diff --git a/.env.example b/.env.example index 62538cbc0..ea79c9a84 100644 --- a/.env.example +++ b/.env.example @@ -1,16 +1 @@ -PORTAL_RUNNER_USERNAME= -PORTAL_RUNNER_PASSWORD= -PORTAL_RUNNER_SUBSCRIPTION= -PORTAL_RUNNER_RESOURCE_GROUP= -PORTAL_RUNNER_DATABASE_ACCOUNT= -PORTAL_RUNNER_DATABASE_ACCOUNT_KEY= -PORTAL_RUNNER_MONGO_DATABASE_ACCOUNT= -PORTAL_RUNNER_MONGO_DATABASE_ACCOUNT_KEY= -PORTAL_RUNNER_CONNECTION_STRING= -NOTEBOOKS_TEST_RUNNER_TENANT_ID= -NOTEBOOKS_TEST_RUNNER_CLIENT_ID= -NOTEBOOKS_TEST_RUNNER_CLIENT_SECRET= -CASSANDRA_CONNECTION_STRING= -MONGO_CONNECTION_STRING= -TABLES_CONNECTION_STRING= DATA_EXPLORER_ENDPOINT=https://localhost:1234/hostedExplorer.html \ No newline at end of file diff --git a/.eslintignore b/.eslintignore index a79ba59fc..8ac793665 100644 --- a/.eslintignore +++ b/.eslintignore @@ -1,37 +1,26 @@ **/node_modules/ +src/**/__mocks__/**/* dist/ Contracts/ src/Api/Apis.ts src/AuthType.ts src/Bindings/BindingHandlersRegisterer.ts src/Bindings/ReactBindingHandler.ts -src/Common/ArrayHashMap.ts src/Common/Constants.ts src/Common/CosmosClient.test.ts src/Common/CosmosClient.ts src/Common/DataAccessUtilityBase.test.ts src/Common/DataAccessUtilityBase.ts -src/Common/DeleteFeedback.ts -src/Common/DocumentClientUtilityBase.ts src/Common/EditableUtility.ts src/Common/HashMap.test.ts -src/Common/HashMap.ts -src/Common/HeadersUtility.test.ts -src/Common/HeadersUtility.ts -src/Common/IteratorUtilities.test.ts -src/Common/IteratorUtilities.ts src/Common/Logger.test.ts src/Common/MessageHandler.test.ts src/Common/MessageHandler.ts src/Common/MongoProxyClient.test.ts src/Common/MongoUtility.ts src/Common/NotificationsClientBase.ts -src/Common/ObjectCache.test.ts -src/Common/ObjectCache.ts src/Common/QueriesClient.ts src/Common/Splitter.ts -src/Common/ThemeUtility.ts -src/Common/UrlUtility.ts src/Config.ts src/Contracts/ActionContracts.ts src/Contracts/DataModels.ts @@ -53,13 +42,9 @@ src/Definitions/jquery.d.ts src/Definitions/plotly.js-cartesian-dist.d-min.ts src/Definitions/png.d.ts src/Definitions/svg.d.ts -src/Definitions/worker.d.ts src/Explorer/ComponentRegisterer.test.ts src/Explorer/ComponentRegisterer.ts -src/Explorer/ContextMenuButtonFactory.ts src/Explorer/Controls/CollapsiblePanel/CollapsiblePanelComponent.ts -src/Explorer/Controls/CommandButton/CommandButton.test.ts -src/Explorer/Controls/CommandButton/CommandButton.ts src/Explorer/Controls/DiffEditor/DiffEditorComponent.ts src/Explorer/Controls/DynamicList/DynamicList.test.ts src/Explorer/Controls/DynamicList/DynamicListComponent.ts @@ -68,7 +53,6 @@ src/Explorer/Controls/ErrorDisplayComponent/ErrorDisplayComponent.ts src/Explorer/Controls/InputTypeahead/InputTypeahead.ts src/Explorer/Controls/JsonEditor/JsonEditorComponent.ts src/Explorer/Controls/Notebook/NotebookAppMessageHandler.ts -src/Explorer/Controls/ThroughputInput/ThroughputInput.test.ts src/Explorer/Controls/ThroughputInput/ThroughputInputComponent.ts src/Explorer/Controls/ThroughputInput/ThroughputInputComponentAutoPilotV3.ts src/Explorer/Controls/Toolbar/IToolbarAction.ts @@ -87,7 +71,6 @@ src/Explorer/DataSamples/ContainerSampleGenerator.test.ts src/Explorer/DataSamples/ContainerSampleGenerator.ts src/Explorer/DataSamples/DataSamplesUtil.test.ts src/Explorer/DataSamples/DataSamplesUtil.ts -src/Explorer/Explorer.tsx src/Explorer/Graph/GraphExplorerComponent/ArraysByKeyCache.test.ts src/Explorer/Graph/GraphExplorerComponent/ArraysByKeyCache.ts src/Explorer/Graph/GraphExplorerComponent/D3ForceGraph.test.ts @@ -95,22 +78,12 @@ src/Explorer/Graph/GraphExplorerComponent/D3ForceGraph.ts src/Explorer/Graph/GraphExplorerComponent/EdgeInfoCache.ts src/Explorer/Graph/GraphExplorerComponent/GraphData.test.ts src/Explorer/Graph/GraphExplorerComponent/GraphData.ts -src/Explorer/Graph/GraphExplorerComponent/GraphUtil.test.ts -src/Explorer/Graph/GraphExplorerComponent/GraphUtil.ts src/Explorer/Graph/GraphExplorerComponent/GremlinClient.test.ts src/Explorer/Graph/GraphExplorerComponent/GremlinClient.ts src/Explorer/Graph/GraphExplorerComponent/GremlinSimpleClient.test.ts src/Explorer/Graph/GraphExplorerComponent/GremlinSimpleClient.ts -src/Explorer/Graph/GraphStyleComponent/GraphStyle.test.ts -src/Explorer/Graph/GraphStyleComponent/GraphStyleComponent.ts -src/Explorer/Graph/NewVertexComponent/NewVertex.test.ts -src/Explorer/Graph/NewVertexComponent/NewVertexComponent.ts -src/Explorer/Menus/CommandBar/CommandBarComponentButtonFactory.test.ts -src/Explorer/Menus/CommandBar/CommandBarComponentButtonFactory.ts src/Explorer/Menus/ContextMenu.ts src/Explorer/MostRecentActivity/MostRecentActivity.ts -src/Explorer/Notebook/FileSystemUtil.ts -src/Explorer/Notebook/NTeractUtil.ts src/Explorer/Notebook/NotebookClientV2.ts src/Explorer/Notebook/NotebookComponent/NotebookContentProvider.ts src/Explorer/Notebook/NotebookComponent/__mocks__/rx-jupyter.ts @@ -125,52 +98,17 @@ src/Explorer/Notebook/NotebookContainerClient.ts src/Explorer/Notebook/NotebookContentClient.ts src/Explorer/Notebook/NotebookContentItem.ts src/Explorer/Notebook/NotebookUtil.ts -src/Explorer/OpenActions.test.ts -src/Explorer/OpenActions.ts src/Explorer/OpenActionsStubs.ts -src/Explorer/Panes/AddCollectionPane.test.ts -src/Explorer/Panes/AddCollectionPane.ts -src/Explorer/Panes/AddDatabasePane.test.ts -src/Explorer/Panes/AddDatabasePane.ts -src/Explorer/Panes/BrowseQueriesPane.ts -src/Explorer/Panes/CassandraAddCollectionPane.ts -src/Explorer/Panes/ContextualPaneBase.ts -src/Explorer/Panes/DeleteCollectionConfirmationPane.test.ts -src/Explorer/Panes/DeleteCollectionConfirmationPane.ts -src/Explorer/Panes/DeleteDatabaseConfirmationPane.test.ts -src/Explorer/Panes/DeleteDatabaseConfirmationPane.ts -src/Explorer/Panes/ExecuteSprocParamsPane.ts -src/Explorer/Panes/GraphStylingPane.ts -src/Explorer/Panes/LoadQueryPane.ts -src/Explorer/Panes/NewVertexPane.ts -src/Explorer/Panes/PaneComponents.ts -src/Explorer/Panes/RenewAdHocAccessPane.ts -src/Explorer/Panes/SaveQueryPane.ts -src/Explorer/Panes/SettingsPane.test.ts -src/Explorer/Panes/SettingsPane.ts -src/Explorer/Panes/SetupNotebooksPane.ts -src/Explorer/Panes/StringInputPane.ts -src/Explorer/Panes/SwitchDirectoryPane.ts -src/Explorer/Panes/Tables/AddTableEntityPane.ts -src/Explorer/Panes/Tables/EditTableEntityPane.ts -src/Explorer/Panes/Tables/EntityPropertyViewModel.ts -src/Explorer/Panes/Tables/QuerySelectPane.ts -src/Explorer/Panes/Tables/TableColumnOptionsPane.ts -src/Explorer/Panes/Tables/TableEntityPane.ts src/Explorer/Panes/Tables/Validators/EntityPropertyNameValidator.ts src/Explorer/Panes/Tables/Validators/EntityPropertyValidationCommon.ts src/Explorer/Panes/Tables/Validators/EntityPropertyValueValidator.ts -src/Explorer/Panes/UploadFilePane.ts -src/Explorer/Panes/UploadItemsPane.ts src/Explorer/SplashScreen/SplashScreen.test.ts -src/Explorer/Tables/Constants.ts src/Explorer/Tables/DataTable/CacheBase.ts src/Explorer/Tables/DataTable/DataTableBindingManager.ts src/Explorer/Tables/DataTable/DataTableBuilder.ts src/Explorer/Tables/DataTable/DataTableContextMenu.ts src/Explorer/Tables/DataTable/DataTableOperationManager.ts src/Explorer/Tables/DataTable/DataTableOperations.ts -src/Explorer/Tables/DataTable/DataTableUtilities.ts src/Explorer/Tables/DataTable/DataTableViewModel.ts src/Explorer/Tables/DataTable/TableCommands.ts src/Explorer/Tables/DataTable/TableEntityCache.ts @@ -179,11 +117,8 @@ src/Explorer/Tables/Entities.ts src/Explorer/Tables/QueryBuilder/ClauseGroup.ts src/Explorer/Tables/QueryBuilder/ClauseGroupViewModel.ts src/Explorer/Tables/QueryBuilder/CustomTimestampHelper.ts -src/Explorer/Tables/QueryBuilder/DateTimeUtilities.test.ts -src/Explorer/Tables/QueryBuilder/DateTimeUtilities.ts src/Explorer/Tables/QueryBuilder/QueryBuilderViewModel.ts src/Explorer/Tables/QueryBuilder/QueryClauseViewModel.ts -src/Explorer/Tables/QueryBuilder/QueryViewModel.ts src/Explorer/Tables/TableDataClient.ts src/Explorer/Tables/TableEntityProcessor.ts src/Explorer/Tabs/ConflictsTab.ts @@ -192,197 +127,67 @@ src/Explorer/Tabs/DocumentsTab.test.ts src/Explorer/Tabs/DocumentsTab.ts src/Explorer/Tabs/GraphTab.ts src/Explorer/Tabs/MongoDocumentsTab.ts -src/Explorer/Tabs/MongoQueryTab.ts -src/Explorer/Tabs/MongoShellTab.ts src/Explorer/Tabs/NotebookV2Tab.ts -src/Explorer/Tabs/QueryTab.test.ts -src/Explorer/Tabs/QueryTab.ts -src/Explorer/Tabs/QueryTablesTab.ts src/Explorer/Tabs/ScriptTabBase.ts -src/Explorer/Tabs/StoredProcedureTab.ts src/Explorer/Tabs/TabComponents.ts src/Explorer/Tabs/TabsBase.ts src/Explorer/Tabs/TriggerTab.ts src/Explorer/Tabs/UserDefinedFunctionTab.ts src/Explorer/Tree/AccessibleVerticalList.ts -src/Explorer/Tree/Collection.test.ts src/Explorer/Tree/Collection.ts src/Explorer/Tree/ConflictId.ts -src/Explorer/Tree/Database.ts src/Explorer/Tree/DocumentId.ts src/Explorer/Tree/ObjectId.ts src/Explorer/Tree/ResourceTokenCollection.ts src/Explorer/Tree/StoredProcedure.ts src/Explorer/Tree/TreeComponents.ts src/Explorer/Tree/Trigger.ts -src/Explorer/Tree/UserDefinedFunction.ts src/Explorer/WaitsForTemplateViewModel.ts src/GitHub/GitHubClient.test.ts src/GitHub/GitHubClient.ts src/GitHub/GitHubConnector.ts -src/GitHub/GitHubContentProvider.test.ts -src/GitHub/GitHubContentProvider.ts src/GitHub/GitHubOAuthService.ts -src/HostedExplorer.ts src/Index.ts src/Juno/JunoClient.test.ts src/Juno/JunoClient.ts -src/Main.ts -src/NotebookWorkspaceManager/NotebookWorkspaceManager.ts -src/NotebookWorkspaceManager/NotebookWorkspaceResourceProviderMockClients.ts -src/Platform/Emulator/DataAccessUtility.ts -src/Platform/Emulator/ExplorerFactory.ts -src/Platform/Emulator/Main.ts -src/Platform/Emulator/NotificationsClient.ts -src/Platform/Hosted/ArmResourceUtils.ts src/Platform/Hosted/Authorization.ts -src/Platform/Hosted/DataAccessUtility.ts -src/Platform/Hosted/ExplorerFactory.ts -src/Platform/Hosted/Helpers/ConnectionStringParser.test.ts -src/Platform/Hosted/Main.ts -src/Platform/Hosted/Maint.test.ts -src/Platform/Hosted/NotificationsClient.ts -src/Platform/Portal/DataAccessUtility.ts -src/Platform/Portal/ExplorerFactory.ts -src/Platform/Portal/Main.ts -src/Platform/Portal/NotificationsClient.ts -src/PlatformType.ts src/ReactDevTools.ts -src/ResourceProvider/IResourceProviderClient.test.ts -src/ResourceProvider/IResourceProviderClient.ts -src/ResourceProvider/ResourceProviderClient.ts -src/ResourceProvider/ResourceProviderClientFactory.ts -src/RouteHandlers/RouteHandler.ts -src/RouteHandlers/TabRouteHandler.test.ts -src/RouteHandlers/TabRouteHandler.ts src/Shared/Constants.ts src/Shared/DefaultExperienceUtility.test.ts src/Shared/DefaultExperienceUtility.ts -src/Shared/ExplorerSettings.ts -src/Shared/PriceEstimateCalculator.ts -src/Shared/StorageUtility.test.ts -src/Shared/StorageUtility.ts -src/Shared/StringUtility.test.ts -src/Shared/StringUtility.ts src/Shared/appInsights.ts src/SparkClusterManager/ArcadiaResourceManager.ts src/SparkClusterManager/SparkClusterManager.ts src/Terminal/JupyterLabAppFactory.ts src/Terminal/NotebookAppContracts.d.ts -src/Terminal/index.ts -src/TokenProviders/PortalTokenProvider.ts -src/TokenProviders/TokenProviderFactory.ts -src/Utils/AuthorizationUtils.test.ts -src/Utils/AuthorizationUtils.ts -src/Utils/AutoPilotUtils.test.ts -src/Utils/AutoPilotUtils.ts -src/Utils/DatabaseAccountUtils.test.ts -src/Utils/DatabaseAccountUtils.ts -src/Utils/JunoUtils.ts -src/Utils/MessageValidation.ts -src/Utils/NotebookConfigurationUtils.ts -src/Utils/PricingUtils.test.ts -src/Utils/QueryUtils.test.ts -src/Utils/QueryUtils.ts -src/Utils/StringUtils.test.ts -src/Utils/StringUtils.ts src/applyExplorerBindings.ts src/global.d.ts -src/quickstart.ts src/setupTests.ts -src/workers/upload/definitions.ts -src/workers/upload/index.ts -src/Explorer/Controls/AccessibleElement/AccessibleElement.tsx -src/Explorer/Controls/Accordion/AccordionComponent.tsx -src/Explorer/Controls/AccountSwitch/AccountSwitchComponent.test.tsx -src/Explorer/Controls/AccountSwitch/AccountSwitchComponent.tsx -src/Explorer/Controls/AccountSwitch/AccountSwitchComponentAdapter.tsx -src/Explorer/Controls/Arcadia/ArcadiaMenuPicker.tsx -src/Explorer/Controls/CollapsiblePanel/CollapsiblePanel.tsx -src/Explorer/Controls/CommandButton/CommandButtonComponent.tsx -src/Explorer/Controls/DialogReactComponent/DialogComponent.tsx -src/Explorer/Controls/DialogReactComponent/DialogComponentAdapter.tsx -src/Explorer/Controls/Directory/DefaultDirectoryDropdownComponent.test.tsx -src/Explorer/Controls/Directory/DefaultDirectoryDropdownComponent.tsx -src/Explorer/Controls/Directory/DirectoryComponentAdapter.tsx -src/Explorer/Controls/Directory/DirectoryListComponent.test.tsx -src/Explorer/Controls/Directory/DirectoryListComponent.tsx -src/Explorer/Controls/Editor/EditorReact.tsx src/Explorer/Controls/InputTypeahead/InputTypeaheadComponent.tsx src/Explorer/Controls/Notebook/NotebookTerminalComponent.test.tsx src/Explorer/Controls/Notebook/NotebookTerminalComponent.tsx -src/Explorer/Controls/NotebookViewer/NotebookMetadataComponent.tsx -src/NotebookViewer/NotebookViewer.tsx src/Explorer/Controls/NotebookViewer/NotebookViewerComponent.tsx -src/Explorer/Controls/QueriesGridReactComponent/QueriesGridComponent.tsx -src/Explorer/Controls/QueriesGridReactComponent/QueriesGridComponentAdapter.tsx -src/Explorer/Controls/ResizeSensorReactComponent/ResizeSensorComponent.tsx -src/Explorer/Controls/Spark/ClusterSettingsComponent.tsx -src/Explorer/Controls/Spark/ClusterSettingsComponentAdapter.tsx -src/Explorer/Controls/Tabs/TabComponent.tsx -src/Explorer/Controls/TreeComponent/TreeComponent.test.tsx src/Explorer/Controls/TreeComponent/TreeComponent.tsx -src/Explorer/Graph/GraphExplorerComponent/EditorNeighborsComponent.tsx -src/Explorer/Graph/GraphExplorerComponent/EditorNodePropertiesComponent.test.tsx -src/Explorer/Graph/GraphExplorerComponent/EditorNodePropertiesComponent.tsx src/Explorer/Graph/GraphExplorerComponent/GraphExplorer.test.tsx src/Explorer/Graph/GraphExplorerComponent/GraphExplorer.tsx -src/Explorer/Graph/GraphExplorerComponent/GraphExplorerAdapter.tsx src/Explorer/Graph/GraphExplorerComponent/GraphVizComponent.tsx src/Explorer/Graph/GraphExplorerComponent/LeftPaneComponent.tsx src/Explorer/Graph/GraphExplorerComponent/MiddlePaneComponent.tsx src/Explorer/Graph/GraphExplorerComponent/NodePropertiesComponent.test.tsx src/Explorer/Graph/GraphExplorerComponent/NodePropertiesComponent.tsx -src/Explorer/Graph/GraphExplorerComponent/QueryContainerComponent.tsx -src/Explorer/Graph/GraphExplorerComponent/ReadOnlyNeighborsComponent.tsx src/Explorer/Graph/GraphExplorerComponent/ReadOnlyNodePropertiesComponent.test.tsx src/Explorer/Graph/GraphExplorerComponent/ReadOnlyNodePropertiesComponent.tsx -src/Explorer/Menus/CommandBar/CommandBarComponentAdapter.tsx -src/Explorer/Menus/CommandBar/CommandBarUtil.test.tsx src/Explorer/Menus/CommandBar/CommandBarUtil.tsx -src/Explorer/Menus/CommandBar/MemoryTrackerComponent.tsx -src/Explorer/Menus/NavBar/ControlBarComponent.tsx -src/Explorer/Menus/NavBar/ControlBarComponentAdapter.tsx -src/Explorer/Menus/NavBar/MeControlComponent.test.tsx -src/Explorer/Menus/NavBar/MeControlComponent.tsx -src/Explorer/Menus/NavBar/MeControlComponentAdapter.tsx -src/Explorer/Menus/NotificationConsole/NotificationConsoleComponent.test.tsx -src/Explorer/Menus/NotificationConsole/NotificationConsoleComponent.tsx -src/Explorer/Menus/NotificationConsole/NotificationConsoleComponentAdapter.tsx -src/Explorer/Notebook/NotebookComponent/NotebookComponent.tsx src/Explorer/Notebook/NotebookComponent/NotebookComponentAdapter.tsx src/Explorer/Notebook/NotebookComponent/NotebookComponentBootstrapper.tsx src/Explorer/Notebook/NotebookComponent/VirtualCommandBarComponent.tsx -src/Explorer/Notebook/NotebookComponent/contents/file/index.tsx -src/Explorer/Notebook/NotebookComponent/contents/file/text-file.tsx src/Explorer/Notebook/NotebookComponent/contents/index.tsx -src/Explorer/Notebook/NotebookRenderer/AzureTheme.tsx src/Explorer/Notebook/NotebookRenderer/NotebookReadOnlyRenderer.tsx src/Explorer/Notebook/NotebookRenderer/NotebookRenderer.tsx -src/Explorer/Notebook/NotebookRenderer/Prompt.tsx -src/Explorer/Notebook/NotebookRenderer/PromptContent.tsx -src/Explorer/Notebook/NotebookRenderer/StatusBar.test.tsx -src/Explorer/Notebook/NotebookRenderer/StatusBar.tsx -src/Explorer/Notebook/NotebookRenderer/Toolbar.tsx -src/Explorer/Notebook/NotebookRenderer/decorators/CellCreator.tsx -src/Explorer/Notebook/NotebookRenderer/decorators/CellLabeler.tsx -src/Explorer/Notebook/NotebookRenderer/decorators/HoverableCell.tsx src/Explorer/Notebook/NotebookRenderer/decorators/draggable/index.tsx src/Explorer/Notebook/NotebookRenderer/decorators/hijack-scroll/index.tsx src/Explorer/Notebook/NotebookRenderer/decorators/kbd-shortcuts/index.tsx src/Explorer/Notebook/temp/inputs/connected-editors/codemirror.tsx -src/Explorer/Notebook/temp/inputs/editor.tsx -src/Explorer/Notebook/temp/markdown-cell.tsx -src/Explorer/Notebook/temp/source.tsx -src/Explorer/Notebook/temp/syntax-highlighter/index.tsx -src/Explorer/SplashScreen/SplashScreen.tsx -src/Explorer/Tabs/GalleryTab.tsx -src/Explorer/Tabs/NotebookViewerTab.tsx -src/Explorer/Tabs/TerminalTab.tsx src/Explorer/Tree/ResourceTreeAdapter.tsx -src/Explorer/Tree/ResourceTreeAdapterForResourceToken.tsx -src/GalleryViewer/Cards/GalleryCardComponent.tsx -src/GalleryViewer/GalleryViewer.tsx -src/GalleryViewer/GalleryViewerComponent.tsx __mocks__/monaco-editor.ts -src/Explorer/Tree/ResourceTreeAdapterForResourceToken.test.tsx \ No newline at end of file +src/Explorer/Tree/ResourceTree.tsx \ No newline at end of file diff --git a/.eslintrc.js b/.eslintrc.js index c1b67a931..f32961a91 100644 --- a/.eslintrc.js +++ b/.eslintrc.js @@ -3,7 +3,7 @@ module.exports = { browser: true, es6: true, }, - plugins: ["@typescript-eslint", "no-null", "prefer-arrow"], + plugins: ["@typescript-eslint", "no-null", "prefer-arrow", "react-hooks"], extends: ["eslint:recommended", "plugin:@typescript-eslint/recommended"], globals: { Atomics: "readonly", @@ -11,6 +11,7 @@ module.exports = { }, parser: "@typescript-eslint/parser", parserOptions: { + project: ["./tsconfig.json", "./tsconfig.test.json"], ecmaFeatures: { jsx: true, }, @@ -20,7 +21,7 @@ module.exports = { overrides: [ { files: ["**/*.tsx"], - extends: ["plugin:react/recommended"], // TODO: Add react-hooks + extends: ["plugin:react/recommended"], plugins: ["react"], }, { @@ -35,6 +36,7 @@ module.exports = { rules: { "no-console": ["error", { allow: ["error", "warn", "dir"] }], curly: "error", + "@typescript-eslint/switch-exhaustiveness-check": "error", "@typescript-eslint/no-unused-vars": "error", "@typescript-eslint/no-extraneous-class": "error", "no-null/no-null": "error", @@ -42,6 +44,8 @@ module.exports = { "prefer-arrow/prefer-arrow-functions": ["error", { allowStandaloneDeclarations: true }], eqeqeq: "error", "react/display-name": "off", + "react-hooks/rules-of-hooks": "warn", // TODO: error + "react-hooks/exhaustive-deps": "warn", // TODO: error "no-restricted-syntax": [ "error", { diff --git a/.github/PULL_REQUEST_TEMPLATE.md b/.github/PULL_REQUEST_TEMPLATE.md new file mode 100644 index 000000000..d2f7952c6 --- /dev/null +++ b/.github/PULL_REQUEST_TEMPLATE.md @@ -0,0 +1 @@ +[Preview this branch](https://cosmos-explorer-preview.azurewebsites.net/pull/EDIT_THIS_NUMBER_IN_THE_PR_DESCRIPTION?feature.someFeatureFlagYouMightNeed=true) diff --git a/.github/dependabot.yml b/.github/dependabot.yml new file mode 100644 index 000000000..60fa0ee1a --- /dev/null +++ b/.github/dependabot.yml @@ -0,0 +1,9 @@ +# Please see the documentation for all configuration options: +# https://help.github.com/github/administering-a-repository/configuration-options-for-dependency-updates + +version: 2 +updates: + - package-ecosystem: "npm" + directory: "/" + schedule: + interval: "daily" diff --git a/.github/workflows/ci.yml b/.github/workflows/ci.yml index 981514009..8e62e4423 100644 --- a/.github/workflows/ci.yml +++ b/.github/workflows/ci.yml @@ -15,10 +15,10 @@ jobs: if: github.ref == 'refs/heads/master' steps: - uses: actions/checkout@v2 - - name: Use Node.js 12.x + - name: Use Node.js 14.x uses: actions/setup-node@v1 with: - node-version: 12.x + node-version: 14.x - run: npm ci - run: node utils/codeMetrics.js env: @@ -28,10 +28,10 @@ jobs: name: "Compile TypeScript" steps: - uses: actions/checkout@v2 - - name: Use Node.js 12.x + - name: Use Node.js 14.x uses: actions/setup-node@v1 with: - node-version: 12.x + node-version: 14.x - run: npm ci - run: npm run compile - run: npm run compile:strict @@ -40,10 +40,10 @@ jobs: name: "Check Format" steps: - uses: actions/checkout@v2 - - name: Use Node.js 12.x + - name: Use Node.js 14.x uses: actions/setup-node@v1 with: - node-version: 12.x + node-version: 14.x - run: npm ci - run: npm run format:check lint: @@ -51,10 +51,10 @@ jobs: name: "Lint" steps: - uses: actions/checkout@v2 - - name: Use Node.js 12.x + - name: Use Node.js 14.x uses: actions/setup-node@v1 with: - node-version: 12.x + node-version: 14.x - run: npm ci - run: npm run lint unittest: @@ -62,22 +62,21 @@ jobs: name: "Unit Tests" steps: - uses: actions/checkout@v2 - - name: Use Node.js 12.x + - name: Use Node.js 14.x uses: actions/setup-node@v1 with: - node-version: 12.x + node-version: 14.x - run: npm ci - run: npm run test build: runs-on: ubuntu-latest - needs: [lint, format, compile, unittest] name: "Build" steps: - uses: actions/checkout@v2 - - name: Use Node.js 12.x + - name: Use Node.js 14.x uses: actions/setup-node@v1 with: - node-version: 12.x + node-version: 14.x - run: npm ci - run: npm run build:contracts - name: Restore Build Cache @@ -92,16 +91,25 @@ jobs: with: name: dist path: dist/ + - name: Upload build to preview blob storage + run: az storage blob upload-batch -d '$web' -s 'dist' --account-name cosmosexplorerpreview --subscription cosmosdb-portalteam-generaldemo --destination-path "${{github.event.pull_request.head.sha || github.sha}}" --account-key="${PREVIEW_STORAGE_KEY}" + env: + PREVIEW_STORAGE_KEY: ${{ secrets.PREVIEW_STORAGE_KEY }} + - name: Upload preview config to blob storage + run: az storage blob upload -c '$web' -f ./preview/config.json --account-name cosmosexplorerpreview --subscription cosmosdb-portalteam-generaldemo --name "${{github.event.pull_request.head.sha || github.sha}}/config.json" --account-key="${PREVIEW_STORAGE_KEY}" + env: + PREVIEW_STORAGE_KEY: ${{ secrets.PREVIEW_STORAGE_KEY }} endtoendemulator: name: "End To End Emulator Tests" - needs: [lint, format, compile, unittest] + # Temporarily disabled. This test needs to be rewritten in playwright + if: false runs-on: windows-latest steps: - uses: actions/checkout@v2 - - name: Use Node.js 12.x + - name: Use Node.js 14.x uses: actions/setup-node@v1 with: - node-version: 12.x + node-version: 14.x - uses: southpolesteve/cosmos-emulator-github-action@v1 - name: End to End Tests run: | @@ -119,72 +127,48 @@ jobs: with: name: screenshots path: failed-* - accessibility: - name: "Accessibility | Hosted" - needs: [lint, format, compile, unittest] + endtoend: + name: "E2E" runs-on: ubuntu-latest + env: + NODE_TLS_REJECT_UNAUTHORIZED: 0 + NOTEBOOKS_TEST_RUNNER_CLIENT_SECRET: ${{ secrets.NOTEBOOKS_TEST_RUNNER_CLIENT_SECRET }} + strategy: + fail-fast: false + matrix: + test-file: + - ./test/cassandra/container.spec.ts + - ./test/graph/container.spec.ts + - ./test/sql/container.spec.ts + - ./test/mongo/container.spec.ts + - ./test/mongo/container32.spec.ts + - ./test/selfServe/selfServeExample.spec.ts + - ./test/notebooks/upload.spec.ts + - ./test/sql/resourceToken.spec.ts + - ./test/tables/container.spec.ts steps: - uses: actions/checkout@v2 - - name: Use Node.js 12.x + - name: Use Node.js 14.x uses: actions/setup-node@v1 with: - node-version: 12.x - - name: Accessibility Check + node-version: 14.x + - run: npm ci + - run: npm start & + - run: npm run wait-for-server + - name: ${{ matrix['test-file'] }} run: | - # Ubuntu gets mad when webpack runs too many files watchers - cat /proc/sys/fs/inotify/max_user_watches - sudo sysctl fs.inotify.max_user_watches=524288 - sudo sysctl -p - npm ci - npm start & - npx wait-on -i 5000 https-get://0.0.0.0:1234/ - node utils/accesibilityCheck.js + # Run tests up to three times + for i in $(seq 1 3); do npx jest -c ./jest.config.playwright.js ${{ matrix['test-file'] }} && s=0 && break || s=$? && sleep 1; done; (exit $s) shell: bash - env: - NODE_TLS_REJECT_UNAUTHORIZED: 0 - endtoendhosted: - name: "End to End Hosted Tests" - needs: [lint, format, compile, unittest] - runs-on: ubuntu-latest - steps: - - uses: actions/checkout@v2 - - name: Use Node.js 12.x - uses: actions/setup-node@v1 - with: - node-version: 12.x - - name: End to End Hosted Tests - run: | - npm ci - npm start & - node utils/cleanupDBs.js - npm run wait-for-server - npm run test:e2e - shell: bash - env: - NODE_TLS_REJECT_UNAUTHORIZED: 0 - PORTAL_RUNNER_SUBSCRIPTION: ${{ secrets.PORTAL_RUNNER_SUBSCRIPTION }} - PORTAL_RUNNER_RESOURCE_GROUP: ${{ secrets.PORTAL_RUNNER_RESOURCE_GROUP }} - PORTAL_RUNNER_DATABASE_ACCOUNT: ${{ secrets.PORTAL_RUNNER_DATABASE_ACCOUNT }} - PORTAL_RUNNER_DATABASE_ACCOUNT_KEY: ${{ secrets.PORTAL_RUNNER_DATABASE_ACCOUNT_KEY }} - PORTAL_RUNNER_MONGO_DATABASE_ACCOUNT: ${{ secrets.PORTAL_RUNNER_MONGO_DATABASE_ACCOUNT }} - PORTAL_RUNNER_MONGO_DATABASE_ACCOUNT_KEY: ${{ secrets.PORTAL_RUNNER_MONGO_DATABASE_ACCOUNT_KEY }} - NOTEBOOKS_TEST_RUNNER_TENANT_ID: ${{ secrets.NOTEBOOKS_TEST_RUNNER_TENANT_ID }} - NOTEBOOKS_TEST_RUNNER_CLIENT_ID: ${{ secrets.NOTEBOOKS_TEST_RUNNER_CLIENT_ID }} - NOTEBOOKS_TEST_RUNNER_CLIENT_SECRET: ${{ secrets.NOTEBOOKS_TEST_RUNNER_CLIENT_SECRET }} - PORTAL_RUNNER_CONNECTION_STRING: ${{ secrets.CONNECTION_STRING_SQL }} - MONGO_CONNECTION_STRING: ${{ secrets.CONNECTION_STRING_MONGO }} - CASSANDRA_CONNECTION_STRING: ${{ secrets.CONNECTION_STRING_CASSANDRA }} - TABLES_CONNECTION_STRING: ${{ secrets.CONNECTION_STRING_TABLE }} - DATA_EXPLORER_ENDPOINT: "https://localhost:1234/hostedExplorer.html" - uses: actions/upload-artifact@v2 if: failure() with: name: screenshots - path: failed-* + path: screenshots/ nuget: name: Publish Nuget if: github.ref == 'refs/heads/master' || contains(github.ref, 'hotfix/') || contains(github.ref, 'release/') - needs: [lint, format, compile, build, unittest, endtoendemulator, endtoendhosted, accessibility] + needs: [build] runs-on: ubuntu-latest env: NUGET_SOURCE: ${{ secrets.NUGET_SOURCE }} @@ -200,7 +184,7 @@ jobs: - run: cp ./configs/prod.json config.json - run: nuget sources add -Name "ADO" -Source "$NUGET_SOURCE" -UserName "GitHub" -Password "$AZURE_DEVOPS_PAT" - run: nuget pack -Version "2.0.0-github-${GITHUB_SHA}" - - run: nuget push -Source "$NUGET_SOURCE" -ApiKey Az *.nupkg + - run: nuget push -SkipDuplicate -Source "$NUGET_SOURCE" -ApiKey Az *.nupkg - uses: actions/upload-artifact@v2 name: packages with: @@ -208,7 +192,7 @@ jobs: nugetmpac: name: Publish Nuget MPAC if: github.ref == 'refs/heads/master' || contains(github.ref, 'hotfix/') || contains(github.ref, 'release/') - needs: [lint, format, compile, build, unittest, endtoendemulator, endtoendhosted, accessibility] + needs: [build] runs-on: ubuntu-latest env: NUGET_SOURCE: ${{ secrets.NUGET_SOURCE }} @@ -225,7 +209,7 @@ jobs: - run: sed -i 's/Azure.Cosmos.DB.Data.Explorer/Azure.Cosmos.DB.Data.Explorer.MPAC/g' DataExplorer.nuspec - run: nuget sources add -Name "ADO" -Source "$NUGET_SOURCE" -UserName "GitHub" -Password "$AZURE_DEVOPS_PAT" - run: nuget pack -Version "2.0.0-github-${GITHUB_SHA}" - - run: nuget push -Source "$NUGET_SOURCE" -ApiKey Az *.nupkg + - run: nuget push -SkipDuplicate -Source "$NUGET_SOURCE" -ApiKey Az *.nupkg - uses: actions/upload-artifact@v2 name: packages with: diff --git a/.github/workflows/cleanup.yml b/.github/workflows/cleanup.yml new file mode 100644 index 000000000..9468565b3 --- /dev/null +++ b/.github/workflows/cleanup.yml @@ -0,0 +1,28 @@ +# This is a basic workflow to help you get started with Actions + +name: Cleanup End to End Account Resources + +on: + # Allows you to run this workflow manually from the Actions tab + workflow_dispatch: + schedule: + # Once every hour + - cron: "0 15 * * *" + +# A workflow run is made up of one or more jobs that can run sequentially or in parallel +jobs: + # This workflow contains a single job called "build" + cleanupaccounts: + name: "Cleanup Test Database Accounts" + runs-on: ubuntu-latest + env: + NOTEBOOKS_TEST_RUNNER_CLIENT_ID: ${{ secrets.NOTEBOOKS_TEST_RUNNER_CLIENT_ID }} + NOTEBOOKS_TEST_RUNNER_CLIENT_SECRET: ${{ secrets.NOTEBOOKS_TEST_RUNNER_CLIENT_SECRET }} + steps: + - uses: actions/checkout@v2 + - name: Use Node.js 14.x + uses: actions/setup-node@v1 + with: + node-version: 14.x + - run: npm ci + - run: node utils/cleanupDBs.js diff --git a/.gitignore b/.gitignore index 109e6c4d2..be016240b 100644 --- a/.gitignore +++ b/.gitignore @@ -14,4 +14,6 @@ Contracts/* .DS_Store .cache/ .env -failure.png \ No newline at end of file +failure.png +screenshots/* +GettingStarted-ignore*.ipynb \ No newline at end of file diff --git a/.vscode/settings.json b/.vscode/settings.json index f4c1f6881..ba70984cf 100644 --- a/.vscode/settings.json +++ b/.vscode/settings.json @@ -1,21 +1,26 @@ // Place your settings in this file to overwrite default and user settings. { - "files.exclude": { - ".vs": true, - ".vscode/**": true, - "*.trx": true, - "**/.DS_Store": true, - "**/.git": true, - "**/.hg": true, - "**/.svn": true, - "built/**": true, - "coverage/**": true, - "libs/**": true, - "node_modules/**": true, - "package-lock.json": true, - "quickstart/**": true, - "test/out/**": true, - "workers/libs/**": true - }, - "typescript.tsdk": "node_modules/typescript/lib" -} \ No newline at end of file + "files.exclude": { + ".vs": true, + ".vscode/**": true, + "*.trx": true, + "**/.DS_Store": true, + "**/.git": true, + "**/.hg": true, + "**/.svn": true, + "built/**": true, + "coverage/**": true, + "libs/**": true, + "node_modules/**": true, + "package-lock.json": true, + "quickstart/**": true, + "test/out/**": true, + "workers/libs/**": true + }, + "typescript.tsdk": "node_modules/typescript/lib", + "editor.formatOnSave": true, + "editor.codeActionsOnSave": { + "source.fixAll.eslint": true, + "source.organizeImports": true + } +} diff --git a/CODING_GUIDELINES.md b/CODING_GUIDELINES.md index daa14a470..1014cae8e 100644 --- a/CODING_GUIDELINES.md +++ b/CODING_GUIDELINES.md @@ -153,7 +153,7 @@ Cosmos Explorer has been under constant development for over 5 years. As a resul ✅ DO -- Use [Puppeteer](https://developers.google.com/web/tools/puppeteer) and [Jest](https://jestjs.io/) +- Use [Playwright](https://github.com/microsoft/playwright) and [Jest](https://jestjs.io/) - Write or modify an existing E2E test that covers the primary use case of any major feature. - Use caution. Do not try to cover every case. End to End tests can be slow and brittle. @@ -188,7 +188,3 @@ Cosmos Explorer has been under constant development for over 5 years. As a resul ✅ DO - Support all [browsers supported by the Azure Portal](https://docs.microsoft.com/en-us/azure/azure-portal/azure-portal-supported-browsers-devices) -- Support IE11 - - In practice, this should not need to be considered as part of a normal development workflow - - Polyfills and transpilation are already provided by our engineering systems. - - This requirement will be removed on March 30th, 2021 when Azure drops IE11 support. diff --git a/README.md b/README.md index fb28c5d7a..f82af79ee 100644 --- a/README.md +++ b/README.md @@ -18,7 +18,6 @@ Run `npm start` to start the development server and automatically rebuild on cha ### Hosted Development (https://cosmos.azure.com) - Visit: `https://localhost:1234/hostedExplorer.html` -- Local sign in via AAD will NOT work. Connection string only in dev mode. Use the Portal if you need AAD auth. - The default webpack dev server configuration will proxy requests to the production portal backend: `https://main.documentdb.ext.azure.com`. This will allow you to use production connection strings on your local machine. ### Emulator Development @@ -69,7 +68,7 @@ Jest and Puppeteer are used for end to end browser based tests and are contained We generally adhere to the release strategy [documented by the Azure SDK Guidelines](https://azure.github.io/azure-sdk/policies_repobranching.html#release-branches). Most releases should happen from the master branch. If master contains commits that cannot be released, you may create a release from a `release/` or `hotfix/` branch. See linked documentation for more details. -### Architechture +### Architecture [![](https://mermaid.ink/img/eyJjb2RlIjoiZ3JhcGggTFJcbiAgaG9zdGVkKGh0dHBzOi8vY29zbW9zLmF6dXJlLmNvbSlcbiAgcG9ydGFsKFBvcnRhbClcbiAgZW11bGF0b3IoRW11bGF0b3IpXG4gIGFhZFtBQURdXG4gIHJlc291cmNlVG9rZW5bUmVzb3VyY2UgVG9rZW5dXG4gIGNvbm5lY3Rpb25TdHJpbmdbQ29ubmVjdGlvbiBTdHJpbmddXG4gIHBvcnRhbFRva2VuW0VuY3J5cHRlZCBQb3J0YWwgVG9rZW5dXG4gIG1hc3RlcktleVtNYXN0ZXIgS2V5XVxuICBhcm1bQVJNIFJlc291cmNlIFByb3ZpZGVyXVxuICBkYXRhcGxhbmVbRGF0YSBQbGFuZV1cbiAgcHJveHlbUG9ydGFsIEFQSSBQcm94eV1cbiAgc3FsW1NRTF1cbiAgbW9uZ29bTW9uZ29dXG4gIHRhYmxlc1tUYWJsZXNdXG4gIGNhc3NhbmRyYVtDYXNzYW5kcmFdXG4gIGdyYWZbR3JhcGhdXG5cblxuICBlbXVsYXRvciAtLT4gbWFzdGVyS2V5IC0tLS0-IGRhdGFwbGFuZVxuICBwb3J0YWwgLS0-IGFhZFxuICBob3N0ZWQgLS0-IHBvcnRhbFRva2VuICYgcmVzb3VyY2VUb2tlbiAmIGNvbm5lY3Rpb25TdHJpbmcgJiBhYWRcbiAgYWFkIC0tLT4gYXJtXG4gIGFhZCAtLS0-IGRhdGFwbGFuZVxuICBhYWQgLS0tPiBwcm94eVxuICByZXNvdXJjZVRva2VuIC0tLT4gc3FsIC0tPiBkYXRhcGxhbmVcbiAgcG9ydGFsVG9rZW4gLS0tPiBwcm94eVxuICBwcm94eSAtLT4gZGF0YXBsYW5lXG4gIGNvbm5lY3Rpb25TdHJpbmcgLS0-IHNxbCAmIG1vbmdvICYgY2Fzc2FuZHJhICYgZ3JhZiAmIHRhYmxlc1xuICBzcWwgLS0-IGRhdGFwbGFuZVxuICB0YWJsZXMgLS0-IGRhdGFwbGFuZVxuICBtb25nbyAtLT4gcHJveHlcbiAgY2Fzc2FuZHJhIC0tPiBwcm94eVxuICBncmFmIC0tPiBwcm94eVxuXG5cdFx0IiwibWVybWFpZCI6eyJ0aGVtZSI6ImRlZmF1bHQifSwidXBkYXRlRWRpdG9yIjpmYWxzZX0)](https://mermaid-js.github.io/mermaid-live-editor/#/edit/eyJjb2RlIjoiZ3JhcGggTFJcbiAgaG9zdGVkKGh0dHBzOi8vY29zbW9zLmF6dXJlLmNvbSlcbiAgcG9ydGFsKFBvcnRhbClcbiAgZW11bGF0b3IoRW11bGF0b3IpXG4gIGFhZFtBQURdXG4gIHJlc291cmNlVG9rZW5bUmVzb3VyY2UgVG9rZW5dXG4gIGNvbm5lY3Rpb25TdHJpbmdbQ29ubmVjdGlvbiBTdHJpbmddXG4gIHBvcnRhbFRva2VuW0VuY3J5cHRlZCBQb3J0YWwgVG9rZW5dXG4gIG1hc3RlcktleVtNYXN0ZXIgS2V5XVxuICBhcm1bQVJNIFJlc291cmNlIFByb3ZpZGVyXVxuICBkYXRhcGxhbmVbRGF0YSBQbGFuZV1cbiAgcHJveHlbUG9ydGFsIEFQSSBQcm94eV1cbiAgc3FsW1NRTF1cbiAgbW9uZ29bTW9uZ29dXG4gIHRhYmxlc1tUYWJsZXNdXG4gIGNhc3NhbmRyYVtDYXNzYW5kcmFdXG4gIGdyYWZbR3JhcGhdXG5cblxuICBlbXVsYXRvciAtLT4gbWFzdGVyS2V5IC0tLS0-IGRhdGFwbGFuZVxuICBwb3J0YWwgLS0-IGFhZFxuICBob3N0ZWQgLS0-IHBvcnRhbFRva2VuICYgcmVzb3VyY2VUb2tlbiAmIGNvbm5lY3Rpb25TdHJpbmcgJiBhYWRcbiAgYWFkIC0tLT4gYXJtXG4gIGFhZCAtLS0-IGRhdGFwbGFuZVxuICBhYWQgLS0tPiBwcm94eVxuICByZXNvdXJjZVRva2VuIC0tLT4gc3FsIC0tPiBkYXRhcGxhbmVcbiAgcG9ydGFsVG9rZW4gLS0tPiBwcm94eVxuICBwcm94eSAtLT4gZGF0YXBsYW5lXG4gIGNvbm5lY3Rpb25TdHJpbmcgLS0-IHNxbCAmIG1vbmdvICYgY2Fzc2FuZHJhICYgZ3JhZiAmIHRhYmxlc1xuICBzcWwgLS0-IGRhdGFwbGFuZVxuICB0YWJsZXMgLS0-IGRhdGFwbGFuZVxuICBtb25nbyAtLT4gcHJveHlcbiAgY2Fzc2FuZHJhIC0tPiBwcm94eVxuICBncmFmIC0tPiBwcm94eVxuXG5cdFx0IiwibWVybWFpZCI6eyJ0aGVtZSI6ImRlZmF1bHQifSwidXBkYXRlRWRpdG9yIjpmYWxzZX0) diff --git a/configs/mpac.json b/configs/mpac.json index dd9a572a1..7c270c6d5 100644 --- a/configs/mpac.json +++ b/configs/mpac.json @@ -1,3 +1,3 @@ { - "JUNO_ENDPOINT": "https://tools-staging.cosmos.azure.com" -} + "JUNO_ENDPOINT": "https://tools-staging.cosmos.azure.com" +} \ No newline at end of file diff --git a/docs/assets/css/main.css b/docs/assets/css/main.css new file mode 100644 index 000000000..46571c27c --- /dev/null +++ b/docs/assets/css/main.css @@ -0,0 +1,2660 @@ +:root { + --color-background: #fdfdfd; + --color-text: #222; + --color-text-aside: #707070; + --color-link: #4da6ff; + --color-menu-divider: #eee; + --color-menu-divider-focus: #000; + --color-menu-label: #707070; + --color-panel: #fff; + --color-panel-divider: #eee; + --color-comment-tag: #707070; + --color-comment-tag-text: #fff; + --color-code-background: rgba(0, 0, 0, 0.04); + --color-ts: #9600ff; + --color-ts-interface: #647f1b; + --color-ts-enum: #937210; + --color-ts-class: #0672de; + --color-ts-private: #707070; + --color-toolbar: #fff; + --color-toolbar-text: #333; +} + +/*! normalize.css v1.1.3 | MIT License | git.io/normalize */ +/* ========================================================================== + * * HTML5 display definitions + * * ========================================================================== */ +/** + * * Correct `block` display not defined in IE 6/7/8/9 and Firefox 3. */ +article, aside, details, figcaption, figure, footer, header, hgroup, main, nav, section, summary { + display: block; +} + +/** + * * Correct `inline-block` display not defined in IE 6/7/8/9 and Firefox 3. */ +audio, canvas, video { + display: inline-block; + *display: inline; + *zoom: 1; +} + +/** + * * Prevent modern browsers from displaying `audio` without controls. + * * Remove excess height in iOS 5 devices. */ +audio:not([controls]) { + display: none; + height: 0; +} + +/** + * * Address styling not present in IE 7/8/9, Firefox 3, and Safari 4. + * * Known issue: no IE 6 support. */ +[hidden] { + display: none; +} + +/* ========================================================================== + * * Base + * * ========================================================================== */ +/** + * * 1. Correct text resizing oddly in IE 6/7 when body `font-size` is set using + * * `em` units. + * * 2. Prevent iOS text size adjust after orientation change, without disabling + * * user zoom. */ +html { + font-size: 100%; + /* 1 */ + -ms-text-size-adjust: 100%; + /* 2 */ + -webkit-text-size-adjust: 100%; + /* 2 */ + font-family: sans-serif; +} + +/** + * * Address `font-family` inconsistency between `textarea` and other form + * * elements. */ +button, input, select, textarea { + font-family: sans-serif; +} + +/** + * * Address margins handled incorrectly in IE 6/7. */ +body { + margin: 0; +} + +/* ========================================================================== + * * Links + * * ========================================================================== */ +/** + * * Address `outline` inconsistency between Chrome and other browsers. */ +a:focus { + outline: thin dotted; +} +a:active, a:hover { + outline: 0; +} + +/** + * * Improve readability when focused and also mouse hovered in all browsers. */ +/* ========================================================================== + * * Typography + * * ========================================================================== */ +/** + * * Address font sizes and margins set differently in IE 6/7. + * * Address font sizes within `section` and `article` in Firefox 4+, Safari 5, + * * and Chrome. */ +h1 { + font-size: 2em; + margin: 0.67em 0; +} + +h2 { + font-size: 1.5em; + margin: 0.83em 0; +} + +h3 { + font-size: 1.17em; + margin: 1em 0; +} + +h4, .tsd-index-panel h3 { + font-size: 1em; + margin: 1.33em 0; +} + +h5 { + font-size: 0.83em; + margin: 1.67em 0; +} + +h6 { + font-size: 0.67em; + margin: 2.33em 0; +} + +/** + * * Address styling not present in IE 7/8/9, Safari 5, and Chrome. */ +abbr[title] { + border-bottom: 1px dotted; +} + +/** + * * Address style set to `bolder` in Firefox 3+, Safari 4/5, and Chrome. */ +b, strong { + font-weight: bold; +} + +blockquote { + margin: 1em 40px; +} + +/** + * * Address styling not present in Safari 5 and Chrome. */ +dfn { + font-style: italic; +} + +/** + * * Address differences between Firefox and other browsers. + * * Known issue: no IE 6/7 normalization. */ +hr { + -moz-box-sizing: content-box; + box-sizing: content-box; + height: 0; +} + +/** + * * Address styling not present in IE 6/7/8/9. */ +mark { + background: #ff0; + color: #000; +} + +/** + * * Address margins set differently in IE 6/7. */ +p, pre { + margin: 1em 0; +} + +/** + * * Correct font family set oddly in IE 6, Safari 4/5, and Chrome. */ +code, kbd, pre, samp { + font-family: monospace, serif; + _font-family: "courier new", monospace; + font-size: 1em; +} + +/** + * * Improve readability of pre-formatted text in all browsers. */ +pre { + white-space: pre; + white-space: pre-wrap; + word-wrap: break-word; +} + +/** + * * Address CSS quotes not supported in IE 6/7. */ +q { + quotes: none; +} +q:before, q:after { + content: ""; + content: none; +} + +/** + * * Address `quotes` property not supported in Safari 4. */ +/** + * * Address inconsistent and variable font size in all browsers. */ +small { + font-size: 80%; +} + +/** + * * Prevent `sub` and `sup` affecting `line-height` in all browsers. */ +sub { + font-size: 75%; + line-height: 0; + position: relative; + vertical-align: baseline; +} + +sup { + font-size: 75%; + line-height: 0; + position: relative; + vertical-align: baseline; + top: -0.5em; +} + +sub { + bottom: -0.25em; +} + +/* ========================================================================== + * * Lists + * * ========================================================================== */ +/** + * * Address margins set differently in IE 6/7. */ +dl, menu, ol, ul { + margin: 1em 0; +} + +dd { + margin: 0 0 0 40px; +} + +/** + * * Address paddings set differently in IE 6/7. */ +menu, ol, ul { + padding: 0 0 0 40px; +} + +/** + * * Correct list images handled incorrectly in IE 7. */ +nav ul, nav ol { + list-style: none; + list-style-image: none; +} + +/* ========================================================================== + * * Embedded content + * * ========================================================================== */ +/** + * * 1. Remove border when inside `a` element in IE 6/7/8/9 and Firefox 3. + * * 2. Improve image quality when scaled in IE 7. */ +img { + border: 0; + /* 1 */ + -ms-interpolation-mode: bicubic; +} + +/* 2 */ +/** + * * Correct overflow displayed oddly in IE 9. */ +svg:not(:root) { + overflow: hidden; +} + +/* ========================================================================== + * * Figures + * * ========================================================================== */ +/** + * * Address margin not present in IE 6/7/8/9, Safari 5, and Opera 11. */ +figure, form { + margin: 0; +} + +/* ========================================================================== + * * Forms + * * ========================================================================== */ +/** + * * Correct margin displayed oddly in IE 6/7. */ +/** + * * Define consistent border, margin, and padding. */ +fieldset { + border: 1px solid #c0c0c0; + margin: 0 2px; + padding: 0.35em 0.625em 0.75em; +} + +/** + * * 1. Correct color not being inherited in IE 6/7/8/9. + * * 2. Correct text not wrapping in Firefox 3. + * * 3. Correct alignment displayed oddly in IE 6/7. */ +legend { + border: 0; + /* 1 */ + padding: 0; + white-space: normal; + /* 2 */ + *margin-left: -7px; +} + +/* 3 */ +/** + * * 1. Correct font size not being inherited in all browsers. + * * 2. Address margins set differently in IE 6/7, Firefox 3+, Safari 5, + * * and Chrome. + * * 3. Improve appearance and consistency in all browsers. */ +button, input, select, textarea { + font-size: 100%; + /* 1 */ + margin: 0; + /* 2 */ + vertical-align: baseline; + /* 3 */ + *vertical-align: middle; +} + +/* 3 */ +/** + * * Address Firefox 3+ setting `line-height` on `input` using `!important` in + * * the UA stylesheet. */ +button, input { + line-height: normal; +} + +/** + * * Address inconsistent `text-transform` inheritance for `button` and `select`. + * * All other form control elements do not inherit `text-transform` values. + * * Correct `button` style inheritance in Chrome, Safari 5+, and IE 6+. + * * Correct `select` style inheritance in Firefox 4+ and Opera. */ +button, select { + text-transform: none; +} + +/** + * * 1. Avoid the WebKit bug in Android 4.0.* where (2) destroys native `audio` + * * and `video` controls. + * * 2. Correct inability to style clickable `input` types in iOS. + * * 3. Improve usability and consistency of cursor style between image-type + * * `input` and others. + * * 4. Remove inner spacing in IE 7 without affecting normal text inputs. + * * Known issue: inner spacing remains in IE 6. */ +button, html input[type=button] { + -webkit-appearance: button; + /* 2 */ + cursor: pointer; + /* 3 */ + *overflow: visible; +} + +/* 4 */ +input[type=reset], input[type=submit] { + -webkit-appearance: button; + /* 2 */ + cursor: pointer; + /* 3 */ + *overflow: visible; +} + +/* 4 */ +/** + * * Re-set default cursor for disabled elements. */ +button[disabled], html input[disabled] { + cursor: default; +} + +/** + * * 1. Address box sizing set to content-box in IE 8/9. + * * 2. Remove excess padding in IE 8/9. + * * 3. Remove excess padding in IE 7. + * * Known issue: excess padding remains in IE 6. */ +input { + /* 3 */ +} +input[type=checkbox], input[type=radio] { + box-sizing: border-box; + /* 1 */ + padding: 0; + /* 2 */ + *height: 13px; + /* 3 */ + *width: 13px; +} +input[type=search] { + -webkit-appearance: textfield; + /* 1 */ + -moz-box-sizing: content-box; + -webkit-box-sizing: content-box; + /* 2 */ + box-sizing: content-box; +} +input[type=search]::-webkit-search-cancel-button, input[type=search]::-webkit-search-decoration { + -webkit-appearance: none; +} + +/** + * * 1. Address `appearance` set to `searchfield` in Safari 5 and Chrome. + * * 2. Address `box-sizing` set to `border-box` in Safari 5 and Chrome + * * (include `-moz` to future-proof). */ +/** + * * Remove inner padding and search cancel button in Safari 5 and Chrome + * * on OS X. */ +/** + * * Remove inner padding and border in Firefox 3+. */ +button::-moz-focus-inner, input::-moz-focus-inner { + border: 0; + padding: 0; +} + +/** + * * 1. Remove default vertical scrollbar in IE 6/7/8/9. + * * 2. Improve readability and alignment in all browsers. */ +textarea { + overflow: auto; + /* 1 */ + vertical-align: top; +} + +/* 2 */ +/* ========================================================================== + * * Tables + * * ========================================================================== */ +/** + * * Remove most spacing between table cells. */ +table { + border-collapse: collapse; + border-spacing: 0; +} + +ul.tsd-descriptions > li > :first-child, .tsd-panel > :first-child, .col > :first-child, .col-11 > :first-child, .col-10 > :first-child, .col-9 > :first-child, .col-8 > :first-child, .col-7 > :first-child, .col-6 > :first-child, .col-5 > :first-child, .col-4 > :first-child, .col-3 > :first-child, .col-2 > :first-child, .col-1 > :first-child, +ul.tsd-descriptions > li > :first-child > :first-child, +.tsd-panel > :first-child > :first-child, +.col > :first-child > :first-child, +.col-11 > :first-child > :first-child, +.col-10 > :first-child > :first-child, +.col-9 > :first-child > :first-child, +.col-8 > :first-child > :first-child, +.col-7 > :first-child > :first-child, +.col-6 > :first-child > :first-child, +.col-5 > :first-child > :first-child, +.col-4 > :first-child > :first-child, +.col-3 > :first-child > :first-child, +.col-2 > :first-child > :first-child, +.col-1 > :first-child > :first-child, +ul.tsd-descriptions > li > :first-child > :first-child > :first-child, +.tsd-panel > :first-child > :first-child > :first-child, +.col > :first-child > :first-child > :first-child, +.col-11 > :first-child > :first-child > :first-child, +.col-10 > :first-child > :first-child > :first-child, +.col-9 > :first-child > :first-child > :first-child, +.col-8 > :first-child > :first-child > :first-child, +.col-7 > :first-child > :first-child > :first-child, +.col-6 > :first-child > :first-child > :first-child, +.col-5 > :first-child > :first-child > :first-child, +.col-4 > :first-child > :first-child > :first-child, +.col-3 > :first-child > :first-child > :first-child, +.col-2 > :first-child > :first-child > :first-child, +.col-1 > :first-child > :first-child > :first-child { + margin-top: 0; +} +ul.tsd-descriptions > li > :last-child, .tsd-panel > :last-child, .col > :last-child, .col-11 > :last-child, .col-10 > :last-child, .col-9 > :last-child, .col-8 > :last-child, .col-7 > :last-child, .col-6 > :last-child, .col-5 > :last-child, .col-4 > :last-child, .col-3 > :last-child, .col-2 > :last-child, .col-1 > :last-child, +ul.tsd-descriptions > li > :last-child > :last-child, +.tsd-panel > :last-child > :last-child, +.col > :last-child > :last-child, +.col-11 > :last-child > :last-child, +.col-10 > :last-child > :last-child, +.col-9 > :last-child > :last-child, +.col-8 > :last-child > :last-child, +.col-7 > :last-child > :last-child, +.col-6 > :last-child > :last-child, +.col-5 > :last-child > :last-child, +.col-4 > :last-child > :last-child, +.col-3 > :last-child > :last-child, +.col-2 > :last-child > :last-child, +.col-1 > :last-child > :last-child, +ul.tsd-descriptions > li > :last-child > :last-child > :last-child, +.tsd-panel > :last-child > :last-child > :last-child, +.col > :last-child > :last-child > :last-child, +.col-11 > :last-child > :last-child > :last-child, +.col-10 > :last-child > :last-child > :last-child, +.col-9 > :last-child > :last-child > :last-child, +.col-8 > :last-child > :last-child > :last-child, +.col-7 > :last-child > :last-child > :last-child, +.col-6 > :last-child > :last-child > :last-child, +.col-5 > :last-child > :last-child > :last-child, +.col-4 > :last-child > :last-child > :last-child, +.col-3 > :last-child > :last-child > :last-child, +.col-2 > :last-child > :last-child > :last-child, +.col-1 > :last-child > :last-child > :last-child { + margin-bottom: 0; +} + +.container { + max-width: 1200px; + margin: 0 auto; + padding: 0 40px; +} +@media (max-width: 640px) { + .container { + padding: 0 20px; + } +} + +.container-main { + padding-bottom: 200px; +} + +.row { + display: flex; + position: relative; + margin: 0 -10px; +} +.row:after { + visibility: hidden; + display: block; + content: ""; + clear: both; + height: 0; +} + +.col, .col-11, .col-10, .col-9, .col-8, .col-7, .col-6, .col-5, .col-4, .col-3, .col-2, .col-1 { + box-sizing: border-box; + float: left; + padding: 0 10px; +} + +.col-1 { + width: 8.3333333333%; +} + +.offset-1 { + margin-left: 8.3333333333%; +} + +.col-2 { + width: 16.6666666667%; +} + +.offset-2 { + margin-left: 16.6666666667%; +} + +.col-3 { + width: 25%; +} + +.offset-3 { + margin-left: 25%; +} + +.col-4 { + width: 33.3333333333%; +} + +.offset-4 { + margin-left: 33.3333333333%; +} + +.col-5 { + width: 41.6666666667%; +} + +.offset-5 { + margin-left: 41.6666666667%; +} + +.col-6 { + width: 50%; +} + +.offset-6 { + margin-left: 50%; +} + +.col-7 { + width: 58.3333333333%; +} + +.offset-7 { + margin-left: 58.3333333333%; +} + +.col-8 { + width: 66.6666666667%; +} + +.offset-8 { + margin-left: 66.6666666667%; +} + +.col-9 { + width: 75%; +} + +.offset-9 { + margin-left: 75%; +} + +.col-10 { + width: 83.3333333333%; +} + +.offset-10 { + margin-left: 83.3333333333%; +} + +.col-11 { + width: 91.6666666667%; +} + +.offset-11 { + margin-left: 91.6666666667%; +} + +.tsd-kind-icon { + display: block; + position: relative; + padding-left: 20px; + text-indent: -20px; +} +.tsd-kind-icon:before { + content: ""; + display: inline-block; + vertical-align: middle; + width: 17px; + height: 17px; + margin: 0 3px 2px 0; + background-image: url(../images/icons.png); +} +@media (-webkit-min-device-pixel-ratio: 1.5), (min-resolution: 144dpi) { + .tsd-kind-icon:before { + background-image: url(../images/icons@2x.png); + background-size: 238px 204px; + } +} + +.tsd-signature.tsd-kind-icon:before { + background-position: 0 -153px; +} + +.tsd-kind-object-literal > .tsd-kind-icon:before { + background-position: 0px -17px; +} +.tsd-kind-object-literal.tsd-is-protected > .tsd-kind-icon:before { + background-position: -17px -17px; +} +.tsd-kind-object-literal.tsd-is-private > .tsd-kind-icon:before { + background-position: -34px -17px; +} + +.tsd-kind-class > .tsd-kind-icon:before { + background-position: 0px -34px; +} +.tsd-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -17px -34px; +} +.tsd-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -34px -34px; +} + +.tsd-kind-class.tsd-has-type-parameter > .tsd-kind-icon:before { + background-position: 0px -51px; +} +.tsd-kind-class.tsd-has-type-parameter.tsd-is-protected > .tsd-kind-icon:before { + background-position: -17px -51px; +} +.tsd-kind-class.tsd-has-type-parameter.tsd-is-private > .tsd-kind-icon:before { + background-position: -34px -51px; +} + +.tsd-kind-interface > .tsd-kind-icon:before { + background-position: 0px -68px; +} +.tsd-kind-interface.tsd-is-protected > .tsd-kind-icon:before { + background-position: -17px -68px; +} +.tsd-kind-interface.tsd-is-private > .tsd-kind-icon:before { + background-position: -34px -68px; +} + +.tsd-kind-interface.tsd-has-type-parameter > .tsd-kind-icon:before { + background-position: 0px -85px; +} +.tsd-kind-interface.tsd-has-type-parameter.tsd-is-protected > .tsd-kind-icon:before { + background-position: -17px -85px; +} +.tsd-kind-interface.tsd-has-type-parameter.tsd-is-private > .tsd-kind-icon:before { + background-position: -34px -85px; +} + +.tsd-kind-namespace > .tsd-kind-icon:before { + background-position: 0px -102px; +} +.tsd-kind-namespace.tsd-is-protected > .tsd-kind-icon:before { + background-position: -17px -102px; +} +.tsd-kind-namespace.tsd-is-private > .tsd-kind-icon:before { + background-position: -34px -102px; +} + +.tsd-kind-module > .tsd-kind-icon:before { + background-position: 0px -102px; +} +.tsd-kind-module.tsd-is-protected > .tsd-kind-icon:before { + background-position: -17px -102px; +} +.tsd-kind-module.tsd-is-private > .tsd-kind-icon:before { + background-position: -34px -102px; +} + +.tsd-kind-enum > .tsd-kind-icon:before { + background-position: 0px -119px; +} +.tsd-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -17px -119px; +} +.tsd-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -34px -119px; +} + +.tsd-kind-enum-member > .tsd-kind-icon:before { + background-position: 0px -136px; +} +.tsd-kind-enum-member.tsd-is-protected > .tsd-kind-icon:before { + background-position: -17px -136px; +} +.tsd-kind-enum-member.tsd-is-private > .tsd-kind-icon:before { + background-position: -34px -136px; +} + +.tsd-kind-signature > .tsd-kind-icon:before { + background-position: 0px -153px; +} +.tsd-kind-signature.tsd-is-protected > .tsd-kind-icon:before { + background-position: -17px -153px; +} +.tsd-kind-signature.tsd-is-private > .tsd-kind-icon:before { + background-position: -34px -153px; +} + +.tsd-kind-type-alias > .tsd-kind-icon:before { + background-position: 0px -170px; +} +.tsd-kind-type-alias.tsd-is-protected > .tsd-kind-icon:before { + background-position: -17px -170px; +} +.tsd-kind-type-alias.tsd-is-private > .tsd-kind-icon:before { + background-position: -34px -170px; +} + +.tsd-kind-type-alias.tsd-has-type-parameter > .tsd-kind-icon:before { + background-position: 0px -187px; +} +.tsd-kind-type-alias.tsd-has-type-parameter.tsd-is-protected > .tsd-kind-icon:before { + background-position: -17px -187px; +} +.tsd-kind-type-alias.tsd-has-type-parameter.tsd-is-private > .tsd-kind-icon:before { + background-position: -34px -187px; +} + +.tsd-kind-variable > .tsd-kind-icon:before { + background-position: -136px -0px; +} +.tsd-kind-variable.tsd-is-protected > .tsd-kind-icon:before { + background-position: -153px -0px; +} +.tsd-kind-variable.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -0px; +} +.tsd-kind-variable.tsd-parent-kind-class > .tsd-kind-icon:before { + background-position: -51px -0px; +} +.tsd-kind-variable.tsd-parent-kind-class.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -68px -0px; +} +.tsd-kind-variable.tsd-parent-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -85px -0px; +} +.tsd-kind-variable.tsd-parent-kind-class.tsd-is-protected.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -102px -0px; +} +.tsd-kind-variable.tsd-parent-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -0px; +} +.tsd-kind-variable.tsd-parent-kind-enum > .tsd-kind-icon:before { + background-position: -170px -0px; +} +.tsd-kind-variable.tsd-parent-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -187px -0px; +} +.tsd-kind-variable.tsd-parent-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -0px; +} +.tsd-kind-variable.tsd-parent-kind-interface > .tsd-kind-icon:before { + background-position: -204px -0px; +} +.tsd-kind-variable.tsd-parent-kind-interface.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -221px -0px; +} + +.tsd-kind-property > .tsd-kind-icon:before { + background-position: -136px -0px; +} +.tsd-kind-property.tsd-is-protected > .tsd-kind-icon:before { + background-position: -153px -0px; +} +.tsd-kind-property.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -0px; +} +.tsd-kind-property.tsd-parent-kind-class > .tsd-kind-icon:before { + background-position: -51px -0px; +} +.tsd-kind-property.tsd-parent-kind-class.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -68px -0px; +} +.tsd-kind-property.tsd-parent-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -85px -0px; +} +.tsd-kind-property.tsd-parent-kind-class.tsd-is-protected.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -102px -0px; +} +.tsd-kind-property.tsd-parent-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -0px; +} +.tsd-kind-property.tsd-parent-kind-enum > .tsd-kind-icon:before { + background-position: -170px -0px; +} +.tsd-kind-property.tsd-parent-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -187px -0px; +} +.tsd-kind-property.tsd-parent-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -0px; +} +.tsd-kind-property.tsd-parent-kind-interface > .tsd-kind-icon:before { + background-position: -204px -0px; +} +.tsd-kind-property.tsd-parent-kind-interface.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -221px -0px; +} + +.tsd-kind-get-signature > .tsd-kind-icon:before { + background-position: -136px -17px; +} +.tsd-kind-get-signature.tsd-is-protected > .tsd-kind-icon:before { + background-position: -153px -17px; +} +.tsd-kind-get-signature.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -17px; +} +.tsd-kind-get-signature.tsd-parent-kind-class > .tsd-kind-icon:before { + background-position: -51px -17px; +} +.tsd-kind-get-signature.tsd-parent-kind-class.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -68px -17px; +} +.tsd-kind-get-signature.tsd-parent-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -85px -17px; +} +.tsd-kind-get-signature.tsd-parent-kind-class.tsd-is-protected.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -102px -17px; +} +.tsd-kind-get-signature.tsd-parent-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -17px; +} +.tsd-kind-get-signature.tsd-parent-kind-enum > .tsd-kind-icon:before { + background-position: -170px -17px; +} +.tsd-kind-get-signature.tsd-parent-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -187px -17px; +} +.tsd-kind-get-signature.tsd-parent-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -17px; +} +.tsd-kind-get-signature.tsd-parent-kind-interface > .tsd-kind-icon:before { + background-position: -204px -17px; +} +.tsd-kind-get-signature.tsd-parent-kind-interface.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -221px -17px; +} + +.tsd-kind-set-signature > .tsd-kind-icon:before { + background-position: -136px -34px; +} +.tsd-kind-set-signature.tsd-is-protected > .tsd-kind-icon:before { + background-position: -153px -34px; +} +.tsd-kind-set-signature.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -34px; +} +.tsd-kind-set-signature.tsd-parent-kind-class > .tsd-kind-icon:before { + background-position: -51px -34px; +} +.tsd-kind-set-signature.tsd-parent-kind-class.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -68px -34px; +} +.tsd-kind-set-signature.tsd-parent-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -85px -34px; +} +.tsd-kind-set-signature.tsd-parent-kind-class.tsd-is-protected.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -102px -34px; +} +.tsd-kind-set-signature.tsd-parent-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -34px; +} +.tsd-kind-set-signature.tsd-parent-kind-enum > .tsd-kind-icon:before { + background-position: -170px -34px; +} +.tsd-kind-set-signature.tsd-parent-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -187px -34px; +} +.tsd-kind-set-signature.tsd-parent-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -34px; +} +.tsd-kind-set-signature.tsd-parent-kind-interface > .tsd-kind-icon:before { + background-position: -204px -34px; +} +.tsd-kind-set-signature.tsd-parent-kind-interface.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -221px -34px; +} + +.tsd-kind-accessor > .tsd-kind-icon:before { + background-position: -136px -51px; +} +.tsd-kind-accessor.tsd-is-protected > .tsd-kind-icon:before { + background-position: -153px -51px; +} +.tsd-kind-accessor.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -51px; +} +.tsd-kind-accessor.tsd-parent-kind-class > .tsd-kind-icon:before { + background-position: -51px -51px; +} +.tsd-kind-accessor.tsd-parent-kind-class.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -68px -51px; +} +.tsd-kind-accessor.tsd-parent-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -85px -51px; +} +.tsd-kind-accessor.tsd-parent-kind-class.tsd-is-protected.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -102px -51px; +} +.tsd-kind-accessor.tsd-parent-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -51px; +} +.tsd-kind-accessor.tsd-parent-kind-enum > .tsd-kind-icon:before { + background-position: -170px -51px; +} +.tsd-kind-accessor.tsd-parent-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -187px -51px; +} +.tsd-kind-accessor.tsd-parent-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -51px; +} +.tsd-kind-accessor.tsd-parent-kind-interface > .tsd-kind-icon:before { + background-position: -204px -51px; +} +.tsd-kind-accessor.tsd-parent-kind-interface.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -221px -51px; +} + +.tsd-kind-function > .tsd-kind-icon:before { + background-position: -136px -68px; +} +.tsd-kind-function.tsd-is-protected > .tsd-kind-icon:before { + background-position: -153px -68px; +} +.tsd-kind-function.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -68px; +} +.tsd-kind-function.tsd-parent-kind-class > .tsd-kind-icon:before { + background-position: -51px -68px; +} +.tsd-kind-function.tsd-parent-kind-class.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -68px -68px; +} +.tsd-kind-function.tsd-parent-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -85px -68px; +} +.tsd-kind-function.tsd-parent-kind-class.tsd-is-protected.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -102px -68px; +} +.tsd-kind-function.tsd-parent-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -68px; +} +.tsd-kind-function.tsd-parent-kind-enum > .tsd-kind-icon:before { + background-position: -170px -68px; +} +.tsd-kind-function.tsd-parent-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -187px -68px; +} +.tsd-kind-function.tsd-parent-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -68px; +} +.tsd-kind-function.tsd-parent-kind-interface > .tsd-kind-icon:before { + background-position: -204px -68px; +} +.tsd-kind-function.tsd-parent-kind-interface.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -221px -68px; +} + +.tsd-kind-method > .tsd-kind-icon:before { + background-position: -136px -68px; +} +.tsd-kind-method.tsd-is-protected > .tsd-kind-icon:before { + background-position: -153px -68px; +} +.tsd-kind-method.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -68px; +} +.tsd-kind-method.tsd-parent-kind-class > .tsd-kind-icon:before { + background-position: -51px -68px; +} +.tsd-kind-method.tsd-parent-kind-class.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -68px -68px; +} +.tsd-kind-method.tsd-parent-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -85px -68px; +} +.tsd-kind-method.tsd-parent-kind-class.tsd-is-protected.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -102px -68px; +} +.tsd-kind-method.tsd-parent-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -68px; +} +.tsd-kind-method.tsd-parent-kind-enum > .tsd-kind-icon:before { + background-position: -170px -68px; +} +.tsd-kind-method.tsd-parent-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -187px -68px; +} +.tsd-kind-method.tsd-parent-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -68px; +} +.tsd-kind-method.tsd-parent-kind-interface > .tsd-kind-icon:before { + background-position: -204px -68px; +} +.tsd-kind-method.tsd-parent-kind-interface.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -221px -68px; +} + +.tsd-kind-call-signature > .tsd-kind-icon:before { + background-position: -136px -68px; +} +.tsd-kind-call-signature.tsd-is-protected > .tsd-kind-icon:before { + background-position: -153px -68px; +} +.tsd-kind-call-signature.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -68px; +} +.tsd-kind-call-signature.tsd-parent-kind-class > .tsd-kind-icon:before { + background-position: -51px -68px; +} +.tsd-kind-call-signature.tsd-parent-kind-class.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -68px -68px; +} +.tsd-kind-call-signature.tsd-parent-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -85px -68px; +} +.tsd-kind-call-signature.tsd-parent-kind-class.tsd-is-protected.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -102px -68px; +} +.tsd-kind-call-signature.tsd-parent-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -68px; +} +.tsd-kind-call-signature.tsd-parent-kind-enum > .tsd-kind-icon:before { + background-position: -170px -68px; +} +.tsd-kind-call-signature.tsd-parent-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -187px -68px; +} +.tsd-kind-call-signature.tsd-parent-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -68px; +} +.tsd-kind-call-signature.tsd-parent-kind-interface > .tsd-kind-icon:before { + background-position: -204px -68px; +} +.tsd-kind-call-signature.tsd-parent-kind-interface.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -221px -68px; +} + +.tsd-kind-function.tsd-has-type-parameter > .tsd-kind-icon:before { + background-position: -136px -85px; +} +.tsd-kind-function.tsd-has-type-parameter.tsd-is-protected > .tsd-kind-icon:before { + background-position: -153px -85px; +} +.tsd-kind-function.tsd-has-type-parameter.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -85px; +} +.tsd-kind-function.tsd-has-type-parameter.tsd-parent-kind-class > .tsd-kind-icon:before { + background-position: -51px -85px; +} +.tsd-kind-function.tsd-has-type-parameter.tsd-parent-kind-class.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -68px -85px; +} +.tsd-kind-function.tsd-has-type-parameter.tsd-parent-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -85px -85px; +} +.tsd-kind-function.tsd-has-type-parameter.tsd-parent-kind-class.tsd-is-protected.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -102px -85px; +} +.tsd-kind-function.tsd-has-type-parameter.tsd-parent-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -85px; +} +.tsd-kind-function.tsd-has-type-parameter.tsd-parent-kind-enum > .tsd-kind-icon:before { + background-position: -170px -85px; +} +.tsd-kind-function.tsd-has-type-parameter.tsd-parent-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -187px -85px; +} +.tsd-kind-function.tsd-has-type-parameter.tsd-parent-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -85px; +} +.tsd-kind-function.tsd-has-type-parameter.tsd-parent-kind-interface > .tsd-kind-icon:before { + background-position: -204px -85px; +} +.tsd-kind-function.tsd-has-type-parameter.tsd-parent-kind-interface.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -221px -85px; +} + +.tsd-kind-method.tsd-has-type-parameter > .tsd-kind-icon:before { + background-position: -136px -85px; +} +.tsd-kind-method.tsd-has-type-parameter.tsd-is-protected > .tsd-kind-icon:before { + background-position: -153px -85px; +} +.tsd-kind-method.tsd-has-type-parameter.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -85px; +} +.tsd-kind-method.tsd-has-type-parameter.tsd-parent-kind-class > .tsd-kind-icon:before { + background-position: -51px -85px; +} +.tsd-kind-method.tsd-has-type-parameter.tsd-parent-kind-class.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -68px -85px; +} +.tsd-kind-method.tsd-has-type-parameter.tsd-parent-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -85px -85px; +} +.tsd-kind-method.tsd-has-type-parameter.tsd-parent-kind-class.tsd-is-protected.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -102px -85px; +} +.tsd-kind-method.tsd-has-type-parameter.tsd-parent-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -85px; +} +.tsd-kind-method.tsd-has-type-parameter.tsd-parent-kind-enum > .tsd-kind-icon:before { + background-position: -170px -85px; +} +.tsd-kind-method.tsd-has-type-parameter.tsd-parent-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -187px -85px; +} +.tsd-kind-method.tsd-has-type-parameter.tsd-parent-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -85px; +} +.tsd-kind-method.tsd-has-type-parameter.tsd-parent-kind-interface > .tsd-kind-icon:before { + background-position: -204px -85px; +} +.tsd-kind-method.tsd-has-type-parameter.tsd-parent-kind-interface.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -221px -85px; +} + +.tsd-kind-constructor > .tsd-kind-icon:before { + background-position: -136px -102px; +} +.tsd-kind-constructor.tsd-is-protected > .tsd-kind-icon:before { + background-position: -153px -102px; +} +.tsd-kind-constructor.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -102px; +} +.tsd-kind-constructor.tsd-parent-kind-class > .tsd-kind-icon:before { + background-position: -51px -102px; +} +.tsd-kind-constructor.tsd-parent-kind-class.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -68px -102px; +} +.tsd-kind-constructor.tsd-parent-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -85px -102px; +} +.tsd-kind-constructor.tsd-parent-kind-class.tsd-is-protected.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -102px -102px; +} +.tsd-kind-constructor.tsd-parent-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -102px; +} +.tsd-kind-constructor.tsd-parent-kind-enum > .tsd-kind-icon:before { + background-position: -170px -102px; +} +.tsd-kind-constructor.tsd-parent-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -187px -102px; +} +.tsd-kind-constructor.tsd-parent-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -102px; +} +.tsd-kind-constructor.tsd-parent-kind-interface > .tsd-kind-icon:before { + background-position: -204px -102px; +} +.tsd-kind-constructor.tsd-parent-kind-interface.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -221px -102px; +} + +.tsd-kind-constructor-signature > .tsd-kind-icon:before { + background-position: -136px -102px; +} +.tsd-kind-constructor-signature.tsd-is-protected > .tsd-kind-icon:before { + background-position: -153px -102px; +} +.tsd-kind-constructor-signature.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -102px; +} +.tsd-kind-constructor-signature.tsd-parent-kind-class > .tsd-kind-icon:before { + background-position: -51px -102px; +} +.tsd-kind-constructor-signature.tsd-parent-kind-class.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -68px -102px; +} +.tsd-kind-constructor-signature.tsd-parent-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -85px -102px; +} +.tsd-kind-constructor-signature.tsd-parent-kind-class.tsd-is-protected.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -102px -102px; +} +.tsd-kind-constructor-signature.tsd-parent-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -102px; +} +.tsd-kind-constructor-signature.tsd-parent-kind-enum > .tsd-kind-icon:before { + background-position: -170px -102px; +} +.tsd-kind-constructor-signature.tsd-parent-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -187px -102px; +} +.tsd-kind-constructor-signature.tsd-parent-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -102px; +} +.tsd-kind-constructor-signature.tsd-parent-kind-interface > .tsd-kind-icon:before { + background-position: -204px -102px; +} +.tsd-kind-constructor-signature.tsd-parent-kind-interface.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -221px -102px; +} + +.tsd-kind-index-signature > .tsd-kind-icon:before { + background-position: -136px -119px; +} +.tsd-kind-index-signature.tsd-is-protected > .tsd-kind-icon:before { + background-position: -153px -119px; +} +.tsd-kind-index-signature.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -119px; +} +.tsd-kind-index-signature.tsd-parent-kind-class > .tsd-kind-icon:before { + background-position: -51px -119px; +} +.tsd-kind-index-signature.tsd-parent-kind-class.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -68px -119px; +} +.tsd-kind-index-signature.tsd-parent-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -85px -119px; +} +.tsd-kind-index-signature.tsd-parent-kind-class.tsd-is-protected.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -102px -119px; +} +.tsd-kind-index-signature.tsd-parent-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -119px; +} +.tsd-kind-index-signature.tsd-parent-kind-enum > .tsd-kind-icon:before { + background-position: -170px -119px; +} +.tsd-kind-index-signature.tsd-parent-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -187px -119px; +} +.tsd-kind-index-signature.tsd-parent-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -119px; +} +.tsd-kind-index-signature.tsd-parent-kind-interface > .tsd-kind-icon:before { + background-position: -204px -119px; +} +.tsd-kind-index-signature.tsd-parent-kind-interface.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -221px -119px; +} + +.tsd-kind-event > .tsd-kind-icon:before { + background-position: -136px -136px; +} +.tsd-kind-event.tsd-is-protected > .tsd-kind-icon:before { + background-position: -153px -136px; +} +.tsd-kind-event.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -136px; +} +.tsd-kind-event.tsd-parent-kind-class > .tsd-kind-icon:before { + background-position: -51px -136px; +} +.tsd-kind-event.tsd-parent-kind-class.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -68px -136px; +} +.tsd-kind-event.tsd-parent-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -85px -136px; +} +.tsd-kind-event.tsd-parent-kind-class.tsd-is-protected.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -102px -136px; +} +.tsd-kind-event.tsd-parent-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -136px; +} +.tsd-kind-event.tsd-parent-kind-enum > .tsd-kind-icon:before { + background-position: -170px -136px; +} +.tsd-kind-event.tsd-parent-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -187px -136px; +} +.tsd-kind-event.tsd-parent-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -136px; +} +.tsd-kind-event.tsd-parent-kind-interface > .tsd-kind-icon:before { + background-position: -204px -136px; +} +.tsd-kind-event.tsd-parent-kind-interface.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -221px -136px; +} + +.tsd-is-static > .tsd-kind-icon:before { + background-position: -136px -153px; +} +.tsd-is-static.tsd-is-protected > .tsd-kind-icon:before { + background-position: -153px -153px; +} +.tsd-is-static.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -153px; +} +.tsd-is-static.tsd-parent-kind-class > .tsd-kind-icon:before { + background-position: -51px -153px; +} +.tsd-is-static.tsd-parent-kind-class.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -68px -153px; +} +.tsd-is-static.tsd-parent-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -85px -153px; +} +.tsd-is-static.tsd-parent-kind-class.tsd-is-protected.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -102px -153px; +} +.tsd-is-static.tsd-parent-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -153px; +} +.tsd-is-static.tsd-parent-kind-enum > .tsd-kind-icon:before { + background-position: -170px -153px; +} +.tsd-is-static.tsd-parent-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -187px -153px; +} +.tsd-is-static.tsd-parent-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -153px; +} +.tsd-is-static.tsd-parent-kind-interface > .tsd-kind-icon:before { + background-position: -204px -153px; +} +.tsd-is-static.tsd-parent-kind-interface.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -221px -153px; +} + +.tsd-is-static.tsd-kind-function > .tsd-kind-icon:before { + background-position: -136px -170px; +} +.tsd-is-static.tsd-kind-function.tsd-is-protected > .tsd-kind-icon:before { + background-position: -153px -170px; +} +.tsd-is-static.tsd-kind-function.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -170px; +} +.tsd-is-static.tsd-kind-function.tsd-parent-kind-class > .tsd-kind-icon:before { + background-position: -51px -170px; +} +.tsd-is-static.tsd-kind-function.tsd-parent-kind-class.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -68px -170px; +} +.tsd-is-static.tsd-kind-function.tsd-parent-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -85px -170px; +} +.tsd-is-static.tsd-kind-function.tsd-parent-kind-class.tsd-is-protected.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -102px -170px; +} +.tsd-is-static.tsd-kind-function.tsd-parent-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -170px; +} +.tsd-is-static.tsd-kind-function.tsd-parent-kind-enum > .tsd-kind-icon:before { + background-position: -170px -170px; +} +.tsd-is-static.tsd-kind-function.tsd-parent-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -187px -170px; +} +.tsd-is-static.tsd-kind-function.tsd-parent-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -170px; +} +.tsd-is-static.tsd-kind-function.tsd-parent-kind-interface > .tsd-kind-icon:before { + background-position: -204px -170px; +} +.tsd-is-static.tsd-kind-function.tsd-parent-kind-interface.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -221px -170px; +} + +.tsd-is-static.tsd-kind-method > .tsd-kind-icon:before { + background-position: -136px -170px; +} +.tsd-is-static.tsd-kind-method.tsd-is-protected > .tsd-kind-icon:before { + background-position: -153px -170px; +} +.tsd-is-static.tsd-kind-method.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -170px; +} +.tsd-is-static.tsd-kind-method.tsd-parent-kind-class > .tsd-kind-icon:before { + background-position: -51px -170px; +} +.tsd-is-static.tsd-kind-method.tsd-parent-kind-class.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -68px -170px; +} +.tsd-is-static.tsd-kind-method.tsd-parent-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -85px -170px; +} +.tsd-is-static.tsd-kind-method.tsd-parent-kind-class.tsd-is-protected.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -102px -170px; +} +.tsd-is-static.tsd-kind-method.tsd-parent-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -170px; +} +.tsd-is-static.tsd-kind-method.tsd-parent-kind-enum > .tsd-kind-icon:before { + background-position: -170px -170px; +} +.tsd-is-static.tsd-kind-method.tsd-parent-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -187px -170px; +} +.tsd-is-static.tsd-kind-method.tsd-parent-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -170px; +} +.tsd-is-static.tsd-kind-method.tsd-parent-kind-interface > .tsd-kind-icon:before { + background-position: -204px -170px; +} +.tsd-is-static.tsd-kind-method.tsd-parent-kind-interface.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -221px -170px; +} + +.tsd-is-static.tsd-kind-call-signature > .tsd-kind-icon:before { + background-position: -136px -170px; +} +.tsd-is-static.tsd-kind-call-signature.tsd-is-protected > .tsd-kind-icon:before { + background-position: -153px -170px; +} +.tsd-is-static.tsd-kind-call-signature.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -170px; +} +.tsd-is-static.tsd-kind-call-signature.tsd-parent-kind-class > .tsd-kind-icon:before { + background-position: -51px -170px; +} +.tsd-is-static.tsd-kind-call-signature.tsd-parent-kind-class.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -68px -170px; +} +.tsd-is-static.tsd-kind-call-signature.tsd-parent-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -85px -170px; +} +.tsd-is-static.tsd-kind-call-signature.tsd-parent-kind-class.tsd-is-protected.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -102px -170px; +} +.tsd-is-static.tsd-kind-call-signature.tsd-parent-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -170px; +} +.tsd-is-static.tsd-kind-call-signature.tsd-parent-kind-enum > .tsd-kind-icon:before { + background-position: -170px -170px; +} +.tsd-is-static.tsd-kind-call-signature.tsd-parent-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -187px -170px; +} +.tsd-is-static.tsd-kind-call-signature.tsd-parent-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -170px; +} +.tsd-is-static.tsd-kind-call-signature.tsd-parent-kind-interface > .tsd-kind-icon:before { + background-position: -204px -170px; +} +.tsd-is-static.tsd-kind-call-signature.tsd-parent-kind-interface.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -221px -170px; +} + +.tsd-is-static.tsd-kind-event > .tsd-kind-icon:before { + background-position: -136px -187px; +} +.tsd-is-static.tsd-kind-event.tsd-is-protected > .tsd-kind-icon:before { + background-position: -153px -187px; +} +.tsd-is-static.tsd-kind-event.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -187px; +} +.tsd-is-static.tsd-kind-event.tsd-parent-kind-class > .tsd-kind-icon:before { + background-position: -51px -187px; +} +.tsd-is-static.tsd-kind-event.tsd-parent-kind-class.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -68px -187px; +} +.tsd-is-static.tsd-kind-event.tsd-parent-kind-class.tsd-is-protected > .tsd-kind-icon:before { + background-position: -85px -187px; +} +.tsd-is-static.tsd-kind-event.tsd-parent-kind-class.tsd-is-protected.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -102px -187px; +} +.tsd-is-static.tsd-kind-event.tsd-parent-kind-class.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -187px; +} +.tsd-is-static.tsd-kind-event.tsd-parent-kind-enum > .tsd-kind-icon:before { + background-position: -170px -187px; +} +.tsd-is-static.tsd-kind-event.tsd-parent-kind-enum.tsd-is-protected > .tsd-kind-icon:before { + background-position: -187px -187px; +} +.tsd-is-static.tsd-kind-event.tsd-parent-kind-enum.tsd-is-private > .tsd-kind-icon:before { + background-position: -119px -187px; +} +.tsd-is-static.tsd-kind-event.tsd-parent-kind-interface > .tsd-kind-icon:before { + background-position: -204px -187px; +} +.tsd-is-static.tsd-kind-event.tsd-parent-kind-interface.tsd-is-inherited > .tsd-kind-icon:before { + background-position: -221px -187px; +} + +@keyframes fade-in { + from { + opacity: 0; + } + to { + opacity: 1; + } +} +@keyframes fade-out { + from { + opacity: 1; + visibility: visible; + } + to { + opacity: 0; + } +} +@keyframes fade-in-delayed { + 0% { + opacity: 0; + } + 33% { + opacity: 0; + } + 100% { + opacity: 1; + } +} +@keyframes fade-out-delayed { + 0% { + opacity: 1; + visibility: visible; + } + 66% { + opacity: 0; + } + 100% { + opacity: 0; + } +} +@keyframes shift-to-left { + from { + transform: translate(0, 0); + } + to { + transform: translate(-25%, 0); + } +} +@keyframes unshift-to-left { + from { + transform: translate(-25%, 0); + } + to { + transform: translate(0, 0); + } +} +@keyframes pop-in-from-right { + from { + transform: translate(100%, 0); + } + to { + transform: translate(0, 0); + } +} +@keyframes pop-out-to-right { + from { + transform: translate(0, 0); + visibility: visible; + } + to { + transform: translate(100%, 0); + } +} +body { + background: var(--color-background); + font-family: "Segoe UI", sans-serif; + font-size: 16px; + color: var(--color-text); +} + +a { + color: var(--color-link); + text-decoration: none; +} +a:hover { + text-decoration: underline; +} + +code, pre { + font-family: Menlo, Monaco, Consolas, "Courier New", monospace; + padding: 0.2em; + margin: 0; + font-size: 14px; + background-color: var(--color-code-background); +} + +pre { + padding: 10px; +} +pre code { + padding: 0; + font-size: 100%; + background-color: transparent; +} + +blockquote { + margin: 1em 0; + padding-left: 1em; + border-left: 4px solid gray; +} + +.tsd-typography { + line-height: 1.333em; +} +.tsd-typography ul { + list-style: square; + padding: 0 0 0 20px; + margin: 0; +} +.tsd-typography h4, .tsd-typography .tsd-index-panel h3, .tsd-index-panel .tsd-typography h3, .tsd-typography h5, .tsd-typography h6 { + font-size: 1em; + margin: 0; +} +.tsd-typography h5, .tsd-typography h6 { + font-weight: normal; +} +.tsd-typography p, .tsd-typography ul, .tsd-typography ol { + margin: 1em 0; +} + +@media (min-width: 901px) and (max-width: 1024px) { + html.default .col-content { + width: 72%; + } + html.default .col-menu { + width: 28%; + } + html.default .tsd-navigation { + padding-left: 10px; + } +} +@media (max-width: 900px) { + html.default .col-content { + float: none; + width: 100%; + } + html.default .col-menu { + position: fixed !important; + overflow: auto; + -webkit-overflow-scrolling: touch; + z-index: 1024; + top: 0 !important; + bottom: 0 !important; + left: auto !important; + right: 0 !important; + width: 100%; + padding: 20px 20px 0 0; + max-width: 450px; + visibility: hidden; + background-color: var(--color-panel); + transform: translate(100%, 0); + } + html.default .col-menu > *:last-child { + padding-bottom: 20px; + } + html.default .overlay { + content: ""; + display: block; + position: fixed; + z-index: 1023; + top: 0; + left: 0; + right: 0; + bottom: 0; + background-color: rgba(0, 0, 0, 0.75); + visibility: hidden; + } + html.default.to-has-menu .overlay { + animation: fade-in 0.4s; + } + html.default.to-has-menu header, +html.default.to-has-menu footer, +html.default.to-has-menu .col-content { + animation: shift-to-left 0.4s; + } + html.default.to-has-menu .col-menu { + animation: pop-in-from-right 0.4s; + } + html.default.from-has-menu .overlay { + animation: fade-out 0.4s; + } + html.default.from-has-menu header, +html.default.from-has-menu footer, +html.default.from-has-menu .col-content { + animation: unshift-to-left 0.4s; + } + html.default.from-has-menu .col-menu { + animation: pop-out-to-right 0.4s; + } + html.default.has-menu body { + overflow: hidden; + } + html.default.has-menu .overlay { + visibility: visible; + } + html.default.has-menu header, +html.default.has-menu footer, +html.default.has-menu .col-content { + transform: translate(-25%, 0); + } + html.default.has-menu .col-menu { + visibility: visible; + transform: translate(0, 0); + } +} + +.tsd-page-title { + padding: 70px 0 20px 0; + margin: 0 0 40px 0; + background: var(--color-panel); + box-shadow: 0 0 5px rgba(0, 0, 0, 0.35); +} +.tsd-page-title h1 { + margin: 0; +} + +.tsd-breadcrumb { + margin: 0; + padding: 0; + color: var(--color-text-aside); +} +.tsd-breadcrumb a { + color: var(--color-text-aside); + text-decoration: none; +} +.tsd-breadcrumb a:hover { + text-decoration: underline; +} +.tsd-breadcrumb li { + display: inline; +} +.tsd-breadcrumb li:after { + content: " / "; +} + +html.minimal .container { + margin: 0; +} +html.minimal .container-main { + padding-top: 50px; + padding-bottom: 0; +} +html.minimal .content-wrap { + padding-left: 300px; +} +html.minimal .tsd-navigation { + position: fixed !important; + overflow: auto; + -webkit-overflow-scrolling: touch; + box-sizing: border-box; + z-index: 1; + left: 0; + top: 40px; + bottom: 0; + width: 300px; + padding: 20px; + margin: 0; +} +html.minimal .tsd-member .tsd-member { + margin-left: 0; +} +html.minimal .tsd-page-toolbar { + position: fixed; + z-index: 2; +} +html.minimal #tsd-filter .tsd-filter-group { + right: 0; + transform: none; +} +html.minimal footer { + background-color: transparent; +} +html.minimal footer .container { + padding: 0; +} +html.minimal .tsd-generator { + padding: 0; +} +@media (max-width: 900px) { + html.minimal .tsd-navigation { + display: none; + } + html.minimal .content-wrap { + padding-left: 0; + } +} + +dl.tsd-comment-tags { + overflow: hidden; +} +dl.tsd-comment-tags dt { + float: left; + padding: 1px 5px; + margin: 0 10px 0 0; + border-radius: 4px; + border: 1px solid var(--color-comment-tag); + color: var(--color-comment-tag); + font-size: 0.8em; + font-weight: normal; +} +dl.tsd-comment-tags dd { + margin: 0 0 10px 0; +} +dl.tsd-comment-tags dd:before, dl.tsd-comment-tags dd:after { + display: table; + content: " "; +} +dl.tsd-comment-tags dd pre, dl.tsd-comment-tags dd:after { + clear: both; +} +dl.tsd-comment-tags p { + margin: 0; +} + +.tsd-panel.tsd-comment .lead { + font-size: 1.1em; + line-height: 1.333em; + margin-bottom: 2em; +} +.tsd-panel.tsd-comment .lead:last-child { + margin-bottom: 0; +} + +.toggle-protected .tsd-is-private { + display: none; +} + +.toggle-public .tsd-is-private, +.toggle-public .tsd-is-protected, +.toggle-public .tsd-is-private-protected { + display: none; +} + +.toggle-inherited .tsd-is-inherited { + display: none; +} + +.toggle-externals .tsd-is-external { + display: none; +} + +#tsd-filter { + position: relative; + display: inline-block; + height: 40px; + vertical-align: bottom; +} +.no-filter #tsd-filter { + display: none; +} +#tsd-filter .tsd-filter-group { + display: inline-block; + height: 40px; + vertical-align: bottom; + white-space: nowrap; +} +#tsd-filter input { + display: none; +} +@media (max-width: 900px) { + #tsd-filter .tsd-filter-group { + display: block; + position: absolute; + top: 40px; + right: 20px; + height: auto; + background-color: var(--color-panel); + visibility: hidden; + transform: translate(50%, 0); + box-shadow: 0 0 4px rgba(0, 0, 0, 0.25); + } + .has-options #tsd-filter .tsd-filter-group { + visibility: visible; + } + .to-has-options #tsd-filter .tsd-filter-group { + animation: fade-in 0.2s; + } + .from-has-options #tsd-filter .tsd-filter-group { + animation: fade-out 0.2s; + } + #tsd-filter label, +#tsd-filter .tsd-select { + display: block; + padding-right: 20px; + } +} + +footer { + border-top: 1px solid var(--color-panel-divider); + background-color: var(--color-panel); +} +footer.with-border-bottom { + border-bottom: 1px solid var(--color-panel-divider); +} +footer .tsd-legend-group { + font-size: 0; +} +footer .tsd-legend { + display: inline-block; + width: 25%; + padding: 0; + font-size: 16px; + list-style: none; + line-height: 1.333em; + vertical-align: top; +} +@media (max-width: 900px) { + footer .tsd-legend { + width: 50%; + } +} + +.tsd-hierarchy { + list-style: square; + padding: 0 0 0 20px; + margin: 0; +} +.tsd-hierarchy .target { + font-weight: bold; +} + +.tsd-index-panel .tsd-index-content { + margin-bottom: -30px !important; +} +.tsd-index-panel .tsd-index-section { + margin-bottom: 30px !important; +} +.tsd-index-panel h3 { + margin: 0 -20px 10px -20px; + padding: 0 20px 10px 20px; + border-bottom: 1px solid var(--color-panel-divider); +} +.tsd-index-panel ul.tsd-index-list { + -webkit-column-count: 3; + -moz-column-count: 3; + -ms-column-count: 3; + -o-column-count: 3; + column-count: 3; + -webkit-column-gap: 20px; + -moz-column-gap: 20px; + -ms-column-gap: 20px; + -o-column-gap: 20px; + column-gap: 20px; + padding: 0; + list-style: none; + line-height: 1.333em; +} +@media (max-width: 900px) { + .tsd-index-panel ul.tsd-index-list { + -webkit-column-count: 1; + -moz-column-count: 1; + -ms-column-count: 1; + -o-column-count: 1; + column-count: 1; + } +} +@media (min-width: 901px) and (max-width: 1024px) { + .tsd-index-panel ul.tsd-index-list { + -webkit-column-count: 2; + -moz-column-count: 2; + -ms-column-count: 2; + -o-column-count: 2; + column-count: 2; + } +} +.tsd-index-panel ul.tsd-index-list li { + -webkit-page-break-inside: avoid; + -moz-page-break-inside: avoid; + -ms-page-break-inside: avoid; + -o-page-break-inside: avoid; + page-break-inside: avoid; +} +.tsd-index-panel a, +.tsd-index-panel .tsd-parent-kind-module a { + color: var(--color-ts); +} +.tsd-index-panel .tsd-parent-kind-interface a { + color: var(--color-ts-interface); +} +.tsd-index-panel .tsd-parent-kind-enum a { + color: var(--color-ts-enum); +} +.tsd-index-panel .tsd-parent-kind-class a { + color: var(--color-ts-class); +} +.tsd-index-panel .tsd-kind-module a { + color: var(--color-ts); +} +.tsd-index-panel .tsd-kind-interface a { + color: var(--color-ts-interface); +} +.tsd-index-panel .tsd-kind-enum a { + color: var(--color-ts-enum); +} +.tsd-index-panel .tsd-kind-class a { + color: var(--color-ts-class); +} +.tsd-index-panel .tsd-is-private a { + color: var(--color-ts-private); +} + +.tsd-flag { + display: inline-block; + padding: 1px 5px; + border-radius: 4px; + color: var(--color-comment-tag-text); + background-color: var(--color-comment-tag); + text-indent: 0; + font-size: 14px; + font-weight: normal; +} + +.tsd-anchor { + position: absolute; + top: -100px; +} + +.tsd-member { + position: relative; +} +.tsd-member .tsd-anchor + h3 { + margin-top: 0; + margin-bottom: 0; + border-bottom: none; +} +.tsd-member a[data-tsd-kind] { + color: var(--color-ts); +} +.tsd-member a[data-tsd-kind=Interface] { + color: var(--color-ts-interface); +} +.tsd-member a[data-tsd-kind=Enum] { + color: var(--color-ts-enum); +} +.tsd-member a[data-tsd-kind=Class] { + color: var(--color-ts-class); +} +.tsd-member a[data-tsd-kind=Private] { + color: var(--color-ts-private); +} + +.tsd-navigation { + margin: 0 0 0 40px; +} +.tsd-navigation a { + display: block; + padding-top: 2px; + padding-bottom: 2px; + border-left: 2px solid transparent; + color: var(--color-text); + text-decoration: none; + transition: border-left-color 0.1s; +} +.tsd-navigation a:hover { + text-decoration: underline; +} +.tsd-navigation ul { + margin: 0; + padding: 0; + list-style: none; +} +.tsd-navigation li { + padding: 0; +} + +.tsd-navigation.primary { + padding-bottom: 40px; +} +.tsd-navigation.primary a { + display: block; + padding-top: 6px; + padding-bottom: 6px; +} +.tsd-navigation.primary ul li a { + padding-left: 5px; +} +.tsd-navigation.primary ul li li a { + padding-left: 25px; +} +.tsd-navigation.primary ul li li li a { + padding-left: 45px; +} +.tsd-navigation.primary ul li li li li a { + padding-left: 65px; +} +.tsd-navigation.primary ul li li li li li a { + padding-left: 85px; +} +.tsd-navigation.primary ul li li li li li li a { + padding-left: 105px; +} +.tsd-navigation.primary > ul { + border-bottom: 1px solid var(--color-panel-divider); +} +.tsd-navigation.primary li { + border-top: 1px solid var(--color-panel-divider); +} +.tsd-navigation.primary li.current > a { + font-weight: bold; +} +.tsd-navigation.primary li.label span { + display: block; + padding: 20px 0 6px 5px; + color: var(--color-menu-label); +} +.tsd-navigation.primary li.globals + li > span, .tsd-navigation.primary li.globals + li > a { + padding-top: 20px; +} + +.tsd-navigation.secondary { + max-height: calc(100vh - 1rem - 40px); + overflow: auto; + position: -webkit-sticky; + position: sticky; + top: calc(.5rem + 40px); + transition: 0.3s; +} +.tsd-navigation.secondary.tsd-navigation--toolbar-hide { + max-height: calc(100vh - 1rem); + top: 0.5rem; +} +.tsd-navigation.secondary ul { + transition: opacity 0.2s; +} +.tsd-navigation.secondary ul li a { + padding-left: 25px; +} +.tsd-navigation.secondary ul li li a { + padding-left: 45px; +} +.tsd-navigation.secondary ul li li li a { + padding-left: 65px; +} +.tsd-navigation.secondary ul li li li li a { + padding-left: 85px; +} +.tsd-navigation.secondary ul li li li li li a { + padding-left: 105px; +} +.tsd-navigation.secondary ul li li li li li li a { + padding-left: 125px; +} +.tsd-navigation.secondary ul.current a { + border-left-color: var(--color-panel-divider); +} +.tsd-navigation.secondary li.focus > a, +.tsd-navigation.secondary ul.current li.focus > a { + border-left-color: var(--color-menu-divider-focus); +} +.tsd-navigation.secondary li.current { + margin-top: 20px; + margin-bottom: 20px; + border-left-color: var(--color-panel-divider); +} +.tsd-navigation.secondary li.current > a { + font-weight: bold; +} + +@media (min-width: 901px) { + .menu-sticky-wrap { + position: static; + } +} + +.tsd-panel { + margin: 20px 0; + padding: 20px; + background-color: var(--color-panel); + box-shadow: 0 0 4px rgba(0, 0, 0, 0.25); +} +.tsd-panel:empty { + display: none; +} +.tsd-panel > h1, .tsd-panel > h2, .tsd-panel > h3 { + margin: 1.5em -20px 10px -20px; + padding: 0 20px 10px 20px; + border-bottom: 1px solid var(--color-panel-divider); +} +.tsd-panel > h1.tsd-before-signature, .tsd-panel > h2.tsd-before-signature, .tsd-panel > h3.tsd-before-signature { + margin-bottom: 0; + border-bottom: 0; +} +.tsd-panel table { + display: block; + width: 100%; + overflow: auto; + margin-top: 10px; + word-break: normal; + word-break: keep-all; +} +.tsd-panel table th { + font-weight: bold; +} +.tsd-panel table th, .tsd-panel table td { + padding: 6px 13px; + border: 1px solid #ddd; +} +.tsd-panel table tr { + background-color: #fff; + border-top: 1px solid #ccc; +} +.tsd-panel table tr:nth-child(2n) { + background-color: #f8f8f8; +} + +.tsd-panel-group { + margin: 60px 0; +} +.tsd-panel-group > h1, .tsd-panel-group > h2, .tsd-panel-group > h3 { + padding-left: 20px; + padding-right: 20px; +} + +#tsd-search { + transition: background-color 0.2s; +} +#tsd-search .title { + position: relative; + z-index: 2; +} +#tsd-search .field { + position: absolute; + left: 0; + top: 0; + right: 40px; + height: 40px; +} +#tsd-search .field input { + box-sizing: border-box; + position: relative; + top: -50px; + z-index: 1; + width: 100%; + padding: 0 10px; + opacity: 0; + outline: 0; + border: 0; + background: transparent; + color: var(--color-text); +} +#tsd-search .field label { + position: absolute; + overflow: hidden; + right: -40px; +} +#tsd-search .field input, +#tsd-search .title { + transition: opacity 0.2s; +} +#tsd-search .results { + position: absolute; + visibility: hidden; + top: 40px; + width: 100%; + margin: 0; + padding: 0; + list-style: none; + box-shadow: 0 0 4px rgba(0, 0, 0, 0.25); +} +#tsd-search .results li { + padding: 0 10px; + background-color: var(--color-background); +} +#tsd-search .results li:nth-child(even) { + background-color: var(--color-panel); +} +#tsd-search .results li.state { + display: none; +} +#tsd-search .results li.current, +#tsd-search .results li:hover { + background-color: var(--color-panel-divider); +} +#tsd-search .results a { + display: block; +} +#tsd-search .results a:before { + top: 10px; +} +#tsd-search .results span.parent { + color: var(--color-text-aside); + font-weight: normal; +} +#tsd-search.has-focus { + background-color: var(--color-panel-divider); +} +#tsd-search.has-focus .field input { + top: 0; + opacity: 1; +} +#tsd-search.has-focus .title { + z-index: 0; + opacity: 0; +} +#tsd-search.has-focus .results { + visibility: visible; +} +#tsd-search.loading .results li.state.loading { + display: block; +} +#tsd-search.failure .results li.state.failure { + display: block; +} + +.tsd-signature { + margin: 0 0 1em 0; + padding: 10px; + border: 1px solid var(--color-panel-divider); + font-family: Menlo, Monaco, Consolas, "Courier New", monospace; + font-size: 14px; + overflow-x: auto; +} +.tsd-signature.tsd-kind-icon { + padding-left: 30px; +} +.tsd-signature.tsd-kind-icon:before { + top: 10px; + left: 10px; +} +.tsd-panel > .tsd-signature { + margin-left: -20px; + margin-right: -20px; + border-width: 1px 0; +} +.tsd-panel > .tsd-signature.tsd-kind-icon { + padding-left: 40px; +} +.tsd-panel > .tsd-signature.tsd-kind-icon:before { + left: 20px; +} + +.tsd-signature-symbol { + color: var(--color-text-aside); + font-weight: normal; +} + +.tsd-signature-type { + font-style: italic; + font-weight: normal; +} + +.tsd-signatures { + padding: 0; + margin: 0 0 1em 0; + border: 1px solid var(--color-panel-divider); +} +.tsd-signatures .tsd-signature { + margin: 0; + border-width: 1px 0 0 0; + transition: background-color 0.1s; +} +.tsd-signatures .tsd-signature:first-child { + border-top-width: 0; +} +.tsd-signatures .tsd-signature.current { + background-color: var(--color-panel-divider); +} +.tsd-signatures.active > .tsd-signature { + cursor: pointer; +} +.tsd-panel > .tsd-signatures { + margin-left: -20px; + margin-right: -20px; + border-width: 1px 0; +} +.tsd-panel > .tsd-signatures .tsd-signature.tsd-kind-icon { + padding-left: 40px; +} +.tsd-panel > .tsd-signatures .tsd-signature.tsd-kind-icon:before { + left: 20px; +} +.tsd-panel > a.anchor + .tsd-signatures { + border-top-width: 0; + margin-top: -20px; +} + +ul.tsd-descriptions { + position: relative; + overflow: hidden; + padding: 0; + list-style: none; +} +ul.tsd-descriptions.active > .tsd-description { + display: none; +} +ul.tsd-descriptions.active > .tsd-description.current { + display: block; +} +ul.tsd-descriptions.active > .tsd-description.fade-in { + animation: fade-in-delayed 0.3s; +} +ul.tsd-descriptions.active > .tsd-description.fade-out { + animation: fade-out-delayed 0.3s; + position: absolute; + display: block; + top: 0; + left: 0; + right: 0; + opacity: 0; + visibility: hidden; +} +ul.tsd-descriptions h4, ul.tsd-descriptions .tsd-index-panel h3, .tsd-index-panel ul.tsd-descriptions h3 { + font-size: 16px; + margin: 1em 0 0.5em 0; +} + +ul.tsd-parameters, +ul.tsd-type-parameters { + list-style: square; + margin: 0; + padding-left: 20px; +} +ul.tsd-parameters > li.tsd-parameter-signature, +ul.tsd-type-parameters > li.tsd-parameter-signature { + list-style: none; + margin-left: -20px; +} +ul.tsd-parameters h5, +ul.tsd-type-parameters h5 { + font-size: 16px; + margin: 1em 0 0.5em 0; +} +ul.tsd-parameters .tsd-comment, +ul.tsd-type-parameters .tsd-comment { + margin-top: -0.5em; +} + +.tsd-sources { + font-size: 14px; + color: var(--color-text-aside); + margin: 0 0 1em 0; +} +.tsd-sources a { + color: var(--color-text-aside); + text-decoration: underline; +} +.tsd-sources ul, .tsd-sources p { + margin: 0 !important; +} +.tsd-sources ul { + list-style: none; + padding: 0; +} + +.tsd-page-toolbar { + position: fixed; + z-index: 1; + top: 0; + left: 0; + width: 100%; + height: 40px; + color: var(--color-toolbar-text); + background: var(--color-toolbar); + border-bottom: 1px solid var(--color-panel-divider); + transition: transform 0.3s linear; +} +.tsd-page-toolbar a { + color: var(--color-toolbar-text); + text-decoration: none; +} +.tsd-page-toolbar a.title { + font-weight: bold; +} +.tsd-page-toolbar a.title:hover { + text-decoration: underline; +} +.tsd-page-toolbar .table-wrap { + display: table; + width: 100%; + height: 40px; +} +.tsd-page-toolbar .table-cell { + display: table-cell; + position: relative; + white-space: nowrap; + line-height: 40px; +} +.tsd-page-toolbar .table-cell:first-child { + width: 100%; +} + +.tsd-page-toolbar--hide { + transform: translateY(-100%); +} + +.tsd-select .tsd-select-list li:before, .tsd-select .tsd-select-label:before, .tsd-widget:before { + content: ""; + display: inline-block; + width: 40px; + height: 40px; + margin: 0 -8px 0 0; + background-image: url(../images/widgets.png); + background-repeat: no-repeat; + text-indent: -1024px; + vertical-align: bottom; +} +@media (-webkit-min-device-pixel-ratio: 1.5), (min-resolution: 144dpi) { + .tsd-select .tsd-select-list li:before, .tsd-select .tsd-select-label:before, .tsd-widget:before { + background-image: url(../images/widgets@2x.png); + background-size: 320px 40px; + } +} + +.tsd-widget { + display: inline-block; + overflow: hidden; + opacity: 0.6; + height: 40px; + transition: opacity 0.1s, background-color 0.2s; + vertical-align: bottom; + cursor: pointer; +} +.tsd-widget:hover { + opacity: 0.8; +} +.tsd-widget.active { + opacity: 1; + background-color: var(--color-panel-divider); +} +.tsd-widget.no-caption { + width: 40px; +} +.tsd-widget.no-caption:before { + margin: 0; +} +.tsd-widget.search:before { + background-position: 0 0; +} +.tsd-widget.menu:before { + background-position: -40px 0; +} +.tsd-widget.options:before { + background-position: -80px 0; +} +.tsd-widget.options, .tsd-widget.menu { + display: none; +} +@media (max-width: 900px) { + .tsd-widget.options, .tsd-widget.menu { + display: inline-block; + } +} +input[type=checkbox] + .tsd-widget:before { + background-position: -120px 0; +} +input[type=checkbox]:checked + .tsd-widget:before { + background-position: -160px 0; +} + +.tsd-select { + position: relative; + display: inline-block; + height: 40px; + transition: opacity 0.1s, background-color 0.2s; + vertical-align: bottom; + cursor: pointer; +} +.tsd-select .tsd-select-label { + opacity: 0.6; + transition: opacity 0.2s; +} +.tsd-select .tsd-select-label:before { + background-position: -240px 0; +} +.tsd-select.active .tsd-select-label { + opacity: 0.8; +} +.tsd-select.active .tsd-select-list { + visibility: visible; + opacity: 1; + transition-delay: 0s; +} +.tsd-select .tsd-select-list { + position: absolute; + visibility: hidden; + top: 40px; + left: 0; + margin: 0; + padding: 0; + opacity: 0; + list-style: none; + box-shadow: 0 0 4px rgba(0, 0, 0, 0.25); + transition: visibility 0s 0.2s, opacity 0.2s; +} +.tsd-select .tsd-select-list li { + padding: 0 20px 0 0; + background-color: var(--color-background); +} +.tsd-select .tsd-select-list li:before { + background-position: 40px 0; +} +.tsd-select .tsd-select-list li:nth-child(even) { + background-color: var(--color-panel); +} +.tsd-select .tsd-select-list li:hover { + background-color: var(--color-panel-divider); +} +.tsd-select .tsd-select-list li.selected:before { + background-position: -200px 0; +} +@media (max-width: 900px) { + .tsd-select .tsd-select-list { + top: 0; + left: auto; + right: 100%; + margin-right: -5px; + } + .tsd-select .tsd-select-label:before { + background-position: -280px 0; + } +} + +img { + max-width: 100%; +} diff --git a/docs/assets/images/icons.png b/docs/assets/images/icons.png new file mode 100644 index 000000000..3836d5fe4 Binary files /dev/null and b/docs/assets/images/icons.png differ diff --git a/docs/assets/images/icons@2x.png b/docs/assets/images/icons@2x.png new file mode 100644 index 000000000..5a209e2f6 Binary files /dev/null and b/docs/assets/images/icons@2x.png differ diff --git a/docs/assets/images/widgets.png b/docs/assets/images/widgets.png new file mode 100644 index 000000000..c7380532a Binary files /dev/null and b/docs/assets/images/widgets.png differ diff --git a/docs/assets/images/widgets@2x.png b/docs/assets/images/widgets@2x.png new file mode 100644 index 000000000..4bbbd5727 Binary files /dev/null and b/docs/assets/images/widgets@2x.png differ diff --git a/docs/assets/js/main.js b/docs/assets/js/main.js new file mode 100644 index 000000000..dc257a868 --- /dev/null +++ b/docs/assets/js/main.js @@ -0,0 +1,248 @@ +/* + * ATTENTION: The "eval" devtool has been used (maybe by default in mode: "development"). + * This devtool is not neither made for production nor for readable output files. + * It uses "eval()" calls to create a separate source file in the browser devtools. + * If you are trying to read the output file, select a different devtool (https://webpack.js.org/configuration/devtool/) + * or disable the default devtool with "devtool: false". + * If you are looking for production-ready output files, see mode: "production" (https://webpack.js.org/configuration/mode/). + */ +/******/ (() => { // webpackBootstrap +/******/ var __webpack_modules__ = ({ + +/***/ "../node_modules/lunr/lunr.js": +/*!************************************!*\ + !*** ../node_modules/lunr/lunr.js ***! + \************************************/ +/***/ ((module, exports, __webpack_require__) => { + +eval("var __WEBPACK_AMD_DEFINE_FACTORY__, __WEBPACK_AMD_DEFINE_RESULT__;/**\n * lunr - http://lunrjs.com - A bit like Solr, but much smaller and not as bright - 2.3.9\n * Copyright (C) 2020 Oliver Nightingale\n * @license MIT\n */\n\n;(function(){\n\n/**\n * A convenience function for configuring and constructing\n * a new lunr Index.\n *\n * A lunr.Builder instance is created and the pipeline setup\n * with a trimmer, stop word filter and stemmer.\n *\n * This builder object is yielded to the configuration function\n * that is passed as a parameter, allowing the list of fields\n * and other builder parameters to be customised.\n *\n * All documents _must_ be added within the passed config function.\n *\n * @example\n * var idx = lunr(function () {\n * this.field('title')\n * this.field('body')\n * this.ref('id')\n *\n * documents.forEach(function (doc) {\n * this.add(doc)\n * }, this)\n * })\n *\n * @see {@link lunr.Builder}\n * @see {@link lunr.Pipeline}\n * @see {@link lunr.trimmer}\n * @see {@link lunr.stopWordFilter}\n * @see {@link lunr.stemmer}\n * @namespace {function} lunr\n */\nvar lunr = function (config) {\n var builder = new lunr.Builder\n\n builder.pipeline.add(\n lunr.trimmer,\n lunr.stopWordFilter,\n lunr.stemmer\n )\n\n builder.searchPipeline.add(\n lunr.stemmer\n )\n\n config.call(builder, builder)\n return builder.build()\n}\n\nlunr.version = \"2.3.9\"\n/*!\n * lunr.utils\n * Copyright (C) 2020 Oliver Nightingale\n */\n\n/**\n * A namespace containing utils for the rest of the lunr library\n * @namespace lunr.utils\n */\nlunr.utils = {}\n\n/**\n * Print a warning message to the console.\n *\n * @param {String} message The message to be printed.\n * @memberOf lunr.utils\n * @function\n */\nlunr.utils.warn = (function (global) {\n /* eslint-disable no-console */\n return function (message) {\n if (global.console && console.warn) {\n console.warn(message)\n }\n }\n /* eslint-enable no-console */\n})(this)\n\n/**\n * Convert an object to a string.\n *\n * In the case of `null` and `undefined` the function returns\n * the empty string, in all other cases the result of calling\n * `toString` on the passed object is returned.\n *\n * @param {Any} obj The object to convert to a string.\n * @return {String} string representation of the passed object.\n * @memberOf lunr.utils\n */\nlunr.utils.asString = function (obj) {\n if (obj === void 0 || obj === null) {\n return \"\"\n } else {\n return obj.toString()\n }\n}\n\n/**\n * Clones an object.\n *\n * Will create a copy of an existing object such that any mutations\n * on the copy cannot affect the original.\n *\n * Only shallow objects are supported, passing a nested object to this\n * function will cause a TypeError.\n *\n * Objects with primitives, and arrays of primitives are supported.\n *\n * @param {Object} obj The object to clone.\n * @return {Object} a clone of the passed object.\n * @throws {TypeError} when a nested object is passed.\n * @memberOf Utils\n */\nlunr.utils.clone = function (obj) {\n if (obj === null || obj === undefined) {\n return obj\n }\n\n var clone = Object.create(null),\n keys = Object.keys(obj)\n\n for (var i = 0; i < keys.length; i++) {\n var key = keys[i],\n val = obj[key]\n\n if (Array.isArray(val)) {\n clone[key] = val.slice()\n continue\n }\n\n if (typeof val === 'string' ||\n typeof val === 'number' ||\n typeof val === 'boolean') {\n clone[key] = val\n continue\n }\n\n throw new TypeError(\"clone is not deep and does not support nested objects\")\n }\n\n return clone\n}\nlunr.FieldRef = function (docRef, fieldName, stringValue) {\n this.docRef = docRef\n this.fieldName = fieldName\n this._stringValue = stringValue\n}\n\nlunr.FieldRef.joiner = \"/\"\n\nlunr.FieldRef.fromString = function (s) {\n var n = s.indexOf(lunr.FieldRef.joiner)\n\n if (n === -1) {\n throw \"malformed field ref string\"\n }\n\n var fieldRef = s.slice(0, n),\n docRef = s.slice(n + 1)\n\n return new lunr.FieldRef (docRef, fieldRef, s)\n}\n\nlunr.FieldRef.prototype.toString = function () {\n if (this._stringValue == undefined) {\n this._stringValue = this.fieldName + lunr.FieldRef.joiner + this.docRef\n }\n\n return this._stringValue\n}\n/*!\n * lunr.Set\n * Copyright (C) 2020 Oliver Nightingale\n */\n\n/**\n * A lunr set.\n *\n * @constructor\n */\nlunr.Set = function (elements) {\n this.elements = Object.create(null)\n\n if (elements) {\n this.length = elements.length\n\n for (var i = 0; i < this.length; i++) {\n this.elements[elements[i]] = true\n }\n } else {\n this.length = 0\n }\n}\n\n/**\n * A complete set that contains all elements.\n *\n * @static\n * @readonly\n * @type {lunr.Set}\n */\nlunr.Set.complete = {\n intersect: function (other) {\n return other\n },\n\n union: function () {\n return this\n },\n\n contains: function () {\n return true\n }\n}\n\n/**\n * An empty set that contains no elements.\n *\n * @static\n * @readonly\n * @type {lunr.Set}\n */\nlunr.Set.empty = {\n intersect: function () {\n return this\n },\n\n union: function (other) {\n return other\n },\n\n contains: function () {\n return false\n }\n}\n\n/**\n * Returns true if this set contains the specified object.\n *\n * @param {object} object - Object whose presence in this set is to be tested.\n * @returns {boolean} - True if this set contains the specified object.\n */\nlunr.Set.prototype.contains = function (object) {\n return !!this.elements[object]\n}\n\n/**\n * Returns a new set containing only the elements that are present in both\n * this set and the specified set.\n *\n * @param {lunr.Set} other - set to intersect with this set.\n * @returns {lunr.Set} a new set that is the intersection of this and the specified set.\n */\n\nlunr.Set.prototype.intersect = function (other) {\n var a, b, elements, intersection = []\n\n if (other === lunr.Set.complete) {\n return this\n }\n\n if (other === lunr.Set.empty) {\n return other\n }\n\n if (this.length < other.length) {\n a = this\n b = other\n } else {\n a = other\n b = this\n }\n\n elements = Object.keys(a.elements)\n\n for (var i = 0; i < elements.length; i++) {\n var element = elements[i]\n if (element in b.elements) {\n intersection.push(element)\n }\n }\n\n return new lunr.Set (intersection)\n}\n\n/**\n * Returns a new set combining the elements of this and the specified set.\n *\n * @param {lunr.Set} other - set to union with this set.\n * @return {lunr.Set} a new set that is the union of this and the specified set.\n */\n\nlunr.Set.prototype.union = function (other) {\n if (other === lunr.Set.complete) {\n return lunr.Set.complete\n }\n\n if (other === lunr.Set.empty) {\n return this\n }\n\n return new lunr.Set(Object.keys(this.elements).concat(Object.keys(other.elements)))\n}\n/**\n * A function to calculate the inverse document frequency for\n * a posting. This is shared between the builder and the index\n *\n * @private\n * @param {object} posting - The posting for a given term\n * @param {number} documentCount - The total number of documents.\n */\nlunr.idf = function (posting, documentCount) {\n var documentsWithTerm = 0\n\n for (var fieldName in posting) {\n if (fieldName == '_index') continue // Ignore the term index, its not a field\n documentsWithTerm += Object.keys(posting[fieldName]).length\n }\n\n var x = (documentCount - documentsWithTerm + 0.5) / (documentsWithTerm + 0.5)\n\n return Math.log(1 + Math.abs(x))\n}\n\n/**\n * A token wraps a string representation of a token\n * as it is passed through the text processing pipeline.\n *\n * @constructor\n * @param {string} [str=''] - The string token being wrapped.\n * @param {object} [metadata={}] - Metadata associated with this token.\n */\nlunr.Token = function (str, metadata) {\n this.str = str || \"\"\n this.metadata = metadata || {}\n}\n\n/**\n * Returns the token string that is being wrapped by this object.\n *\n * @returns {string}\n */\nlunr.Token.prototype.toString = function () {\n return this.str\n}\n\n/**\n * A token update function is used when updating or optionally\n * when cloning a token.\n *\n * @callback lunr.Token~updateFunction\n * @param {string} str - The string representation of the token.\n * @param {Object} metadata - All metadata associated with this token.\n */\n\n/**\n * Applies the given function to the wrapped string token.\n *\n * @example\n * token.update(function (str, metadata) {\n * return str.toUpperCase()\n * })\n *\n * @param {lunr.Token~updateFunction} fn - A function to apply to the token string.\n * @returns {lunr.Token}\n */\nlunr.Token.prototype.update = function (fn) {\n this.str = fn(this.str, this.metadata)\n return this\n}\n\n/**\n * Creates a clone of this token. Optionally a function can be\n * applied to the cloned token.\n *\n * @param {lunr.Token~updateFunction} [fn] - An optional function to apply to the cloned token.\n * @returns {lunr.Token}\n */\nlunr.Token.prototype.clone = function (fn) {\n fn = fn || function (s) { return s }\n return new lunr.Token (fn(this.str, this.metadata), this.metadata)\n}\n/*!\n * lunr.tokenizer\n * Copyright (C) 2020 Oliver Nightingale\n */\n\n/**\n * A function for splitting a string into tokens ready to be inserted into\n * the search index. Uses `lunr.tokenizer.separator` to split strings, change\n * the value of this property to change how strings are split into tokens.\n *\n * This tokenizer will convert its parameter to a string by calling `toString` and\n * then will split this string on the character in `lunr.tokenizer.separator`.\n * Arrays will have their elements converted to strings and wrapped in a lunr.Token.\n *\n * Optional metadata can be passed to the tokenizer, this metadata will be cloned and\n * added as metadata to every token that is created from the object to be tokenized.\n *\n * @static\n * @param {?(string|object|object[])} obj - The object to convert into tokens\n * @param {?object} metadata - Optional metadata to associate with every token\n * @returns {lunr.Token[]}\n * @see {@link lunr.Pipeline}\n */\nlunr.tokenizer = function (obj, metadata) {\n if (obj == null || obj == undefined) {\n return []\n }\n\n if (Array.isArray(obj)) {\n return obj.map(function (t) {\n return new lunr.Token(\n lunr.utils.asString(t).toLowerCase(),\n lunr.utils.clone(metadata)\n )\n })\n }\n\n var str = obj.toString().toLowerCase(),\n len = str.length,\n tokens = []\n\n for (var sliceEnd = 0, sliceStart = 0; sliceEnd <= len; sliceEnd++) {\n var char = str.charAt(sliceEnd),\n sliceLength = sliceEnd - sliceStart\n\n if ((char.match(lunr.tokenizer.separator) || sliceEnd == len)) {\n\n if (sliceLength > 0) {\n var tokenMetadata = lunr.utils.clone(metadata) || {}\n tokenMetadata[\"position\"] = [sliceStart, sliceLength]\n tokenMetadata[\"index\"] = tokens.length\n\n tokens.push(\n new lunr.Token (\n str.slice(sliceStart, sliceEnd),\n tokenMetadata\n )\n )\n }\n\n sliceStart = sliceEnd + 1\n }\n\n }\n\n return tokens\n}\n\n/**\n * The separator used to split a string into tokens. Override this property to change the behaviour of\n * `lunr.tokenizer` behaviour when tokenizing strings. By default this splits on whitespace and hyphens.\n *\n * @static\n * @see lunr.tokenizer\n */\nlunr.tokenizer.separator = /[\\s\\-]+/\n/*!\n * lunr.Pipeline\n * Copyright (C) 2020 Oliver Nightingale\n */\n\n/**\n * lunr.Pipelines maintain an ordered list of functions to be applied to all\n * tokens in documents entering the search index and queries being ran against\n * the index.\n *\n * An instance of lunr.Index created with the lunr shortcut will contain a\n * pipeline with a stop word filter and an English language stemmer. Extra\n * functions can be added before or after either of these functions or these\n * default functions can be removed.\n *\n * When run the pipeline will call each function in turn, passing a token, the\n * index of that token in the original list of all tokens and finally a list of\n * all the original tokens.\n *\n * The output of functions in the pipeline will be passed to the next function\n * in the pipeline. To exclude a token from entering the index the function\n * should return undefined, the rest of the pipeline will not be called with\n * this token.\n *\n * For serialisation of pipelines to work, all functions used in an instance of\n * a pipeline should be registered with lunr.Pipeline. Registered functions can\n * then be loaded. If trying to load a serialised pipeline that uses functions\n * that are not registered an error will be thrown.\n *\n * If not planning on serialising the pipeline then registering pipeline functions\n * is not necessary.\n *\n * @constructor\n */\nlunr.Pipeline = function () {\n this._stack = []\n}\n\nlunr.Pipeline.registeredFunctions = Object.create(null)\n\n/**\n * A pipeline function maps lunr.Token to lunr.Token. A lunr.Token contains the token\n * string as well as all known metadata. A pipeline function can mutate the token string\n * or mutate (or add) metadata for a given token.\n *\n * A pipeline function can indicate that the passed token should be discarded by returning\n * null, undefined or an empty string. This token will not be passed to any downstream pipeline\n * functions and will not be added to the index.\n *\n * Multiple tokens can be returned by returning an array of tokens. Each token will be passed\n * to any downstream pipeline functions and all will returned tokens will be added to the index.\n *\n * Any number of pipeline functions may be chained together using a lunr.Pipeline.\n *\n * @interface lunr.PipelineFunction\n * @param {lunr.Token} token - A token from the document being processed.\n * @param {number} i - The index of this token in the complete list of tokens for this document/field.\n * @param {lunr.Token[]} tokens - All tokens for this document/field.\n * @returns {(?lunr.Token|lunr.Token[])}\n */\n\n/**\n * Register a function with the pipeline.\n *\n * Functions that are used in the pipeline should be registered if the pipeline\n * needs to be serialised, or a serialised pipeline needs to be loaded.\n *\n * Registering a function does not add it to a pipeline, functions must still be\n * added to instances of the pipeline for them to be used when running a pipeline.\n *\n * @param {lunr.PipelineFunction} fn - The function to check for.\n * @param {String} label - The label to register this function with\n */\nlunr.Pipeline.registerFunction = function (fn, label) {\n if (label in this.registeredFunctions) {\n lunr.utils.warn('Overwriting existing registered function: ' + label)\n }\n\n fn.label = label\n lunr.Pipeline.registeredFunctions[fn.label] = fn\n}\n\n/**\n * Warns if the function is not registered as a Pipeline function.\n *\n * @param {lunr.PipelineFunction} fn - The function to check for.\n * @private\n */\nlunr.Pipeline.warnIfFunctionNotRegistered = function (fn) {\n var isRegistered = fn.label && (fn.label in this.registeredFunctions)\n\n if (!isRegistered) {\n lunr.utils.warn('Function is not registered with pipeline. This may cause problems when serialising the index.\\n', fn)\n }\n}\n\n/**\n * Loads a previously serialised pipeline.\n *\n * All functions to be loaded must already be registered with lunr.Pipeline.\n * If any function from the serialised data has not been registered then an\n * error will be thrown.\n *\n * @param {Object} serialised - The serialised pipeline to load.\n * @returns {lunr.Pipeline}\n */\nlunr.Pipeline.load = function (serialised) {\n var pipeline = new lunr.Pipeline\n\n serialised.forEach(function (fnName) {\n var fn = lunr.Pipeline.registeredFunctions[fnName]\n\n if (fn) {\n pipeline.add(fn)\n } else {\n throw new Error('Cannot load unregistered function: ' + fnName)\n }\n })\n\n return pipeline\n}\n\n/**\n * Adds new functions to the end of the pipeline.\n *\n * Logs a warning if the function has not been registered.\n *\n * @param {lunr.PipelineFunction[]} functions - Any number of functions to add to the pipeline.\n */\nlunr.Pipeline.prototype.add = function () {\n var fns = Array.prototype.slice.call(arguments)\n\n fns.forEach(function (fn) {\n lunr.Pipeline.warnIfFunctionNotRegistered(fn)\n this._stack.push(fn)\n }, this)\n}\n\n/**\n * Adds a single function after a function that already exists in the\n * pipeline.\n *\n * Logs a warning if the function has not been registered.\n *\n * @param {lunr.PipelineFunction} existingFn - A function that already exists in the pipeline.\n * @param {lunr.PipelineFunction} newFn - The new function to add to the pipeline.\n */\nlunr.Pipeline.prototype.after = function (existingFn, newFn) {\n lunr.Pipeline.warnIfFunctionNotRegistered(newFn)\n\n var pos = this._stack.indexOf(existingFn)\n if (pos == -1) {\n throw new Error('Cannot find existingFn')\n }\n\n pos = pos + 1\n this._stack.splice(pos, 0, newFn)\n}\n\n/**\n * Adds a single function before a function that already exists in the\n * pipeline.\n *\n * Logs a warning if the function has not been registered.\n *\n * @param {lunr.PipelineFunction} existingFn - A function that already exists in the pipeline.\n * @param {lunr.PipelineFunction} newFn - The new function to add to the pipeline.\n */\nlunr.Pipeline.prototype.before = function (existingFn, newFn) {\n lunr.Pipeline.warnIfFunctionNotRegistered(newFn)\n\n var pos = this._stack.indexOf(existingFn)\n if (pos == -1) {\n throw new Error('Cannot find existingFn')\n }\n\n this._stack.splice(pos, 0, newFn)\n}\n\n/**\n * Removes a function from the pipeline.\n *\n * @param {lunr.PipelineFunction} fn The function to remove from the pipeline.\n */\nlunr.Pipeline.prototype.remove = function (fn) {\n var pos = this._stack.indexOf(fn)\n if (pos == -1) {\n return\n }\n\n this._stack.splice(pos, 1)\n}\n\n/**\n * Runs the current list of functions that make up the pipeline against the\n * passed tokens.\n *\n * @param {Array} tokens The tokens to run through the pipeline.\n * @returns {Array}\n */\nlunr.Pipeline.prototype.run = function (tokens) {\n var stackLength = this._stack.length\n\n for (var i = 0; i < stackLength; i++) {\n var fn = this._stack[i]\n var memo = []\n\n for (var j = 0; j < tokens.length; j++) {\n var result = fn(tokens[j], j, tokens)\n\n if (result === null || result === void 0 || result === '') continue\n\n if (Array.isArray(result)) {\n for (var k = 0; k < result.length; k++) {\n memo.push(result[k])\n }\n } else {\n memo.push(result)\n }\n }\n\n tokens = memo\n }\n\n return tokens\n}\n\n/**\n * Convenience method for passing a string through a pipeline and getting\n * strings out. This method takes care of wrapping the passed string in a\n * token and mapping the resulting tokens back to strings.\n *\n * @param {string} str - The string to pass through the pipeline.\n * @param {?object} metadata - Optional metadata to associate with the token\n * passed to the pipeline.\n * @returns {string[]}\n */\nlunr.Pipeline.prototype.runString = function (str, metadata) {\n var token = new lunr.Token (str, metadata)\n\n return this.run([token]).map(function (t) {\n return t.toString()\n })\n}\n\n/**\n * Resets the pipeline by removing any existing processors.\n *\n */\nlunr.Pipeline.prototype.reset = function () {\n this._stack = []\n}\n\n/**\n * Returns a representation of the pipeline ready for serialisation.\n *\n * Logs a warning if the function has not been registered.\n *\n * @returns {Array}\n */\nlunr.Pipeline.prototype.toJSON = function () {\n return this._stack.map(function (fn) {\n lunr.Pipeline.warnIfFunctionNotRegistered(fn)\n\n return fn.label\n })\n}\n/*!\n * lunr.Vector\n * Copyright (C) 2020 Oliver Nightingale\n */\n\n/**\n * A vector is used to construct the vector space of documents and queries. These\n * vectors support operations to determine the similarity between two documents or\n * a document and a query.\n *\n * Normally no parameters are required for initializing a vector, but in the case of\n * loading a previously dumped vector the raw elements can be provided to the constructor.\n *\n * For performance reasons vectors are implemented with a flat array, where an elements\n * index is immediately followed by its value. E.g. [index, value, index, value]. This\n * allows the underlying array to be as sparse as possible and still offer decent\n * performance when being used for vector calculations.\n *\n * @constructor\n * @param {Number[]} [elements] - The flat list of element index and element value pairs.\n */\nlunr.Vector = function (elements) {\n this._magnitude = 0\n this.elements = elements || []\n}\n\n\n/**\n * Calculates the position within the vector to insert a given index.\n *\n * This is used internally by insert and upsert. If there are duplicate indexes then\n * the position is returned as if the value for that index were to be updated, but it\n * is the callers responsibility to check whether there is a duplicate at that index\n *\n * @param {Number} insertIdx - The index at which the element should be inserted.\n * @returns {Number}\n */\nlunr.Vector.prototype.positionForIndex = function (index) {\n // For an empty vector the tuple can be inserted at the beginning\n if (this.elements.length == 0) {\n return 0\n }\n\n var start = 0,\n end = this.elements.length / 2,\n sliceLength = end - start,\n pivotPoint = Math.floor(sliceLength / 2),\n pivotIndex = this.elements[pivotPoint * 2]\n\n while (sliceLength > 1) {\n if (pivotIndex < index) {\n start = pivotPoint\n }\n\n if (pivotIndex > index) {\n end = pivotPoint\n }\n\n if (pivotIndex == index) {\n break\n }\n\n sliceLength = end - start\n pivotPoint = start + Math.floor(sliceLength / 2)\n pivotIndex = this.elements[pivotPoint * 2]\n }\n\n if (pivotIndex == index) {\n return pivotPoint * 2\n }\n\n if (pivotIndex > index) {\n return pivotPoint * 2\n }\n\n if (pivotIndex < index) {\n return (pivotPoint + 1) * 2\n }\n}\n\n/**\n * Inserts an element at an index within the vector.\n *\n * Does not allow duplicates, will throw an error if there is already an entry\n * for this index.\n *\n * @param {Number} insertIdx - The index at which the element should be inserted.\n * @param {Number} val - The value to be inserted into the vector.\n */\nlunr.Vector.prototype.insert = function (insertIdx, val) {\n this.upsert(insertIdx, val, function () {\n throw \"duplicate index\"\n })\n}\n\n/**\n * Inserts or updates an existing index within the vector.\n *\n * @param {Number} insertIdx - The index at which the element should be inserted.\n * @param {Number} val - The value to be inserted into the vector.\n * @param {function} fn - A function that is called for updates, the existing value and the\n * requested value are passed as arguments\n */\nlunr.Vector.prototype.upsert = function (insertIdx, val, fn) {\n this._magnitude = 0\n var position = this.positionForIndex(insertIdx)\n\n if (this.elements[position] == insertIdx) {\n this.elements[position + 1] = fn(this.elements[position + 1], val)\n } else {\n this.elements.splice(position, 0, insertIdx, val)\n }\n}\n\n/**\n * Calculates the magnitude of this vector.\n *\n * @returns {Number}\n */\nlunr.Vector.prototype.magnitude = function () {\n if (this._magnitude) return this._magnitude\n\n var sumOfSquares = 0,\n elementsLength = this.elements.length\n\n for (var i = 1; i < elementsLength; i += 2) {\n var val = this.elements[i]\n sumOfSquares += val * val\n }\n\n return this._magnitude = Math.sqrt(sumOfSquares)\n}\n\n/**\n * Calculates the dot product of this vector and another vector.\n *\n * @param {lunr.Vector} otherVector - The vector to compute the dot product with.\n * @returns {Number}\n */\nlunr.Vector.prototype.dot = function (otherVector) {\n var dotProduct = 0,\n a = this.elements, b = otherVector.elements,\n aLen = a.length, bLen = b.length,\n aVal = 0, bVal = 0,\n i = 0, j = 0\n\n while (i < aLen && j < bLen) {\n aVal = a[i], bVal = b[j]\n if (aVal < bVal) {\n i += 2\n } else if (aVal > bVal) {\n j += 2\n } else if (aVal == bVal) {\n dotProduct += a[i + 1] * b[j + 1]\n i += 2\n j += 2\n }\n }\n\n return dotProduct\n}\n\n/**\n * Calculates the similarity between this vector and another vector.\n *\n * @param {lunr.Vector} otherVector - The other vector to calculate the\n * similarity with.\n * @returns {Number}\n */\nlunr.Vector.prototype.similarity = function (otherVector) {\n return this.dot(otherVector) / this.magnitude() || 0\n}\n\n/**\n * Converts the vector to an array of the elements within the vector.\n *\n * @returns {Number[]}\n */\nlunr.Vector.prototype.toArray = function () {\n var output = new Array (this.elements.length / 2)\n\n for (var i = 1, j = 0; i < this.elements.length; i += 2, j++) {\n output[j] = this.elements[i]\n }\n\n return output\n}\n\n/**\n * A JSON serializable representation of the vector.\n *\n * @returns {Number[]}\n */\nlunr.Vector.prototype.toJSON = function () {\n return this.elements\n}\n/* eslint-disable */\n/*!\n * lunr.stemmer\n * Copyright (C) 2020 Oliver Nightingale\n * Includes code from - http://tartarus.org/~martin/PorterStemmer/js.txt\n */\n\n/**\n * lunr.stemmer is an english language stemmer, this is a JavaScript\n * implementation of the PorterStemmer taken from http://tartarus.org/~martin\n *\n * @static\n * @implements {lunr.PipelineFunction}\n * @param {lunr.Token} token - The string to stem\n * @returns {lunr.Token}\n * @see {@link lunr.Pipeline}\n * @function\n */\nlunr.stemmer = (function(){\n var step2list = {\n \"ational\" : \"ate\",\n \"tional\" : \"tion\",\n \"enci\" : \"ence\",\n \"anci\" : \"ance\",\n \"izer\" : \"ize\",\n \"bli\" : \"ble\",\n \"alli\" : \"al\",\n \"entli\" : \"ent\",\n \"eli\" : \"e\",\n \"ousli\" : \"ous\",\n \"ization\" : \"ize\",\n \"ation\" : \"ate\",\n \"ator\" : \"ate\",\n \"alism\" : \"al\",\n \"iveness\" : \"ive\",\n \"fulness\" : \"ful\",\n \"ousness\" : \"ous\",\n \"aliti\" : \"al\",\n \"iviti\" : \"ive\",\n \"biliti\" : \"ble\",\n \"logi\" : \"log\"\n },\n\n step3list = {\n \"icate\" : \"ic\",\n \"ative\" : \"\",\n \"alize\" : \"al\",\n \"iciti\" : \"ic\",\n \"ical\" : \"ic\",\n \"ful\" : \"\",\n \"ness\" : \"\"\n },\n\n c = \"[^aeiou]\", // consonant\n v = \"[aeiouy]\", // vowel\n C = c + \"[^aeiouy]*\", // consonant sequence\n V = v + \"[aeiou]*\", // vowel sequence\n\n mgr0 = \"^(\" + C + \")?\" + V + C, // [C]VC... is m>0\n meq1 = \"^(\" + C + \")?\" + V + C + \"(\" + V + \")?$\", // [C]VC[V] is m=1\n mgr1 = \"^(\" + C + \")?\" + V + C + V + C, // [C]VCVC... is m>1\n s_v = \"^(\" + C + \")?\" + v; // vowel in stem\n\n var re_mgr0 = new RegExp(mgr0);\n var re_mgr1 = new RegExp(mgr1);\n var re_meq1 = new RegExp(meq1);\n var re_s_v = new RegExp(s_v);\n\n var re_1a = /^(.+?)(ss|i)es$/;\n var re2_1a = /^(.+?)([^s])s$/;\n var re_1b = /^(.+?)eed$/;\n var re2_1b = /^(.+?)(ed|ing)$/;\n var re_1b_2 = /.$/;\n var re2_1b_2 = /(at|bl|iz)$/;\n var re3_1b_2 = new RegExp(\"([^aeiouylsz])\\\\1$\");\n var re4_1b_2 = new RegExp(\"^\" + C + v + \"[^aeiouwxy]$\");\n\n var re_1c = /^(.+?[^aeiou])y$/;\n var re_2 = /^(.+?)(ational|tional|enci|anci|izer|bli|alli|entli|eli|ousli|ization|ation|ator|alism|iveness|fulness|ousness|aliti|iviti|biliti|logi)$/;\n\n var re_3 = /^(.+?)(icate|ative|alize|iciti|ical|ful|ness)$/;\n\n var re_4 = /^(.+?)(al|ance|ence|er|ic|able|ible|ant|ement|ment|ent|ou|ism|ate|iti|ous|ive|ize)$/;\n var re2_4 = /^(.+?)(s|t)(ion)$/;\n\n var re_5 = /^(.+?)e$/;\n var re_5_1 = /ll$/;\n var re3_5 = new RegExp(\"^\" + C + v + \"[^aeiouwxy]$\");\n\n var porterStemmer = function porterStemmer(w) {\n var stem,\n suffix,\n firstch,\n re,\n re2,\n re3,\n re4;\n\n if (w.length < 3) { return w; }\n\n firstch = w.substr(0,1);\n if (firstch == \"y\") {\n w = firstch.toUpperCase() + w.substr(1);\n }\n\n // Step 1a\n re = re_1a\n re2 = re2_1a;\n\n if (re.test(w)) { w = w.replace(re,\"$1$2\"); }\n else if (re2.test(w)) { w = w.replace(re2,\"$1$2\"); }\n\n // Step 1b\n re = re_1b;\n re2 = re2_1b;\n if (re.test(w)) {\n var fp = re.exec(w);\n re = re_mgr0;\n if (re.test(fp[1])) {\n re = re_1b_2;\n w = w.replace(re,\"\");\n }\n } else if (re2.test(w)) {\n var fp = re2.exec(w);\n stem = fp[1];\n re2 = re_s_v;\n if (re2.test(stem)) {\n w = stem;\n re2 = re2_1b_2;\n re3 = re3_1b_2;\n re4 = re4_1b_2;\n if (re2.test(w)) { w = w + \"e\"; }\n else if (re3.test(w)) { re = re_1b_2; w = w.replace(re,\"\"); }\n else if (re4.test(w)) { w = w + \"e\"; }\n }\n }\n\n // Step 1c - replace suffix y or Y by i if preceded by a non-vowel which is not the first letter of the word (so cry -> cri, by -> by, say -> say)\n re = re_1c;\n if (re.test(w)) {\n var fp = re.exec(w);\n stem = fp[1];\n w = stem + \"i\";\n }\n\n // Step 2\n re = re_2;\n if (re.test(w)) {\n var fp = re.exec(w);\n stem = fp[1];\n suffix = fp[2];\n re = re_mgr0;\n if (re.test(stem)) {\n w = stem + step2list[suffix];\n }\n }\n\n // Step 3\n re = re_3;\n if (re.test(w)) {\n var fp = re.exec(w);\n stem = fp[1];\n suffix = fp[2];\n re = re_mgr0;\n if (re.test(stem)) {\n w = stem + step3list[suffix];\n }\n }\n\n // Step 4\n re = re_4;\n re2 = re2_4;\n if (re.test(w)) {\n var fp = re.exec(w);\n stem = fp[1];\n re = re_mgr1;\n if (re.test(stem)) {\n w = stem;\n }\n } else if (re2.test(w)) {\n var fp = re2.exec(w);\n stem = fp[1] + fp[2];\n re2 = re_mgr1;\n if (re2.test(stem)) {\n w = stem;\n }\n }\n\n // Step 5\n re = re_5;\n if (re.test(w)) {\n var fp = re.exec(w);\n stem = fp[1];\n re = re_mgr1;\n re2 = re_meq1;\n re3 = re3_5;\n if (re.test(stem) || (re2.test(stem) && !(re3.test(stem)))) {\n w = stem;\n }\n }\n\n re = re_5_1;\n re2 = re_mgr1;\n if (re.test(w) && re2.test(w)) {\n re = re_1b_2;\n w = w.replace(re,\"\");\n }\n\n // and turn initial Y back to y\n\n if (firstch == \"y\") {\n w = firstch.toLowerCase() + w.substr(1);\n }\n\n return w;\n };\n\n return function (token) {\n return token.update(porterStemmer);\n }\n})();\n\nlunr.Pipeline.registerFunction(lunr.stemmer, 'stemmer')\n/*!\n * lunr.stopWordFilter\n * Copyright (C) 2020 Oliver Nightingale\n */\n\n/**\n * lunr.generateStopWordFilter builds a stopWordFilter function from the provided\n * list of stop words.\n *\n * The built in lunr.stopWordFilter is built using this generator and can be used\n * to generate custom stopWordFilters for applications or non English languages.\n *\n * @function\n * @param {Array} token The token to pass through the filter\n * @returns {lunr.PipelineFunction}\n * @see lunr.Pipeline\n * @see lunr.stopWordFilter\n */\nlunr.generateStopWordFilter = function (stopWords) {\n var words = stopWords.reduce(function (memo, stopWord) {\n memo[stopWord] = stopWord\n return memo\n }, {})\n\n return function (token) {\n if (token && words[token.toString()] !== token.toString()) return token\n }\n}\n\n/**\n * lunr.stopWordFilter is an English language stop word list filter, any words\n * contained in the list will not be passed through the filter.\n *\n * This is intended to be used in the Pipeline. If the token does not pass the\n * filter then undefined will be returned.\n *\n * @function\n * @implements {lunr.PipelineFunction}\n * @params {lunr.Token} token - A token to check for being a stop word.\n * @returns {lunr.Token}\n * @see {@link lunr.Pipeline}\n */\nlunr.stopWordFilter = lunr.generateStopWordFilter([\n 'a',\n 'able',\n 'about',\n 'across',\n 'after',\n 'all',\n 'almost',\n 'also',\n 'am',\n 'among',\n 'an',\n 'and',\n 'any',\n 'are',\n 'as',\n 'at',\n 'be',\n 'because',\n 'been',\n 'but',\n 'by',\n 'can',\n 'cannot',\n 'could',\n 'dear',\n 'did',\n 'do',\n 'does',\n 'either',\n 'else',\n 'ever',\n 'every',\n 'for',\n 'from',\n 'get',\n 'got',\n 'had',\n 'has',\n 'have',\n 'he',\n 'her',\n 'hers',\n 'him',\n 'his',\n 'how',\n 'however',\n 'i',\n 'if',\n 'in',\n 'into',\n 'is',\n 'it',\n 'its',\n 'just',\n 'least',\n 'let',\n 'like',\n 'likely',\n 'may',\n 'me',\n 'might',\n 'most',\n 'must',\n 'my',\n 'neither',\n 'no',\n 'nor',\n 'not',\n 'of',\n 'off',\n 'often',\n 'on',\n 'only',\n 'or',\n 'other',\n 'our',\n 'own',\n 'rather',\n 'said',\n 'say',\n 'says',\n 'she',\n 'should',\n 'since',\n 'so',\n 'some',\n 'than',\n 'that',\n 'the',\n 'their',\n 'them',\n 'then',\n 'there',\n 'these',\n 'they',\n 'this',\n 'tis',\n 'to',\n 'too',\n 'twas',\n 'us',\n 'wants',\n 'was',\n 'we',\n 'were',\n 'what',\n 'when',\n 'where',\n 'which',\n 'while',\n 'who',\n 'whom',\n 'why',\n 'will',\n 'with',\n 'would',\n 'yet',\n 'you',\n 'your'\n])\n\nlunr.Pipeline.registerFunction(lunr.stopWordFilter, 'stopWordFilter')\n/*!\n * lunr.trimmer\n * Copyright (C) 2020 Oliver Nightingale\n */\n\n/**\n * lunr.trimmer is a pipeline function for trimming non word\n * characters from the beginning and end of tokens before they\n * enter the index.\n *\n * This implementation may not work correctly for non latin\n * characters and should either be removed or adapted for use\n * with languages with non-latin characters.\n *\n * @static\n * @implements {lunr.PipelineFunction}\n * @param {lunr.Token} token The token to pass through the filter\n * @returns {lunr.Token}\n * @see lunr.Pipeline\n */\nlunr.trimmer = function (token) {\n return token.update(function (s) {\n return s.replace(/^\\W+/, '').replace(/\\W+$/, '')\n })\n}\n\nlunr.Pipeline.registerFunction(lunr.trimmer, 'trimmer')\n/*!\n * lunr.TokenSet\n * Copyright (C) 2020 Oliver Nightingale\n */\n\n/**\n * A token set is used to store the unique list of all tokens\n * within an index. Token sets are also used to represent an\n * incoming query to the index, this query token set and index\n * token set are then intersected to find which tokens to look\n * up in the inverted index.\n *\n * A token set can hold multiple tokens, as in the case of the\n * index token set, or it can hold a single token as in the\n * case of a simple query token set.\n *\n * Additionally token sets are used to perform wildcard matching.\n * Leading, contained and trailing wildcards are supported, and\n * from this edit distance matching can also be provided.\n *\n * Token sets are implemented as a minimal finite state automata,\n * where both common prefixes and suffixes are shared between tokens.\n * This helps to reduce the space used for storing the token set.\n *\n * @constructor\n */\nlunr.TokenSet = function () {\n this.final = false\n this.edges = {}\n this.id = lunr.TokenSet._nextId\n lunr.TokenSet._nextId += 1\n}\n\n/**\n * Keeps track of the next, auto increment, identifier to assign\n * to a new tokenSet.\n *\n * TokenSets require a unique identifier to be correctly minimised.\n *\n * @private\n */\nlunr.TokenSet._nextId = 1\n\n/**\n * Creates a TokenSet instance from the given sorted array of words.\n *\n * @param {String[]} arr - A sorted array of strings to create the set from.\n * @returns {lunr.TokenSet}\n * @throws Will throw an error if the input array is not sorted.\n */\nlunr.TokenSet.fromArray = function (arr) {\n var builder = new lunr.TokenSet.Builder\n\n for (var i = 0, len = arr.length; i < len; i++) {\n builder.insert(arr[i])\n }\n\n builder.finish()\n return builder.root\n}\n\n/**\n * Creates a token set from a query clause.\n *\n * @private\n * @param {Object} clause - A single clause from lunr.Query.\n * @param {string} clause.term - The query clause term.\n * @param {number} [clause.editDistance] - The optional edit distance for the term.\n * @returns {lunr.TokenSet}\n */\nlunr.TokenSet.fromClause = function (clause) {\n if ('editDistance' in clause) {\n return lunr.TokenSet.fromFuzzyString(clause.term, clause.editDistance)\n } else {\n return lunr.TokenSet.fromString(clause.term)\n }\n}\n\n/**\n * Creates a token set representing a single string with a specified\n * edit distance.\n *\n * Insertions, deletions, substitutions and transpositions are each\n * treated as an edit distance of 1.\n *\n * Increasing the allowed edit distance will have a dramatic impact\n * on the performance of both creating and intersecting these TokenSets.\n * It is advised to keep the edit distance less than 3.\n *\n * @param {string} str - The string to create the token set from.\n * @param {number} editDistance - The allowed edit distance to match.\n * @returns {lunr.Vector}\n */\nlunr.TokenSet.fromFuzzyString = function (str, editDistance) {\n var root = new lunr.TokenSet\n\n var stack = [{\n node: root,\n editsRemaining: editDistance,\n str: str\n }]\n\n while (stack.length) {\n var frame = stack.pop()\n\n // no edit\n if (frame.str.length > 0) {\n var char = frame.str.charAt(0),\n noEditNode\n\n if (char in frame.node.edges) {\n noEditNode = frame.node.edges[char]\n } else {\n noEditNode = new lunr.TokenSet\n frame.node.edges[char] = noEditNode\n }\n\n if (frame.str.length == 1) {\n noEditNode.final = true\n }\n\n stack.push({\n node: noEditNode,\n editsRemaining: frame.editsRemaining,\n str: frame.str.slice(1)\n })\n }\n\n if (frame.editsRemaining == 0) {\n continue\n }\n\n // insertion\n if (\"*\" in frame.node.edges) {\n var insertionNode = frame.node.edges[\"*\"]\n } else {\n var insertionNode = new lunr.TokenSet\n frame.node.edges[\"*\"] = insertionNode\n }\n\n if (frame.str.length == 0) {\n insertionNode.final = true\n }\n\n stack.push({\n node: insertionNode,\n editsRemaining: frame.editsRemaining - 1,\n str: frame.str\n })\n\n // deletion\n // can only do a deletion if we have enough edits remaining\n // and if there are characters left to delete in the string\n if (frame.str.length > 1) {\n stack.push({\n node: frame.node,\n editsRemaining: frame.editsRemaining - 1,\n str: frame.str.slice(1)\n })\n }\n\n // deletion\n // just removing the last character from the str\n if (frame.str.length == 1) {\n frame.node.final = true\n }\n\n // substitution\n // can only do a substitution if we have enough edits remaining\n // and if there are characters left to substitute\n if (frame.str.length >= 1) {\n if (\"*\" in frame.node.edges) {\n var substitutionNode = frame.node.edges[\"*\"]\n } else {\n var substitutionNode = new lunr.TokenSet\n frame.node.edges[\"*\"] = substitutionNode\n }\n\n if (frame.str.length == 1) {\n substitutionNode.final = true\n }\n\n stack.push({\n node: substitutionNode,\n editsRemaining: frame.editsRemaining - 1,\n str: frame.str.slice(1)\n })\n }\n\n // transposition\n // can only do a transposition if there are edits remaining\n // and there are enough characters to transpose\n if (frame.str.length > 1) {\n var charA = frame.str.charAt(0),\n charB = frame.str.charAt(1),\n transposeNode\n\n if (charB in frame.node.edges) {\n transposeNode = frame.node.edges[charB]\n } else {\n transposeNode = new lunr.TokenSet\n frame.node.edges[charB] = transposeNode\n }\n\n if (frame.str.length == 1) {\n transposeNode.final = true\n }\n\n stack.push({\n node: transposeNode,\n editsRemaining: frame.editsRemaining - 1,\n str: charA + frame.str.slice(2)\n })\n }\n }\n\n return root\n}\n\n/**\n * Creates a TokenSet from a string.\n *\n * The string may contain one or more wildcard characters (*)\n * that will allow wildcard matching when intersecting with\n * another TokenSet.\n *\n * @param {string} str - The string to create a TokenSet from.\n * @returns {lunr.TokenSet}\n */\nlunr.TokenSet.fromString = function (str) {\n var node = new lunr.TokenSet,\n root = node\n\n /*\n * Iterates through all characters within the passed string\n * appending a node for each character.\n *\n * When a wildcard character is found then a self\n * referencing edge is introduced to continually match\n * any number of any characters.\n */\n for (var i = 0, len = str.length; i < len; i++) {\n var char = str[i],\n final = (i == len - 1)\n\n if (char == \"*\") {\n node.edges[char] = node\n node.final = final\n\n } else {\n var next = new lunr.TokenSet\n next.final = final\n\n node.edges[char] = next\n node = next\n }\n }\n\n return root\n}\n\n/**\n * Converts this TokenSet into an array of strings\n * contained within the TokenSet.\n *\n * This is not intended to be used on a TokenSet that\n * contains wildcards, in these cases the results are\n * undefined and are likely to cause an infinite loop.\n *\n * @returns {string[]}\n */\nlunr.TokenSet.prototype.toArray = function () {\n var words = []\n\n var stack = [{\n prefix: \"\",\n node: this\n }]\n\n while (stack.length) {\n var frame = stack.pop(),\n edges = Object.keys(frame.node.edges),\n len = edges.length\n\n if (frame.node.final) {\n /* In Safari, at this point the prefix is sometimes corrupted, see:\n * https://github.com/olivernn/lunr.js/issues/279 Calling any\n * String.prototype method forces Safari to \"cast\" this string to what\n * it's supposed to be, fixing the bug. */\n frame.prefix.charAt(0)\n words.push(frame.prefix)\n }\n\n for (var i = 0; i < len; i++) {\n var edge = edges[i]\n\n stack.push({\n prefix: frame.prefix.concat(edge),\n node: frame.node.edges[edge]\n })\n }\n }\n\n return words\n}\n\n/**\n * Generates a string representation of a TokenSet.\n *\n * This is intended to allow TokenSets to be used as keys\n * in objects, largely to aid the construction and minimisation\n * of a TokenSet. As such it is not designed to be a human\n * friendly representation of the TokenSet.\n *\n * @returns {string}\n */\nlunr.TokenSet.prototype.toString = function () {\n // NOTE: Using Object.keys here as this.edges is very likely\n // to enter 'hash-mode' with many keys being added\n //\n // avoiding a for-in loop here as it leads to the function\n // being de-optimised (at least in V8). From some simple\n // benchmarks the performance is comparable, but allowing\n // V8 to optimize may mean easy performance wins in the future.\n\n if (this._str) {\n return this._str\n }\n\n var str = this.final ? '1' : '0',\n labels = Object.keys(this.edges).sort(),\n len = labels.length\n\n for (var i = 0; i < len; i++) {\n var label = labels[i],\n node = this.edges[label]\n\n str = str + label + node.id\n }\n\n return str\n}\n\n/**\n * Returns a new TokenSet that is the intersection of\n * this TokenSet and the passed TokenSet.\n *\n * This intersection will take into account any wildcards\n * contained within the TokenSet.\n *\n * @param {lunr.TokenSet} b - An other TokenSet to intersect with.\n * @returns {lunr.TokenSet}\n */\nlunr.TokenSet.prototype.intersect = function (b) {\n var output = new lunr.TokenSet,\n frame = undefined\n\n var stack = [{\n qNode: b,\n output: output,\n node: this\n }]\n\n while (stack.length) {\n frame = stack.pop()\n\n // NOTE: As with the #toString method, we are using\n // Object.keys and a for loop instead of a for-in loop\n // as both of these objects enter 'hash' mode, causing\n // the function to be de-optimised in V8\n var qEdges = Object.keys(frame.qNode.edges),\n qLen = qEdges.length,\n nEdges = Object.keys(frame.node.edges),\n nLen = nEdges.length\n\n for (var q = 0; q < qLen; q++) {\n var qEdge = qEdges[q]\n\n for (var n = 0; n < nLen; n++) {\n var nEdge = nEdges[n]\n\n if (nEdge == qEdge || qEdge == '*') {\n var node = frame.node.edges[nEdge],\n qNode = frame.qNode.edges[qEdge],\n final = node.final && qNode.final,\n next = undefined\n\n if (nEdge in frame.output.edges) {\n // an edge already exists for this character\n // no need to create a new node, just set the finality\n // bit unless this node is already final\n next = frame.output.edges[nEdge]\n next.final = next.final || final\n\n } else {\n // no edge exists yet, must create one\n // set the finality bit and insert it\n // into the output\n next = new lunr.TokenSet\n next.final = final\n frame.output.edges[nEdge] = next\n }\n\n stack.push({\n qNode: qNode,\n output: next,\n node: node\n })\n }\n }\n }\n }\n\n return output\n}\nlunr.TokenSet.Builder = function () {\n this.previousWord = \"\"\n this.root = new lunr.TokenSet\n this.uncheckedNodes = []\n this.minimizedNodes = {}\n}\n\nlunr.TokenSet.Builder.prototype.insert = function (word) {\n var node,\n commonPrefix = 0\n\n if (word < this.previousWord) {\n throw new Error (\"Out of order word insertion\")\n }\n\n for (var i = 0; i < word.length && i < this.previousWord.length; i++) {\n if (word[i] != this.previousWord[i]) break\n commonPrefix++\n }\n\n this.minimize(commonPrefix)\n\n if (this.uncheckedNodes.length == 0) {\n node = this.root\n } else {\n node = this.uncheckedNodes[this.uncheckedNodes.length - 1].child\n }\n\n for (var i = commonPrefix; i < word.length; i++) {\n var nextNode = new lunr.TokenSet,\n char = word[i]\n\n node.edges[char] = nextNode\n\n this.uncheckedNodes.push({\n parent: node,\n char: char,\n child: nextNode\n })\n\n node = nextNode\n }\n\n node.final = true\n this.previousWord = word\n}\n\nlunr.TokenSet.Builder.prototype.finish = function () {\n this.minimize(0)\n}\n\nlunr.TokenSet.Builder.prototype.minimize = function (downTo) {\n for (var i = this.uncheckedNodes.length - 1; i >= downTo; i--) {\n var node = this.uncheckedNodes[i],\n childKey = node.child.toString()\n\n if (childKey in this.minimizedNodes) {\n node.parent.edges[node.char] = this.minimizedNodes[childKey]\n } else {\n // Cache the key for this node since\n // we know it can't change anymore\n node.child._str = childKey\n\n this.minimizedNodes[childKey] = node.child\n }\n\n this.uncheckedNodes.pop()\n }\n}\n/*!\n * lunr.Index\n * Copyright (C) 2020 Oliver Nightingale\n */\n\n/**\n * An index contains the built index of all documents and provides a query interface\n * to the index.\n *\n * Usually instances of lunr.Index will not be created using this constructor, instead\n * lunr.Builder should be used to construct new indexes, or lunr.Index.load should be\n * used to load previously built and serialized indexes.\n *\n * @constructor\n * @param {Object} attrs - The attributes of the built search index.\n * @param {Object} attrs.invertedIndex - An index of term/field to document reference.\n * @param {Object} attrs.fieldVectors - Field vectors\n * @param {lunr.TokenSet} attrs.tokenSet - An set of all corpus tokens.\n * @param {string[]} attrs.fields - The names of indexed document fields.\n * @param {lunr.Pipeline} attrs.pipeline - The pipeline to use for search terms.\n */\nlunr.Index = function (attrs) {\n this.invertedIndex = attrs.invertedIndex\n this.fieldVectors = attrs.fieldVectors\n this.tokenSet = attrs.tokenSet\n this.fields = attrs.fields\n this.pipeline = attrs.pipeline\n}\n\n/**\n * A result contains details of a document matching a search query.\n * @typedef {Object} lunr.Index~Result\n * @property {string} ref - The reference of the document this result represents.\n * @property {number} score - A number between 0 and 1 representing how similar this document is to the query.\n * @property {lunr.MatchData} matchData - Contains metadata about this match including which term(s) caused the match.\n */\n\n/**\n * Although lunr provides the ability to create queries using lunr.Query, it also provides a simple\n * query language which itself is parsed into an instance of lunr.Query.\n *\n * For programmatically building queries it is advised to directly use lunr.Query, the query language\n * is best used for human entered text rather than program generated text.\n *\n * At its simplest queries can just be a single term, e.g. `hello`, multiple terms are also supported\n * and will be combined with OR, e.g `hello world` will match documents that contain either 'hello'\n * or 'world', though those that contain both will rank higher in the results.\n *\n * Wildcards can be included in terms to match one or more unspecified characters, these wildcards can\n * be inserted anywhere within the term, and more than one wildcard can exist in a single term. Adding\n * wildcards will increase the number of documents that will be found but can also have a negative\n * impact on query performance, especially with wildcards at the beginning of a term.\n *\n * Terms can be restricted to specific fields, e.g. `title:hello`, only documents with the term\n * hello in the title field will match this query. Using a field not present in the index will lead\n * to an error being thrown.\n *\n * Modifiers can also be added to terms, lunr supports edit distance and boost modifiers on terms. A term\n * boost will make documents matching that term score higher, e.g. `foo^5`. Edit distance is also supported\n * to provide fuzzy matching, e.g. 'hello~2' will match documents with hello with an edit distance of 2.\n * Avoid large values for edit distance to improve query performance.\n *\n * Each term also supports a presence modifier. By default a term's presence in document is optional, however\n * this can be changed to either required or prohibited. For a term's presence to be required in a document the\n * term should be prefixed with a '+', e.g. `+foo bar` is a search for documents that must contain 'foo' and\n * optionally contain 'bar'. Conversely a leading '-' sets the terms presence to prohibited, i.e. it must not\n * appear in a document, e.g. `-foo bar` is a search for documents that do not contain 'foo' but may contain 'bar'.\n *\n * To escape special characters the backslash character '\\' can be used, this allows searches to include\n * characters that would normally be considered modifiers, e.g. `foo\\~2` will search for a term \"foo~2\" instead\n * of attempting to apply a boost of 2 to the search term \"foo\".\n *\n * @typedef {string} lunr.Index~QueryString\n * @example Simple single term query\n * hello\n * @example Multiple term query\n * hello world\n * @example term scoped to a field\n * title:hello\n * @example term with a boost of 10\n * hello^10\n * @example term with an edit distance of 2\n * hello~2\n * @example terms with presence modifiers\n * -foo +bar baz\n */\n\n/**\n * Performs a search against the index using lunr query syntax.\n *\n * Results will be returned sorted by their score, the most relevant results\n * will be returned first. For details on how the score is calculated, please see\n * the {@link https://lunrjs.com/guides/searching.html#scoring|guide}.\n *\n * For more programmatic querying use lunr.Index#query.\n *\n * @param {lunr.Index~QueryString} queryString - A string containing a lunr query.\n * @throws {lunr.QueryParseError} If the passed query string cannot be parsed.\n * @returns {lunr.Index~Result[]}\n */\nlunr.Index.prototype.search = function (queryString) {\n return this.query(function (query) {\n var parser = new lunr.QueryParser(queryString, query)\n parser.parse()\n })\n}\n\n/**\n * A query builder callback provides a query object to be used to express\n * the query to perform on the index.\n *\n * @callback lunr.Index~queryBuilder\n * @param {lunr.Query} query - The query object to build up.\n * @this lunr.Query\n */\n\n/**\n * Performs a query against the index using the yielded lunr.Query object.\n *\n * If performing programmatic queries against the index, this method is preferred\n * over lunr.Index#search so as to avoid the additional query parsing overhead.\n *\n * A query object is yielded to the supplied function which should be used to\n * express the query to be run against the index.\n *\n * Note that although this function takes a callback parameter it is _not_ an\n * asynchronous operation, the callback is just yielded a query object to be\n * customized.\n *\n * @param {lunr.Index~queryBuilder} fn - A function that is used to build the query.\n * @returns {lunr.Index~Result[]}\n */\nlunr.Index.prototype.query = function (fn) {\n // for each query clause\n // * process terms\n // * expand terms from token set\n // * find matching documents and metadata\n // * get document vectors\n // * score documents\n\n var query = new lunr.Query(this.fields),\n matchingFields = Object.create(null),\n queryVectors = Object.create(null),\n termFieldCache = Object.create(null),\n requiredMatches = Object.create(null),\n prohibitedMatches = Object.create(null)\n\n /*\n * To support field level boosts a query vector is created per\n * field. An empty vector is eagerly created to support negated\n * queries.\n */\n for (var i = 0; i < this.fields.length; i++) {\n queryVectors[this.fields[i]] = new lunr.Vector\n }\n\n fn.call(query, query)\n\n for (var i = 0; i < query.clauses.length; i++) {\n /*\n * Unless the pipeline has been disabled for this term, which is\n * the case for terms with wildcards, we need to pass the clause\n * term through the search pipeline. A pipeline returns an array\n * of processed terms. Pipeline functions may expand the passed\n * term, which means we may end up performing multiple index lookups\n * for a single query term.\n */\n var clause = query.clauses[i],\n terms = null,\n clauseMatches = lunr.Set.empty\n\n if (clause.usePipeline) {\n terms = this.pipeline.runString(clause.term, {\n fields: clause.fields\n })\n } else {\n terms = [clause.term]\n }\n\n for (var m = 0; m < terms.length; m++) {\n var term = terms[m]\n\n /*\n * Each term returned from the pipeline needs to use the same query\n * clause object, e.g. the same boost and or edit distance. The\n * simplest way to do this is to re-use the clause object but mutate\n * its term property.\n */\n clause.term = term\n\n /*\n * From the term in the clause we create a token set which will then\n * be used to intersect the indexes token set to get a list of terms\n * to lookup in the inverted index\n */\n var termTokenSet = lunr.TokenSet.fromClause(clause),\n expandedTerms = this.tokenSet.intersect(termTokenSet).toArray()\n\n /*\n * If a term marked as required does not exist in the tokenSet it is\n * impossible for the search to return any matches. We set all the field\n * scoped required matches set to empty and stop examining any further\n * clauses.\n */\n if (expandedTerms.length === 0 && clause.presence === lunr.Query.presence.REQUIRED) {\n for (var k = 0; k < clause.fields.length; k++) {\n var field = clause.fields[k]\n requiredMatches[field] = lunr.Set.empty\n }\n\n break\n }\n\n for (var j = 0; j < expandedTerms.length; j++) {\n /*\n * For each term get the posting and termIndex, this is required for\n * building the query vector.\n */\n var expandedTerm = expandedTerms[j],\n posting = this.invertedIndex[expandedTerm],\n termIndex = posting._index\n\n for (var k = 0; k < clause.fields.length; k++) {\n /*\n * For each field that this query term is scoped by (by default\n * all fields are in scope) we need to get all the document refs\n * that have this term in that field.\n *\n * The posting is the entry in the invertedIndex for the matching\n * term from above.\n */\n var field = clause.fields[k],\n fieldPosting = posting[field],\n matchingDocumentRefs = Object.keys(fieldPosting),\n termField = expandedTerm + \"/\" + field,\n matchingDocumentsSet = new lunr.Set(matchingDocumentRefs)\n\n /*\n * if the presence of this term is required ensure that the matching\n * documents are added to the set of required matches for this clause.\n *\n */\n if (clause.presence == lunr.Query.presence.REQUIRED) {\n clauseMatches = clauseMatches.union(matchingDocumentsSet)\n\n if (requiredMatches[field] === undefined) {\n requiredMatches[field] = lunr.Set.complete\n }\n }\n\n /*\n * if the presence of this term is prohibited ensure that the matching\n * documents are added to the set of prohibited matches for this field,\n * creating that set if it does not yet exist.\n */\n if (clause.presence == lunr.Query.presence.PROHIBITED) {\n if (prohibitedMatches[field] === undefined) {\n prohibitedMatches[field] = lunr.Set.empty\n }\n\n prohibitedMatches[field] = prohibitedMatches[field].union(matchingDocumentsSet)\n\n /*\n * Prohibited matches should not be part of the query vector used for\n * similarity scoring and no metadata should be extracted so we continue\n * to the next field\n */\n continue\n }\n\n /*\n * The query field vector is populated using the termIndex found for\n * the term and a unit value with the appropriate boost applied.\n * Using upsert because there could already be an entry in the vector\n * for the term we are working with. In that case we just add the scores\n * together.\n */\n queryVectors[field].upsert(termIndex, clause.boost, function (a, b) { return a + b })\n\n /**\n * If we've already seen this term, field combo then we've already collected\n * the matching documents and metadata, no need to go through all that again\n */\n if (termFieldCache[termField]) {\n continue\n }\n\n for (var l = 0; l < matchingDocumentRefs.length; l++) {\n /*\n * All metadata for this term/field/document triple\n * are then extracted and collected into an instance\n * of lunr.MatchData ready to be returned in the query\n * results\n */\n var matchingDocumentRef = matchingDocumentRefs[l],\n matchingFieldRef = new lunr.FieldRef (matchingDocumentRef, field),\n metadata = fieldPosting[matchingDocumentRef],\n fieldMatch\n\n if ((fieldMatch = matchingFields[matchingFieldRef]) === undefined) {\n matchingFields[matchingFieldRef] = new lunr.MatchData (expandedTerm, field, metadata)\n } else {\n fieldMatch.add(expandedTerm, field, metadata)\n }\n\n }\n\n termFieldCache[termField] = true\n }\n }\n }\n\n /**\n * If the presence was required we need to update the requiredMatches field sets.\n * We do this after all fields for the term have collected their matches because\n * the clause terms presence is required in _any_ of the fields not _all_ of the\n * fields.\n */\n if (clause.presence === lunr.Query.presence.REQUIRED) {\n for (var k = 0; k < clause.fields.length; k++) {\n var field = clause.fields[k]\n requiredMatches[field] = requiredMatches[field].intersect(clauseMatches)\n }\n }\n }\n\n /**\n * Need to combine the field scoped required and prohibited\n * matching documents into a global set of required and prohibited\n * matches\n */\n var allRequiredMatches = lunr.Set.complete,\n allProhibitedMatches = lunr.Set.empty\n\n for (var i = 0; i < this.fields.length; i++) {\n var field = this.fields[i]\n\n if (requiredMatches[field]) {\n allRequiredMatches = allRequiredMatches.intersect(requiredMatches[field])\n }\n\n if (prohibitedMatches[field]) {\n allProhibitedMatches = allProhibitedMatches.union(prohibitedMatches[field])\n }\n }\n\n var matchingFieldRefs = Object.keys(matchingFields),\n results = [],\n matches = Object.create(null)\n\n /*\n * If the query is negated (contains only prohibited terms)\n * we need to get _all_ fieldRefs currently existing in the\n * index. This is only done when we know that the query is\n * entirely prohibited terms to avoid any cost of getting all\n * fieldRefs unnecessarily.\n *\n * Additionally, blank MatchData must be created to correctly\n * populate the results.\n */\n if (query.isNegated()) {\n matchingFieldRefs = Object.keys(this.fieldVectors)\n\n for (var i = 0; i < matchingFieldRefs.length; i++) {\n var matchingFieldRef = matchingFieldRefs[i]\n var fieldRef = lunr.FieldRef.fromString(matchingFieldRef)\n matchingFields[matchingFieldRef] = new lunr.MatchData\n }\n }\n\n for (var i = 0; i < matchingFieldRefs.length; i++) {\n /*\n * Currently we have document fields that match the query, but we\n * need to return documents. The matchData and scores are combined\n * from multiple fields belonging to the same document.\n *\n * Scores are calculated by field, using the query vectors created\n * above, and combined into a final document score using addition.\n */\n var fieldRef = lunr.FieldRef.fromString(matchingFieldRefs[i]),\n docRef = fieldRef.docRef\n\n if (!allRequiredMatches.contains(docRef)) {\n continue\n }\n\n if (allProhibitedMatches.contains(docRef)) {\n continue\n }\n\n var fieldVector = this.fieldVectors[fieldRef],\n score = queryVectors[fieldRef.fieldName].similarity(fieldVector),\n docMatch\n\n if ((docMatch = matches[docRef]) !== undefined) {\n docMatch.score += score\n docMatch.matchData.combine(matchingFields[fieldRef])\n } else {\n var match = {\n ref: docRef,\n score: score,\n matchData: matchingFields[fieldRef]\n }\n matches[docRef] = match\n results.push(match)\n }\n }\n\n /*\n * Sort the results objects by score, highest first.\n */\n return results.sort(function (a, b) {\n return b.score - a.score\n })\n}\n\n/**\n * Prepares the index for JSON serialization.\n *\n * The schema for this JSON blob will be described in a\n * separate JSON schema file.\n *\n * @returns {Object}\n */\nlunr.Index.prototype.toJSON = function () {\n var invertedIndex = Object.keys(this.invertedIndex)\n .sort()\n .map(function (term) {\n return [term, this.invertedIndex[term]]\n }, this)\n\n var fieldVectors = Object.keys(this.fieldVectors)\n .map(function (ref) {\n return [ref, this.fieldVectors[ref].toJSON()]\n }, this)\n\n return {\n version: lunr.version,\n fields: this.fields,\n fieldVectors: fieldVectors,\n invertedIndex: invertedIndex,\n pipeline: this.pipeline.toJSON()\n }\n}\n\n/**\n * Loads a previously serialized lunr.Index\n *\n * @param {Object} serializedIndex - A previously serialized lunr.Index\n * @returns {lunr.Index}\n */\nlunr.Index.load = function (serializedIndex) {\n var attrs = {},\n fieldVectors = {},\n serializedVectors = serializedIndex.fieldVectors,\n invertedIndex = Object.create(null),\n serializedInvertedIndex = serializedIndex.invertedIndex,\n tokenSetBuilder = new lunr.TokenSet.Builder,\n pipeline = lunr.Pipeline.load(serializedIndex.pipeline)\n\n if (serializedIndex.version != lunr.version) {\n lunr.utils.warn(\"Version mismatch when loading serialised index. Current version of lunr '\" + lunr.version + \"' does not match serialized index '\" + serializedIndex.version + \"'\")\n }\n\n for (var i = 0; i < serializedVectors.length; i++) {\n var tuple = serializedVectors[i],\n ref = tuple[0],\n elements = tuple[1]\n\n fieldVectors[ref] = new lunr.Vector(elements)\n }\n\n for (var i = 0; i < serializedInvertedIndex.length; i++) {\n var tuple = serializedInvertedIndex[i],\n term = tuple[0],\n posting = tuple[1]\n\n tokenSetBuilder.insert(term)\n invertedIndex[term] = posting\n }\n\n tokenSetBuilder.finish()\n\n attrs.fields = serializedIndex.fields\n\n attrs.fieldVectors = fieldVectors\n attrs.invertedIndex = invertedIndex\n attrs.tokenSet = tokenSetBuilder.root\n attrs.pipeline = pipeline\n\n return new lunr.Index(attrs)\n}\n/*!\n * lunr.Builder\n * Copyright (C) 2020 Oliver Nightingale\n */\n\n/**\n * lunr.Builder performs indexing on a set of documents and\n * returns instances of lunr.Index ready for querying.\n *\n * All configuration of the index is done via the builder, the\n * fields to index, the document reference, the text processing\n * pipeline and document scoring parameters are all set on the\n * builder before indexing.\n *\n * @constructor\n * @property {string} _ref - Internal reference to the document reference field.\n * @property {string[]} _fields - Internal reference to the document fields to index.\n * @property {object} invertedIndex - The inverted index maps terms to document fields.\n * @property {object} documentTermFrequencies - Keeps track of document term frequencies.\n * @property {object} documentLengths - Keeps track of the length of documents added to the index.\n * @property {lunr.tokenizer} tokenizer - Function for splitting strings into tokens for indexing.\n * @property {lunr.Pipeline} pipeline - The pipeline performs text processing on tokens before indexing.\n * @property {lunr.Pipeline} searchPipeline - A pipeline for processing search terms before querying the index.\n * @property {number} documentCount - Keeps track of the total number of documents indexed.\n * @property {number} _b - A parameter to control field length normalization, setting this to 0 disabled normalization, 1 fully normalizes field lengths, the default value is 0.75.\n * @property {number} _k1 - A parameter to control how quickly an increase in term frequency results in term frequency saturation, the default value is 1.2.\n * @property {number} termIndex - A counter incremented for each unique term, used to identify a terms position in the vector space.\n * @property {array} metadataWhitelist - A list of metadata keys that have been whitelisted for entry in the index.\n */\nlunr.Builder = function () {\n this._ref = \"id\"\n this._fields = Object.create(null)\n this._documents = Object.create(null)\n this.invertedIndex = Object.create(null)\n this.fieldTermFrequencies = {}\n this.fieldLengths = {}\n this.tokenizer = lunr.tokenizer\n this.pipeline = new lunr.Pipeline\n this.searchPipeline = new lunr.Pipeline\n this.documentCount = 0\n this._b = 0.75\n this._k1 = 1.2\n this.termIndex = 0\n this.metadataWhitelist = []\n}\n\n/**\n * Sets the document field used as the document reference. Every document must have this field.\n * The type of this field in the document should be a string, if it is not a string it will be\n * coerced into a string by calling toString.\n *\n * The default ref is 'id'.\n *\n * The ref should _not_ be changed during indexing, it should be set before any documents are\n * added to the index. Changing it during indexing can lead to inconsistent results.\n *\n * @param {string} ref - The name of the reference field in the document.\n */\nlunr.Builder.prototype.ref = function (ref) {\n this._ref = ref\n}\n\n/**\n * A function that is used to extract a field from a document.\n *\n * Lunr expects a field to be at the top level of a document, if however the field\n * is deeply nested within a document an extractor function can be used to extract\n * the right field for indexing.\n *\n * @callback fieldExtractor\n * @param {object} doc - The document being added to the index.\n * @returns {?(string|object|object[])} obj - The object that will be indexed for this field.\n * @example Extracting a nested field\n * function (doc) { return doc.nested.field }\n */\n\n/**\n * Adds a field to the list of document fields that will be indexed. Every document being\n * indexed should have this field. Null values for this field in indexed documents will\n * not cause errors but will limit the chance of that document being retrieved by searches.\n *\n * All fields should be added before adding documents to the index. Adding fields after\n * a document has been indexed will have no effect on already indexed documents.\n *\n * Fields can be boosted at build time. This allows terms within that field to have more\n * importance when ranking search results. Use a field boost to specify that matches within\n * one field are more important than other fields.\n *\n * @param {string} fieldName - The name of a field to index in all documents.\n * @param {object} attributes - Optional attributes associated with this field.\n * @param {number} [attributes.boost=1] - Boost applied to all terms within this field.\n * @param {fieldExtractor} [attributes.extractor] - Function to extract a field from a document.\n * @throws {RangeError} fieldName cannot contain unsupported characters '/'\n */\nlunr.Builder.prototype.field = function (fieldName, attributes) {\n if (/\\//.test(fieldName)) {\n throw new RangeError (\"Field '\" + fieldName + \"' contains illegal character '/'\")\n }\n\n this._fields[fieldName] = attributes || {}\n}\n\n/**\n * A parameter to tune the amount of field length normalisation that is applied when\n * calculating relevance scores. A value of 0 will completely disable any normalisation\n * and a value of 1 will fully normalise field lengths. The default is 0.75. Values of b\n * will be clamped to the range 0 - 1.\n *\n * @param {number} number - The value to set for this tuning parameter.\n */\nlunr.Builder.prototype.b = function (number) {\n if (number < 0) {\n this._b = 0\n } else if (number > 1) {\n this._b = 1\n } else {\n this._b = number\n }\n}\n\n/**\n * A parameter that controls the speed at which a rise in term frequency results in term\n * frequency saturation. The default value is 1.2. Setting this to a higher value will give\n * slower saturation levels, a lower value will result in quicker saturation.\n *\n * @param {number} number - The value to set for this tuning parameter.\n */\nlunr.Builder.prototype.k1 = function (number) {\n this._k1 = number\n}\n\n/**\n * Adds a document to the index.\n *\n * Before adding fields to the index the index should have been fully setup, with the document\n * ref and all fields to index already having been specified.\n *\n * The document must have a field name as specified by the ref (by default this is 'id') and\n * it should have all fields defined for indexing, though null or undefined values will not\n * cause errors.\n *\n * Entire documents can be boosted at build time. Applying a boost to a document indicates that\n * this document should rank higher in search results than other documents.\n *\n * @param {object} doc - The document to add to the index.\n * @param {object} attributes - Optional attributes associated with this document.\n * @param {number} [attributes.boost=1] - Boost applied to all terms within this document.\n */\nlunr.Builder.prototype.add = function (doc, attributes) {\n var docRef = doc[this._ref],\n fields = Object.keys(this._fields)\n\n this._documents[docRef] = attributes || {}\n this.documentCount += 1\n\n for (var i = 0; i < fields.length; i++) {\n var fieldName = fields[i],\n extractor = this._fields[fieldName].extractor,\n field = extractor ? extractor(doc) : doc[fieldName],\n tokens = this.tokenizer(field, {\n fields: [fieldName]\n }),\n terms = this.pipeline.run(tokens),\n fieldRef = new lunr.FieldRef (docRef, fieldName),\n fieldTerms = Object.create(null)\n\n this.fieldTermFrequencies[fieldRef] = fieldTerms\n this.fieldLengths[fieldRef] = 0\n\n // store the length of this field for this document\n this.fieldLengths[fieldRef] += terms.length\n\n // calculate term frequencies for this field\n for (var j = 0; j < terms.length; j++) {\n var term = terms[j]\n\n if (fieldTerms[term] == undefined) {\n fieldTerms[term] = 0\n }\n\n fieldTerms[term] += 1\n\n // add to inverted index\n // create an initial posting if one doesn't exist\n if (this.invertedIndex[term] == undefined) {\n var posting = Object.create(null)\n posting[\"_index\"] = this.termIndex\n this.termIndex += 1\n\n for (var k = 0; k < fields.length; k++) {\n posting[fields[k]] = Object.create(null)\n }\n\n this.invertedIndex[term] = posting\n }\n\n // add an entry for this term/fieldName/docRef to the invertedIndex\n if (this.invertedIndex[term][fieldName][docRef] == undefined) {\n this.invertedIndex[term][fieldName][docRef] = Object.create(null)\n }\n\n // store all whitelisted metadata about this token in the\n // inverted index\n for (var l = 0; l < this.metadataWhitelist.length; l++) {\n var metadataKey = this.metadataWhitelist[l],\n metadata = term.metadata[metadataKey]\n\n if (this.invertedIndex[term][fieldName][docRef][metadataKey] == undefined) {\n this.invertedIndex[term][fieldName][docRef][metadataKey] = []\n }\n\n this.invertedIndex[term][fieldName][docRef][metadataKey].push(metadata)\n }\n }\n\n }\n}\n\n/**\n * Calculates the average document length for this index\n *\n * @private\n */\nlunr.Builder.prototype.calculateAverageFieldLengths = function () {\n\n var fieldRefs = Object.keys(this.fieldLengths),\n numberOfFields = fieldRefs.length,\n accumulator = {},\n documentsWithField = {}\n\n for (var i = 0; i < numberOfFields; i++) {\n var fieldRef = lunr.FieldRef.fromString(fieldRefs[i]),\n field = fieldRef.fieldName\n\n documentsWithField[field] || (documentsWithField[field] = 0)\n documentsWithField[field] += 1\n\n accumulator[field] || (accumulator[field] = 0)\n accumulator[field] += this.fieldLengths[fieldRef]\n }\n\n var fields = Object.keys(this._fields)\n\n for (var i = 0; i < fields.length; i++) {\n var fieldName = fields[i]\n accumulator[fieldName] = accumulator[fieldName] / documentsWithField[fieldName]\n }\n\n this.averageFieldLength = accumulator\n}\n\n/**\n * Builds a vector space model of every document using lunr.Vector\n *\n * @private\n */\nlunr.Builder.prototype.createFieldVectors = function () {\n var fieldVectors = {},\n fieldRefs = Object.keys(this.fieldTermFrequencies),\n fieldRefsLength = fieldRefs.length,\n termIdfCache = Object.create(null)\n\n for (var i = 0; i < fieldRefsLength; i++) {\n var fieldRef = lunr.FieldRef.fromString(fieldRefs[i]),\n fieldName = fieldRef.fieldName,\n fieldLength = this.fieldLengths[fieldRef],\n fieldVector = new lunr.Vector,\n termFrequencies = this.fieldTermFrequencies[fieldRef],\n terms = Object.keys(termFrequencies),\n termsLength = terms.length\n\n\n var fieldBoost = this._fields[fieldName].boost || 1,\n docBoost = this._documents[fieldRef.docRef].boost || 1\n\n for (var j = 0; j < termsLength; j++) {\n var term = terms[j],\n tf = termFrequencies[term],\n termIndex = this.invertedIndex[term]._index,\n idf, score, scoreWithPrecision\n\n if (termIdfCache[term] === undefined) {\n idf = lunr.idf(this.invertedIndex[term], this.documentCount)\n termIdfCache[term] = idf\n } else {\n idf = termIdfCache[term]\n }\n\n score = idf * ((this._k1 + 1) * tf) / (this._k1 * (1 - this._b + this._b * (fieldLength / this.averageFieldLength[fieldName])) + tf)\n score *= fieldBoost\n score *= docBoost\n scoreWithPrecision = Math.round(score * 1000) / 1000\n // Converts 1.23456789 to 1.234.\n // Reducing the precision so that the vectors take up less\n // space when serialised. Doing it now so that they behave\n // the same before and after serialisation. Also, this is\n // the fastest approach to reducing a number's precision in\n // JavaScript.\n\n fieldVector.insert(termIndex, scoreWithPrecision)\n }\n\n fieldVectors[fieldRef] = fieldVector\n }\n\n this.fieldVectors = fieldVectors\n}\n\n/**\n * Creates a token set of all tokens in the index using lunr.TokenSet\n *\n * @private\n */\nlunr.Builder.prototype.createTokenSet = function () {\n this.tokenSet = lunr.TokenSet.fromArray(\n Object.keys(this.invertedIndex).sort()\n )\n}\n\n/**\n * Builds the index, creating an instance of lunr.Index.\n *\n * This completes the indexing process and should only be called\n * once all documents have been added to the index.\n *\n * @returns {lunr.Index}\n */\nlunr.Builder.prototype.build = function () {\n this.calculateAverageFieldLengths()\n this.createFieldVectors()\n this.createTokenSet()\n\n return new lunr.Index({\n invertedIndex: this.invertedIndex,\n fieldVectors: this.fieldVectors,\n tokenSet: this.tokenSet,\n fields: Object.keys(this._fields),\n pipeline: this.searchPipeline\n })\n}\n\n/**\n * Applies a plugin to the index builder.\n *\n * A plugin is a function that is called with the index builder as its context.\n * Plugins can be used to customise or extend the behaviour of the index\n * in some way. A plugin is just a function, that encapsulated the custom\n * behaviour that should be applied when building the index.\n *\n * The plugin function will be called with the index builder as its argument, additional\n * arguments can also be passed when calling use. The function will be called\n * with the index builder as its context.\n *\n * @param {Function} plugin The plugin to apply.\n */\nlunr.Builder.prototype.use = function (fn) {\n var args = Array.prototype.slice.call(arguments, 1)\n args.unshift(this)\n fn.apply(this, args)\n}\n/**\n * Contains and collects metadata about a matching document.\n * A single instance of lunr.MatchData is returned as part of every\n * lunr.Index~Result.\n *\n * @constructor\n * @param {string} term - The term this match data is associated with\n * @param {string} field - The field in which the term was found\n * @param {object} metadata - The metadata recorded about this term in this field\n * @property {object} metadata - A cloned collection of metadata associated with this document.\n * @see {@link lunr.Index~Result}\n */\nlunr.MatchData = function (term, field, metadata) {\n var clonedMetadata = Object.create(null),\n metadataKeys = Object.keys(metadata || {})\n\n // Cloning the metadata to prevent the original\n // being mutated during match data combination.\n // Metadata is kept in an array within the inverted\n // index so cloning the data can be done with\n // Array#slice\n for (var i = 0; i < metadataKeys.length; i++) {\n var key = metadataKeys[i]\n clonedMetadata[key] = metadata[key].slice()\n }\n\n this.metadata = Object.create(null)\n\n if (term !== undefined) {\n this.metadata[term] = Object.create(null)\n this.metadata[term][field] = clonedMetadata\n }\n}\n\n/**\n * An instance of lunr.MatchData will be created for every term that matches a\n * document. However only one instance is required in a lunr.Index~Result. This\n * method combines metadata from another instance of lunr.MatchData with this\n * objects metadata.\n *\n * @param {lunr.MatchData} otherMatchData - Another instance of match data to merge with this one.\n * @see {@link lunr.Index~Result}\n */\nlunr.MatchData.prototype.combine = function (otherMatchData) {\n var terms = Object.keys(otherMatchData.metadata)\n\n for (var i = 0; i < terms.length; i++) {\n var term = terms[i],\n fields = Object.keys(otherMatchData.metadata[term])\n\n if (this.metadata[term] == undefined) {\n this.metadata[term] = Object.create(null)\n }\n\n for (var j = 0; j < fields.length; j++) {\n var field = fields[j],\n keys = Object.keys(otherMatchData.metadata[term][field])\n\n if (this.metadata[term][field] == undefined) {\n this.metadata[term][field] = Object.create(null)\n }\n\n for (var k = 0; k < keys.length; k++) {\n var key = keys[k]\n\n if (this.metadata[term][field][key] == undefined) {\n this.metadata[term][field][key] = otherMatchData.metadata[term][field][key]\n } else {\n this.metadata[term][field][key] = this.metadata[term][field][key].concat(otherMatchData.metadata[term][field][key])\n }\n\n }\n }\n }\n}\n\n/**\n * Add metadata for a term/field pair to this instance of match data.\n *\n * @param {string} term - The term this match data is associated with\n * @param {string} field - The field in which the term was found\n * @param {object} metadata - The metadata recorded about this term in this field\n */\nlunr.MatchData.prototype.add = function (term, field, metadata) {\n if (!(term in this.metadata)) {\n this.metadata[term] = Object.create(null)\n this.metadata[term][field] = metadata\n return\n }\n\n if (!(field in this.metadata[term])) {\n this.metadata[term][field] = metadata\n return\n }\n\n var metadataKeys = Object.keys(metadata)\n\n for (var i = 0; i < metadataKeys.length; i++) {\n var key = metadataKeys[i]\n\n if (key in this.metadata[term][field]) {\n this.metadata[term][field][key] = this.metadata[term][field][key].concat(metadata[key])\n } else {\n this.metadata[term][field][key] = metadata[key]\n }\n }\n}\n/**\n * A lunr.Query provides a programmatic way of defining queries to be performed\n * against a {@link lunr.Index}.\n *\n * Prefer constructing a lunr.Query using the {@link lunr.Index#query} method\n * so the query object is pre-initialized with the right index fields.\n *\n * @constructor\n * @property {lunr.Query~Clause[]} clauses - An array of query clauses.\n * @property {string[]} allFields - An array of all available fields in a lunr.Index.\n */\nlunr.Query = function (allFields) {\n this.clauses = []\n this.allFields = allFields\n}\n\n/**\n * Constants for indicating what kind of automatic wildcard insertion will be used when constructing a query clause.\n *\n * This allows wildcards to be added to the beginning and end of a term without having to manually do any string\n * concatenation.\n *\n * The wildcard constants can be bitwise combined to select both leading and trailing wildcards.\n *\n * @constant\n * @default\n * @property {number} wildcard.NONE - The term will have no wildcards inserted, this is the default behaviour\n * @property {number} wildcard.LEADING - Prepend the term with a wildcard, unless a leading wildcard already exists\n * @property {number} wildcard.TRAILING - Append a wildcard to the term, unless a trailing wildcard already exists\n * @see lunr.Query~Clause\n * @see lunr.Query#clause\n * @see lunr.Query#term\n * @example query term with trailing wildcard\n * query.term('foo', { wildcard: lunr.Query.wildcard.TRAILING })\n * @example query term with leading and trailing wildcard\n * query.term('foo', {\n * wildcard: lunr.Query.wildcard.LEADING | lunr.Query.wildcard.TRAILING\n * })\n */\n\nlunr.Query.wildcard = new String (\"*\")\nlunr.Query.wildcard.NONE = 0\nlunr.Query.wildcard.LEADING = 1\nlunr.Query.wildcard.TRAILING = 2\n\n/**\n * Constants for indicating what kind of presence a term must have in matching documents.\n *\n * @constant\n * @enum {number}\n * @see lunr.Query~Clause\n * @see lunr.Query#clause\n * @see lunr.Query#term\n * @example query term with required presence\n * query.term('foo', { presence: lunr.Query.presence.REQUIRED })\n */\nlunr.Query.presence = {\n /**\n * Term's presence in a document is optional, this is the default value.\n */\n OPTIONAL: 1,\n\n /**\n * Term's presence in a document is required, documents that do not contain\n * this term will not be returned.\n */\n REQUIRED: 2,\n\n /**\n * Term's presence in a document is prohibited, documents that do contain\n * this term will not be returned.\n */\n PROHIBITED: 3\n}\n\n/**\n * A single clause in a {@link lunr.Query} contains a term and details on how to\n * match that term against a {@link lunr.Index}.\n *\n * @typedef {Object} lunr.Query~Clause\n * @property {string[]} fields - The fields in an index this clause should be matched against.\n * @property {number} [boost=1] - Any boost that should be applied when matching this clause.\n * @property {number} [editDistance] - Whether the term should have fuzzy matching applied, and how fuzzy the match should be.\n * @property {boolean} [usePipeline] - Whether the term should be passed through the search pipeline.\n * @property {number} [wildcard=lunr.Query.wildcard.NONE] - Whether the term should have wildcards appended or prepended.\n * @property {number} [presence=lunr.Query.presence.OPTIONAL] - The terms presence in any matching documents.\n */\n\n/**\n * Adds a {@link lunr.Query~Clause} to this query.\n *\n * Unless the clause contains the fields to be matched all fields will be matched. In addition\n * a default boost of 1 is applied to the clause.\n *\n * @param {lunr.Query~Clause} clause - The clause to add to this query.\n * @see lunr.Query~Clause\n * @returns {lunr.Query}\n */\nlunr.Query.prototype.clause = function (clause) {\n if (!('fields' in clause)) {\n clause.fields = this.allFields\n }\n\n if (!('boost' in clause)) {\n clause.boost = 1\n }\n\n if (!('usePipeline' in clause)) {\n clause.usePipeline = true\n }\n\n if (!('wildcard' in clause)) {\n clause.wildcard = lunr.Query.wildcard.NONE\n }\n\n if ((clause.wildcard & lunr.Query.wildcard.LEADING) && (clause.term.charAt(0) != lunr.Query.wildcard)) {\n clause.term = \"*\" + clause.term\n }\n\n if ((clause.wildcard & lunr.Query.wildcard.TRAILING) && (clause.term.slice(-1) != lunr.Query.wildcard)) {\n clause.term = \"\" + clause.term + \"*\"\n }\n\n if (!('presence' in clause)) {\n clause.presence = lunr.Query.presence.OPTIONAL\n }\n\n this.clauses.push(clause)\n\n return this\n}\n\n/**\n * A negated query is one in which every clause has a presence of\n * prohibited. These queries require some special processing to return\n * the expected results.\n *\n * @returns boolean\n */\nlunr.Query.prototype.isNegated = function () {\n for (var i = 0; i < this.clauses.length; i++) {\n if (this.clauses[i].presence != lunr.Query.presence.PROHIBITED) {\n return false\n }\n }\n\n return true\n}\n\n/**\n * Adds a term to the current query, under the covers this will create a {@link lunr.Query~Clause}\n * to the list of clauses that make up this query.\n *\n * The term is used as is, i.e. no tokenization will be performed by this method. Instead conversion\n * to a token or token-like string should be done before calling this method.\n *\n * The term will be converted to a string by calling `toString`. Multiple terms can be passed as an\n * array, each term in the array will share the same options.\n *\n * @param {object|object[]} term - The term(s) to add to the query.\n * @param {object} [options] - Any additional properties to add to the query clause.\n * @returns {lunr.Query}\n * @see lunr.Query#clause\n * @see lunr.Query~Clause\n * @example adding a single term to a query\n * query.term(\"foo\")\n * @example adding a single term to a query and specifying search fields, term boost and automatic trailing wildcard\n * query.term(\"foo\", {\n * fields: [\"title\"],\n * boost: 10,\n * wildcard: lunr.Query.wildcard.TRAILING\n * })\n * @example using lunr.tokenizer to convert a string to tokens before using them as terms\n * query.term(lunr.tokenizer(\"foo bar\"))\n */\nlunr.Query.prototype.term = function (term, options) {\n if (Array.isArray(term)) {\n term.forEach(function (t) { this.term(t, lunr.utils.clone(options)) }, this)\n return this\n }\n\n var clause = options || {}\n clause.term = term.toString()\n\n this.clause(clause)\n\n return this\n}\nlunr.QueryParseError = function (message, start, end) {\n this.name = \"QueryParseError\"\n this.message = message\n this.start = start\n this.end = end\n}\n\nlunr.QueryParseError.prototype = new Error\nlunr.QueryLexer = function (str) {\n this.lexemes = []\n this.str = str\n this.length = str.length\n this.pos = 0\n this.start = 0\n this.escapeCharPositions = []\n}\n\nlunr.QueryLexer.prototype.run = function () {\n var state = lunr.QueryLexer.lexText\n\n while (state) {\n state = state(this)\n }\n}\n\nlunr.QueryLexer.prototype.sliceString = function () {\n var subSlices = [],\n sliceStart = this.start,\n sliceEnd = this.pos\n\n for (var i = 0; i < this.escapeCharPositions.length; i++) {\n sliceEnd = this.escapeCharPositions[i]\n subSlices.push(this.str.slice(sliceStart, sliceEnd))\n sliceStart = sliceEnd + 1\n }\n\n subSlices.push(this.str.slice(sliceStart, this.pos))\n this.escapeCharPositions.length = 0\n\n return subSlices.join('')\n}\n\nlunr.QueryLexer.prototype.emit = function (type) {\n this.lexemes.push({\n type: type,\n str: this.sliceString(),\n start: this.start,\n end: this.pos\n })\n\n this.start = this.pos\n}\n\nlunr.QueryLexer.prototype.escapeCharacter = function () {\n this.escapeCharPositions.push(this.pos - 1)\n this.pos += 1\n}\n\nlunr.QueryLexer.prototype.next = function () {\n if (this.pos >= this.length) {\n return lunr.QueryLexer.EOS\n }\n\n var char = this.str.charAt(this.pos)\n this.pos += 1\n return char\n}\n\nlunr.QueryLexer.prototype.width = function () {\n return this.pos - this.start\n}\n\nlunr.QueryLexer.prototype.ignore = function () {\n if (this.start == this.pos) {\n this.pos += 1\n }\n\n this.start = this.pos\n}\n\nlunr.QueryLexer.prototype.backup = function () {\n this.pos -= 1\n}\n\nlunr.QueryLexer.prototype.acceptDigitRun = function () {\n var char, charCode\n\n do {\n char = this.next()\n charCode = char.charCodeAt(0)\n } while (charCode > 47 && charCode < 58)\n\n if (char != lunr.QueryLexer.EOS) {\n this.backup()\n }\n}\n\nlunr.QueryLexer.prototype.more = function () {\n return this.pos < this.length\n}\n\nlunr.QueryLexer.EOS = 'EOS'\nlunr.QueryLexer.FIELD = 'FIELD'\nlunr.QueryLexer.TERM = 'TERM'\nlunr.QueryLexer.EDIT_DISTANCE = 'EDIT_DISTANCE'\nlunr.QueryLexer.BOOST = 'BOOST'\nlunr.QueryLexer.PRESENCE = 'PRESENCE'\n\nlunr.QueryLexer.lexField = function (lexer) {\n lexer.backup()\n lexer.emit(lunr.QueryLexer.FIELD)\n lexer.ignore()\n return lunr.QueryLexer.lexText\n}\n\nlunr.QueryLexer.lexTerm = function (lexer) {\n if (lexer.width() > 1) {\n lexer.backup()\n lexer.emit(lunr.QueryLexer.TERM)\n }\n\n lexer.ignore()\n\n if (lexer.more()) {\n return lunr.QueryLexer.lexText\n }\n}\n\nlunr.QueryLexer.lexEditDistance = function (lexer) {\n lexer.ignore()\n lexer.acceptDigitRun()\n lexer.emit(lunr.QueryLexer.EDIT_DISTANCE)\n return lunr.QueryLexer.lexText\n}\n\nlunr.QueryLexer.lexBoost = function (lexer) {\n lexer.ignore()\n lexer.acceptDigitRun()\n lexer.emit(lunr.QueryLexer.BOOST)\n return lunr.QueryLexer.lexText\n}\n\nlunr.QueryLexer.lexEOS = function (lexer) {\n if (lexer.width() > 0) {\n lexer.emit(lunr.QueryLexer.TERM)\n }\n}\n\n// This matches the separator used when tokenising fields\n// within a document. These should match otherwise it is\n// not possible to search for some tokens within a document.\n//\n// It is possible for the user to change the separator on the\n// tokenizer so it _might_ clash with any other of the special\n// characters already used within the search string, e.g. :.\n//\n// This means that it is possible to change the separator in\n// such a way that makes some words unsearchable using a search\n// string.\nlunr.QueryLexer.termSeparator = lunr.tokenizer.separator\n\nlunr.QueryLexer.lexText = function (lexer) {\n while (true) {\n var char = lexer.next()\n\n if (char == lunr.QueryLexer.EOS) {\n return lunr.QueryLexer.lexEOS\n }\n\n // Escape character is '\\'\n if (char.charCodeAt(0) == 92) {\n lexer.escapeCharacter()\n continue\n }\n\n if (char == \":\") {\n return lunr.QueryLexer.lexField\n }\n\n if (char == \"~\") {\n lexer.backup()\n if (lexer.width() > 0) {\n lexer.emit(lunr.QueryLexer.TERM)\n }\n return lunr.QueryLexer.lexEditDistance\n }\n\n if (char == \"^\") {\n lexer.backup()\n if (lexer.width() > 0) {\n lexer.emit(lunr.QueryLexer.TERM)\n }\n return lunr.QueryLexer.lexBoost\n }\n\n // \"+\" indicates term presence is required\n // checking for length to ensure that only\n // leading \"+\" are considered\n if (char == \"+\" && lexer.width() === 1) {\n lexer.emit(lunr.QueryLexer.PRESENCE)\n return lunr.QueryLexer.lexText\n }\n\n // \"-\" indicates term presence is prohibited\n // checking for length to ensure that only\n // leading \"-\" are considered\n if (char == \"-\" && lexer.width() === 1) {\n lexer.emit(lunr.QueryLexer.PRESENCE)\n return lunr.QueryLexer.lexText\n }\n\n if (char.match(lunr.QueryLexer.termSeparator)) {\n return lunr.QueryLexer.lexTerm\n }\n }\n}\n\nlunr.QueryParser = function (str, query) {\n this.lexer = new lunr.QueryLexer (str)\n this.query = query\n this.currentClause = {}\n this.lexemeIdx = 0\n}\n\nlunr.QueryParser.prototype.parse = function () {\n this.lexer.run()\n this.lexemes = this.lexer.lexemes\n\n var state = lunr.QueryParser.parseClause\n\n while (state) {\n state = state(this)\n }\n\n return this.query\n}\n\nlunr.QueryParser.prototype.peekLexeme = function () {\n return this.lexemes[this.lexemeIdx]\n}\n\nlunr.QueryParser.prototype.consumeLexeme = function () {\n var lexeme = this.peekLexeme()\n this.lexemeIdx += 1\n return lexeme\n}\n\nlunr.QueryParser.prototype.nextClause = function () {\n var completedClause = this.currentClause\n this.query.clause(completedClause)\n this.currentClause = {}\n}\n\nlunr.QueryParser.parseClause = function (parser) {\n var lexeme = parser.peekLexeme()\n\n if (lexeme == undefined) {\n return\n }\n\n switch (lexeme.type) {\n case lunr.QueryLexer.PRESENCE:\n return lunr.QueryParser.parsePresence\n case lunr.QueryLexer.FIELD:\n return lunr.QueryParser.parseField\n case lunr.QueryLexer.TERM:\n return lunr.QueryParser.parseTerm\n default:\n var errorMessage = \"expected either a field or a term, found \" + lexeme.type\n\n if (lexeme.str.length >= 1) {\n errorMessage += \" with value '\" + lexeme.str + \"'\"\n }\n\n throw new lunr.QueryParseError (errorMessage, lexeme.start, lexeme.end)\n }\n}\n\nlunr.QueryParser.parsePresence = function (parser) {\n var lexeme = parser.consumeLexeme()\n\n if (lexeme == undefined) {\n return\n }\n\n switch (lexeme.str) {\n case \"-\":\n parser.currentClause.presence = lunr.Query.presence.PROHIBITED\n break\n case \"+\":\n parser.currentClause.presence = lunr.Query.presence.REQUIRED\n break\n default:\n var errorMessage = \"unrecognised presence operator'\" + lexeme.str + \"'\"\n throw new lunr.QueryParseError (errorMessage, lexeme.start, lexeme.end)\n }\n\n var nextLexeme = parser.peekLexeme()\n\n if (nextLexeme == undefined) {\n var errorMessage = \"expecting term or field, found nothing\"\n throw new lunr.QueryParseError (errorMessage, lexeme.start, lexeme.end)\n }\n\n switch (nextLexeme.type) {\n case lunr.QueryLexer.FIELD:\n return lunr.QueryParser.parseField\n case lunr.QueryLexer.TERM:\n return lunr.QueryParser.parseTerm\n default:\n var errorMessage = \"expecting term or field, found '\" + nextLexeme.type + \"'\"\n throw new lunr.QueryParseError (errorMessage, nextLexeme.start, nextLexeme.end)\n }\n}\n\nlunr.QueryParser.parseField = function (parser) {\n var lexeme = parser.consumeLexeme()\n\n if (lexeme == undefined) {\n return\n }\n\n if (parser.query.allFields.indexOf(lexeme.str) == -1) {\n var possibleFields = parser.query.allFields.map(function (f) { return \"'\" + f + \"'\" }).join(', '),\n errorMessage = \"unrecognised field '\" + lexeme.str + \"', possible fields: \" + possibleFields\n\n throw new lunr.QueryParseError (errorMessage, lexeme.start, lexeme.end)\n }\n\n parser.currentClause.fields = [lexeme.str]\n\n var nextLexeme = parser.peekLexeme()\n\n if (nextLexeme == undefined) {\n var errorMessage = \"expecting term, found nothing\"\n throw new lunr.QueryParseError (errorMessage, lexeme.start, lexeme.end)\n }\n\n switch (nextLexeme.type) {\n case lunr.QueryLexer.TERM:\n return lunr.QueryParser.parseTerm\n default:\n var errorMessage = \"expecting term, found '\" + nextLexeme.type + \"'\"\n throw new lunr.QueryParseError (errorMessage, nextLexeme.start, nextLexeme.end)\n }\n}\n\nlunr.QueryParser.parseTerm = function (parser) {\n var lexeme = parser.consumeLexeme()\n\n if (lexeme == undefined) {\n return\n }\n\n parser.currentClause.term = lexeme.str.toLowerCase()\n\n if (lexeme.str.indexOf(\"*\") != -1) {\n parser.currentClause.usePipeline = false\n }\n\n var nextLexeme = parser.peekLexeme()\n\n if (nextLexeme == undefined) {\n parser.nextClause()\n return\n }\n\n switch (nextLexeme.type) {\n case lunr.QueryLexer.TERM:\n parser.nextClause()\n return lunr.QueryParser.parseTerm\n case lunr.QueryLexer.FIELD:\n parser.nextClause()\n return lunr.QueryParser.parseField\n case lunr.QueryLexer.EDIT_DISTANCE:\n return lunr.QueryParser.parseEditDistance\n case lunr.QueryLexer.BOOST:\n return lunr.QueryParser.parseBoost\n case lunr.QueryLexer.PRESENCE:\n parser.nextClause()\n return lunr.QueryParser.parsePresence\n default:\n var errorMessage = \"Unexpected lexeme type '\" + nextLexeme.type + \"'\"\n throw new lunr.QueryParseError (errorMessage, nextLexeme.start, nextLexeme.end)\n }\n}\n\nlunr.QueryParser.parseEditDistance = function (parser) {\n var lexeme = parser.consumeLexeme()\n\n if (lexeme == undefined) {\n return\n }\n\n var editDistance = parseInt(lexeme.str, 10)\n\n if (isNaN(editDistance)) {\n var errorMessage = \"edit distance must be numeric\"\n throw new lunr.QueryParseError (errorMessage, lexeme.start, lexeme.end)\n }\n\n parser.currentClause.editDistance = editDistance\n\n var nextLexeme = parser.peekLexeme()\n\n if (nextLexeme == undefined) {\n parser.nextClause()\n return\n }\n\n switch (nextLexeme.type) {\n case lunr.QueryLexer.TERM:\n parser.nextClause()\n return lunr.QueryParser.parseTerm\n case lunr.QueryLexer.FIELD:\n parser.nextClause()\n return lunr.QueryParser.parseField\n case lunr.QueryLexer.EDIT_DISTANCE:\n return lunr.QueryParser.parseEditDistance\n case lunr.QueryLexer.BOOST:\n return lunr.QueryParser.parseBoost\n case lunr.QueryLexer.PRESENCE:\n parser.nextClause()\n return lunr.QueryParser.parsePresence\n default:\n var errorMessage = \"Unexpected lexeme type '\" + nextLexeme.type + \"'\"\n throw new lunr.QueryParseError (errorMessage, nextLexeme.start, nextLexeme.end)\n }\n}\n\nlunr.QueryParser.parseBoost = function (parser) {\n var lexeme = parser.consumeLexeme()\n\n if (lexeme == undefined) {\n return\n }\n\n var boost = parseInt(lexeme.str, 10)\n\n if (isNaN(boost)) {\n var errorMessage = \"boost must be numeric\"\n throw new lunr.QueryParseError (errorMessage, lexeme.start, lexeme.end)\n }\n\n parser.currentClause.boost = boost\n\n var nextLexeme = parser.peekLexeme()\n\n if (nextLexeme == undefined) {\n parser.nextClause()\n return\n }\n\n switch (nextLexeme.type) {\n case lunr.QueryLexer.TERM:\n parser.nextClause()\n return lunr.QueryParser.parseTerm\n case lunr.QueryLexer.FIELD:\n parser.nextClause()\n return lunr.QueryParser.parseField\n case lunr.QueryLexer.EDIT_DISTANCE:\n return lunr.QueryParser.parseEditDistance\n case lunr.QueryLexer.BOOST:\n return lunr.QueryParser.parseBoost\n case lunr.QueryLexer.PRESENCE:\n parser.nextClause()\n return lunr.QueryParser.parsePresence\n default:\n var errorMessage = \"Unexpected lexeme type '\" + nextLexeme.type + \"'\"\n throw new lunr.QueryParseError (errorMessage, nextLexeme.start, nextLexeme.end)\n }\n}\n\n /**\n * export the module via AMD, CommonJS or as a browser global\n * Export code from https://github.com/umdjs/umd/blob/master/returnExports.js\n */\n ;(function (root, factory) {\n if (true) {\n // AMD. Register as an anonymous module.\n !(__WEBPACK_AMD_DEFINE_FACTORY__ = (factory),\n\t\t__WEBPACK_AMD_DEFINE_RESULT__ = (typeof __WEBPACK_AMD_DEFINE_FACTORY__ === 'function' ?\n\t\t(__WEBPACK_AMD_DEFINE_FACTORY__.call(exports, __webpack_require__, exports, module)) :\n\t\t__WEBPACK_AMD_DEFINE_FACTORY__),\n\t\t__WEBPACK_AMD_DEFINE_RESULT__ !== undefined && (module.exports = __WEBPACK_AMD_DEFINE_RESULT__))\n } else {}\n }(this, function () {\n /**\n * Just return a value to define the module export.\n * This example returns an object, but the module\n * can return a function as the exported value.\n */\n return lunr\n }))\n})();\n\n\n//# sourceURL=webpack:///../node_modules/lunr/lunr.js?"); + +/***/ }), + +/***/ "./default/assets/css/main.sass": +/*!**************************************!*\ + !*** ./default/assets/css/main.sass ***! + \**************************************/ +/***/ ((__unused_webpack_module, __webpack_exports__, __webpack_require__) => { + +"use strict"; +eval("__webpack_require__.r(__webpack_exports__);\n// extracted by mini-css-extract-plugin\n\n\n//# sourceURL=webpack:///./default/assets/css/main.sass?"); + +/***/ }), + +/***/ "./default/assets/js/src/bootstrap.ts": +/*!********************************************!*\ + !*** ./default/assets/js/src/bootstrap.ts ***! + \********************************************/ +/***/ ((__unused_webpack_module, __webpack_exports__, __webpack_require__) => { + +"use strict"; +eval("__webpack_require__.r(__webpack_exports__);\n/* harmony import */ var _typedoc_Application__WEBPACK_IMPORTED_MODULE_0__ = __webpack_require__(/*! ./typedoc/Application */ \"./default/assets/js/src/typedoc/Application.ts\");\n/* harmony import */ var _typedoc_components_MenuHighlight__WEBPACK_IMPORTED_MODULE_1__ = __webpack_require__(/*! ./typedoc/components/MenuHighlight */ \"./default/assets/js/src/typedoc/components/MenuHighlight.ts\");\n/* harmony import */ var _typedoc_components_Search__WEBPACK_IMPORTED_MODULE_2__ = __webpack_require__(/*! ./typedoc/components/Search */ \"./default/assets/js/src/typedoc/components/Search.ts\");\n/* harmony import */ var _typedoc_components_Signature__WEBPACK_IMPORTED_MODULE_3__ = __webpack_require__(/*! ./typedoc/components/Signature */ \"./default/assets/js/src/typedoc/components/Signature.ts\");\n/* harmony import */ var _typedoc_components_Toggle__WEBPACK_IMPORTED_MODULE_4__ = __webpack_require__(/*! ./typedoc/components/Toggle */ \"./default/assets/js/src/typedoc/components/Toggle.ts\");\n/* harmony import */ var _typedoc_components_Filter__WEBPACK_IMPORTED_MODULE_5__ = __webpack_require__(/*! ./typedoc/components/Filter */ \"./default/assets/js/src/typedoc/components/Filter.ts\");\n/* harmony import */ var _css_main_sass__WEBPACK_IMPORTED_MODULE_6__ = __webpack_require__(/*! ../../css/main.sass */ \"./default/assets/css/main.sass\");\n\n\n\n\n\n\n\n(0,_typedoc_components_Search__WEBPACK_IMPORTED_MODULE_2__.initSearch)();\n(0,_typedoc_Application__WEBPACK_IMPORTED_MODULE_0__.registerComponent)(_typedoc_components_MenuHighlight__WEBPACK_IMPORTED_MODULE_1__.MenuHighlight, \".menu-highlight\");\n(0,_typedoc_Application__WEBPACK_IMPORTED_MODULE_0__.registerComponent)(_typedoc_components_Signature__WEBPACK_IMPORTED_MODULE_3__.Signature, \".tsd-signatures\");\n(0,_typedoc_Application__WEBPACK_IMPORTED_MODULE_0__.registerComponent)(_typedoc_components_Toggle__WEBPACK_IMPORTED_MODULE_4__.Toggle, \"a[data-toggle]\");\nif (_typedoc_components_Filter__WEBPACK_IMPORTED_MODULE_5__.Filter.isSupported()) {\n (0,_typedoc_Application__WEBPACK_IMPORTED_MODULE_0__.registerComponent)(_typedoc_components_Filter__WEBPACK_IMPORTED_MODULE_5__.Filter, \"#tsd-filter\");\n}\nelse {\n document.documentElement.classList.add(\"no-filter\");\n}\nvar app = new _typedoc_Application__WEBPACK_IMPORTED_MODULE_0__.Application();\nObject.defineProperty(window, \"app\", { value: app });\n\n\n//# sourceURL=webpack:///./default/assets/js/src/bootstrap.ts?"); + +/***/ }), + +/***/ "./default/assets/js/src/typedoc/Application.ts": +/*!******************************************************!*\ + !*** ./default/assets/js/src/typedoc/Application.ts ***! + \******************************************************/ +/***/ ((__unused_webpack_module, __webpack_exports__, __webpack_require__) => { + +"use strict"; +eval("__webpack_require__.r(__webpack_exports__);\n/* harmony export */ __webpack_require__.d(__webpack_exports__, {\n/* harmony export */ \"registerComponent\": () => /* binding */ registerComponent,\n/* harmony export */ \"Application\": () => /* binding */ Application\n/* harmony export */ });\n/**\n * List of all known components.\n */\nvar components = [];\n/**\n * Register a new component.\n */\nfunction registerComponent(constructor, selector) {\n components.push({\n selector: selector,\n constructor: constructor,\n });\n}\n/**\n * TypeDoc application class.\n */\nvar Application = /** @class */ (function () {\n /**\n * Create a new Application instance.\n */\n function Application() {\n this.createComponents(document.body);\n }\n /**\n * Create all components beneath the given jQuery element.\n */\n Application.prototype.createComponents = function (context) {\n components.forEach(function (c) {\n context.querySelectorAll(c.selector).forEach(function (el) {\n if (!el.dataset.hasInstance) {\n new c.constructor({ el: el });\n el.dataset.hasInstance = String(true);\n }\n });\n });\n };\n return Application;\n}());\n\n\n\n//# sourceURL=webpack:///./default/assets/js/src/typedoc/Application.ts?"); + +/***/ }), + +/***/ "./default/assets/js/src/typedoc/Component.ts": +/*!****************************************************!*\ + !*** ./default/assets/js/src/typedoc/Component.ts ***! + \****************************************************/ +/***/ ((__unused_webpack_module, __webpack_exports__, __webpack_require__) => { + +"use strict"; +eval("__webpack_require__.r(__webpack_exports__);\n/* harmony export */ __webpack_require__.d(__webpack_exports__, {\n/* harmony export */ \"Component\": () => /* binding */ Component\n/* harmony export */ });\n/**\n * TypeDoc component class.\n */\nvar Component = /** @class */ (function () {\n function Component(options) {\n this.el = options.el;\n }\n return Component;\n}());\n\n\n\n//# sourceURL=webpack:///./default/assets/js/src/typedoc/Component.ts?"); + +/***/ }), + +/***/ "./default/assets/js/src/typedoc/EventTarget.ts": +/*!******************************************************!*\ + !*** ./default/assets/js/src/typedoc/EventTarget.ts ***! + \******************************************************/ +/***/ ((__unused_webpack_module, __webpack_exports__, __webpack_require__) => { + +"use strict"; +eval("__webpack_require__.r(__webpack_exports__);\n/* harmony export */ __webpack_require__.d(__webpack_exports__, {\n/* harmony export */ \"EventTarget\": () => /* binding */ EventTarget\n/* harmony export */ });\n/**\n * TypeDoc event target class.\n */\nvar EventTarget = /** @class */ (function () {\n function EventTarget() {\n this.listeners = {};\n }\n EventTarget.prototype.addEventListener = function (type, callback) {\n if (!(type in this.listeners)) {\n this.listeners[type] = [];\n }\n this.listeners[type].push(callback);\n };\n EventTarget.prototype.removeEventListener = function (type, callback) {\n if (!(type in this.listeners)) {\n return;\n }\n var stack = this.listeners[type];\n for (var i = 0, l = stack.length; i < l; i++) {\n if (stack[i] === callback) {\n stack.splice(i, 1);\n return;\n }\n }\n };\n EventTarget.prototype.dispatchEvent = function (event) {\n if (!(event.type in this.listeners)) {\n return true;\n }\n var stack = this.listeners[event.type].slice();\n for (var i = 0, l = stack.length; i < l; i++) {\n stack[i].call(this, event);\n }\n return !event.defaultPrevented;\n };\n return EventTarget;\n}());\n\n\n\n//# sourceURL=webpack:///./default/assets/js/src/typedoc/EventTarget.ts?"); + +/***/ }), + +/***/ "./default/assets/js/src/typedoc/components/Filter.ts": +/*!************************************************************!*\ + !*** ./default/assets/js/src/typedoc/components/Filter.ts ***! + \************************************************************/ +/***/ ((__unused_webpack_module, __webpack_exports__, __webpack_require__) => { + +"use strict"; +eval("__webpack_require__.r(__webpack_exports__);\n/* harmony export */ __webpack_require__.d(__webpack_exports__, {\n/* harmony export */ \"Filter\": () => /* binding */ Filter\n/* harmony export */ });\n/* harmony import */ var _Component__WEBPACK_IMPORTED_MODULE_0__ = __webpack_require__(/*! ../Component */ \"./default/assets/js/src/typedoc/Component.ts\");\n/* harmony import */ var _utils_pointer__WEBPACK_IMPORTED_MODULE_1__ = __webpack_require__(/*! ../utils/pointer */ \"./default/assets/js/src/typedoc/utils/pointer.ts\");\nvar __extends = (undefined && undefined.__extends) || (function () {\n var extendStatics = function (d, b) {\n extendStatics = Object.setPrototypeOf ||\n ({ __proto__: [] } instanceof Array && function (d, b) { d.__proto__ = b; }) ||\n function (d, b) { for (var p in b) if (Object.prototype.hasOwnProperty.call(b, p)) d[p] = b[p]; };\n return extendStatics(d, b);\n };\n return function (d, b) {\n extendStatics(d, b);\n function __() { this.constructor = d; }\n d.prototype = b === null ? Object.create(b) : (__.prototype = b.prototype, new __());\n };\n})();\n\n\nvar FilterItem = /** @class */ (function () {\n function FilterItem(key, value) {\n this.key = key;\n this.value = value;\n this.defaultValue = value;\n this.initialize();\n if (window.localStorage[this.key]) {\n this.setValue(this.fromLocalStorage(window.localStorage[this.key]));\n }\n }\n FilterItem.prototype.initialize = function () { };\n FilterItem.prototype.setValue = function (value) {\n if (this.value == value)\n return;\n var oldValue = this.value;\n this.value = value;\n window.localStorage[this.key] = this.toLocalStorage(value);\n this.handleValueChange(oldValue, value);\n };\n return FilterItem;\n}());\nvar FilterItemCheckbox = /** @class */ (function (_super) {\n __extends(FilterItemCheckbox, _super);\n function FilterItemCheckbox() {\n return _super !== null && _super.apply(this, arguments) || this;\n }\n FilterItemCheckbox.prototype.initialize = function () {\n var _this = this;\n var checkbox = document.querySelector(\"#tsd-filter-\" + this.key);\n if (!checkbox)\n return;\n this.checkbox = checkbox;\n this.checkbox.addEventListener(\"change\", function () {\n _this.setValue(_this.checkbox.checked);\n });\n };\n FilterItemCheckbox.prototype.handleValueChange = function (oldValue, newValue) {\n if (!this.checkbox)\n return;\n this.checkbox.checked = this.value;\n document.documentElement.classList.toggle(\"toggle-\" + this.key, this.value != this.defaultValue);\n };\n FilterItemCheckbox.prototype.fromLocalStorage = function (value) {\n return value == \"true\";\n };\n FilterItemCheckbox.prototype.toLocalStorage = function (value) {\n return value ? \"true\" : \"false\";\n };\n return FilterItemCheckbox;\n}(FilterItem));\nvar FilterItemSelect = /** @class */ (function (_super) {\n __extends(FilterItemSelect, _super);\n function FilterItemSelect() {\n return _super !== null && _super.apply(this, arguments) || this;\n }\n FilterItemSelect.prototype.initialize = function () {\n var _this = this;\n document.documentElement.classList.add(\"toggle-\" + this.key + this.value);\n var select = document.querySelector(\"#tsd-filter-\" + this.key);\n if (!select)\n return;\n this.select = select;\n var onActivate = function () {\n _this.select.classList.add(\"active\");\n };\n var onDeactivate = function () {\n _this.select.classList.remove(\"active\");\n };\n this.select.addEventListener(_utils_pointer__WEBPACK_IMPORTED_MODULE_1__.pointerDown, onActivate);\n this.select.addEventListener(\"mouseover\", onActivate);\n this.select.addEventListener(\"mouseleave\", onDeactivate);\n this.select.querySelectorAll(\"li\").forEach(function (el) {\n el.addEventListener(_utils_pointer__WEBPACK_IMPORTED_MODULE_1__.pointerUp, function (e) {\n select.classList.remove(\"active\");\n _this.setValue(e.target.dataset.value || \"\");\n });\n });\n document.addEventListener(_utils_pointer__WEBPACK_IMPORTED_MODULE_1__.pointerDown, function (e) {\n if (_this.select.contains(e.target))\n return;\n _this.select.classList.remove(\"active\");\n });\n };\n FilterItemSelect.prototype.handleValueChange = function (oldValue, newValue) {\n this.select.querySelectorAll(\"li.selected\").forEach(function (el) {\n el.classList.remove(\"selected\");\n });\n var selected = this.select.querySelector('li[data-value=\"' + newValue + '\"]');\n var label = this.select.querySelector(\".tsd-select-label\");\n if (selected && label) {\n selected.classList.add(\"selected\");\n label.textContent = selected.textContent;\n }\n document.documentElement.classList.remove(\"toggle-\" + oldValue);\n document.documentElement.classList.add(\"toggle-\" + newValue);\n };\n FilterItemSelect.prototype.fromLocalStorage = function (value) {\n return value;\n };\n FilterItemSelect.prototype.toLocalStorage = function (value) {\n return value;\n };\n return FilterItemSelect;\n}(FilterItem));\nvar Filter = /** @class */ (function (_super) {\n __extends(Filter, _super);\n function Filter(options) {\n var _this = _super.call(this, options) || this;\n _this.optionVisibility = new FilterItemSelect(\"visibility\", \"private\");\n _this.optionInherited = new FilterItemCheckbox(\"inherited\", true);\n _this.optionExternals = new FilterItemCheckbox(\"externals\", true);\n return _this;\n }\n Filter.isSupported = function () {\n try {\n return typeof window.localStorage != \"undefined\";\n }\n catch (e) {\n return false;\n }\n };\n return Filter;\n}(_Component__WEBPACK_IMPORTED_MODULE_0__.Component));\n\n\n\n//# sourceURL=webpack:///./default/assets/js/src/typedoc/components/Filter.ts?"); + +/***/ }), + +/***/ "./default/assets/js/src/typedoc/components/MenuHighlight.ts": +/*!*******************************************************************!*\ + !*** ./default/assets/js/src/typedoc/components/MenuHighlight.ts ***! + \*******************************************************************/ +/***/ ((__unused_webpack_module, __webpack_exports__, __webpack_require__) => { + +"use strict"; +eval("__webpack_require__.r(__webpack_exports__);\n/* harmony export */ __webpack_require__.d(__webpack_exports__, {\n/* harmony export */ \"MenuHighlight\": () => /* binding */ MenuHighlight\n/* harmony export */ });\n/* harmony import */ var _Component__WEBPACK_IMPORTED_MODULE_0__ = __webpack_require__(/*! ../Component */ \"./default/assets/js/src/typedoc/Component.ts\");\n/* harmony import */ var _services_Viewport__WEBPACK_IMPORTED_MODULE_1__ = __webpack_require__(/*! ../services/Viewport */ \"./default/assets/js/src/typedoc/services/Viewport.ts\");\nvar __extends = (undefined && undefined.__extends) || (function () {\n var extendStatics = function (d, b) {\n extendStatics = Object.setPrototypeOf ||\n ({ __proto__: [] } instanceof Array && function (d, b) { d.__proto__ = b; }) ||\n function (d, b) { for (var p in b) if (Object.prototype.hasOwnProperty.call(b, p)) d[p] = b[p]; };\n return extendStatics(d, b);\n };\n return function (d, b) {\n extendStatics(d, b);\n function __() { this.constructor = d; }\n d.prototype = b === null ? Object.create(b) : (__.prototype = b.prototype, new __());\n };\n})();\n\n\n/**\n * Manages the sticky state of the navigation and moves the highlight\n * to the current navigation item.\n */\nvar MenuHighlight = /** @class */ (function (_super) {\n __extends(MenuHighlight, _super);\n /**\n * Create a new MenuHighlight instance.\n *\n * @param options Backbone view constructor options.\n */\n function MenuHighlight(options) {\n var _this = _super.call(this, options) || this;\n /**\n * List of all discovered anchors.\n */\n _this.anchors = [];\n /**\n * Index of the currently highlighted anchor.\n */\n _this.index = -1;\n _services_Viewport__WEBPACK_IMPORTED_MODULE_1__.Viewport.instance.addEventListener(\"resize\", function () { return _this.onResize(); });\n _services_Viewport__WEBPACK_IMPORTED_MODULE_1__.Viewport.instance.addEventListener(\"scroll\", function (e) { return _this.onScroll(e); });\n _this.createAnchors();\n return _this;\n }\n /**\n * Find all anchors on the current page.\n */\n MenuHighlight.prototype.createAnchors = function () {\n var _this = this;\n var base = window.location.href;\n if (base.indexOf(\"#\") != -1) {\n base = base.substr(0, base.indexOf(\"#\"));\n }\n this.el.querySelectorAll(\"a\").forEach(function (el) {\n var href = el.href;\n if (href.indexOf(\"#\") == -1)\n return;\n if (href.substr(0, base.length) != base)\n return;\n var hash = href.substr(href.indexOf(\"#\") + 1);\n var anchor = document.querySelector(\"a.tsd-anchor[name=\" + hash + \"]\");\n var link = el.parentNode;\n if (!anchor || !link)\n return;\n _this.anchors.push({\n link: link,\n anchor: anchor,\n position: 0,\n });\n });\n this.onResize();\n };\n /**\n * Triggered after the viewport was resized.\n */\n MenuHighlight.prototype.onResize = function () {\n var anchor;\n for (var index = 0, count = this.anchors.length; index < count; index++) {\n anchor = this.anchors[index];\n var rect = anchor.anchor.getBoundingClientRect();\n anchor.position = rect.top + document.body.scrollTop;\n }\n this.anchors.sort(function (a, b) {\n return a.position - b.position;\n });\n var event = new CustomEvent(\"scroll\", {\n detail: {\n scrollTop: _services_Viewport__WEBPACK_IMPORTED_MODULE_1__.Viewport.instance.scrollTop,\n },\n });\n this.onScroll(event);\n };\n /**\n * Triggered after the viewport was scrolled.\n *\n * @param event The custom event with the current vertical scroll position.\n */\n MenuHighlight.prototype.onScroll = function (event) {\n var scrollTop = event.detail.scrollTop + 5;\n var anchors = this.anchors;\n var count = anchors.length - 1;\n var index = this.index;\n while (index > -1 && anchors[index].position > scrollTop) {\n index -= 1;\n }\n while (index < count && anchors[index + 1].position < scrollTop) {\n index += 1;\n }\n if (this.index != index) {\n if (this.index > -1)\n this.anchors[this.index].link.classList.remove(\"focus\");\n this.index = index;\n if (this.index > -1)\n this.anchors[this.index].link.classList.add(\"focus\");\n }\n };\n return MenuHighlight;\n}(_Component__WEBPACK_IMPORTED_MODULE_0__.Component));\n\n\n\n//# sourceURL=webpack:///./default/assets/js/src/typedoc/components/MenuHighlight.ts?"); + +/***/ }), + +/***/ "./default/assets/js/src/typedoc/components/Search.ts": +/*!************************************************************!*\ + !*** ./default/assets/js/src/typedoc/components/Search.ts ***! + \************************************************************/ +/***/ ((__unused_webpack_module, __webpack_exports__, __webpack_require__) => { + +"use strict"; +eval("__webpack_require__.r(__webpack_exports__);\n/* harmony export */ __webpack_require__.d(__webpack_exports__, {\n/* harmony export */ \"initSearch\": () => /* binding */ initSearch\n/* harmony export */ });\n/* harmony import */ var _utils_debounce__WEBPACK_IMPORTED_MODULE_0__ = __webpack_require__(/*! ../utils/debounce */ \"./default/assets/js/src/typedoc/utils/debounce.ts\");\n/* harmony import */ var lunr__WEBPACK_IMPORTED_MODULE_1__ = __webpack_require__(/*! lunr */ \"../node_modules/lunr/lunr.js\");\n/* harmony import */ var lunr__WEBPACK_IMPORTED_MODULE_1___default = /*#__PURE__*/__webpack_require__.n(lunr__WEBPACK_IMPORTED_MODULE_1__);\n\n\nfunction initSearch() {\n var searchEl = document.getElementById(\"tsd-search\");\n if (!searchEl)\n return;\n var searchScript = document.getElementById(\"search-script\");\n searchEl.classList.add(\"loading\");\n if (searchScript) {\n searchScript.addEventListener(\"error\", function () {\n searchEl.classList.remove(\"loading\");\n searchEl.classList.add(\"failure\");\n });\n searchScript.addEventListener(\"load\", function () {\n searchEl.classList.remove(\"loading\");\n searchEl.classList.add(\"ready\");\n });\n if (window.searchData) {\n searchEl.classList.remove(\"loading\");\n }\n }\n var field = document.querySelector(\"#tsd-search-field\");\n var results = document.querySelector(\".results\");\n if (!field || !results) {\n throw new Error(\"The input field or the result list wrapper was not found\");\n }\n var resultClicked = false;\n results.addEventListener(\"mousedown\", function () { return (resultClicked = true); });\n results.addEventListener(\"mouseup\", function () {\n resultClicked = false;\n searchEl.classList.remove(\"has-focus\");\n });\n field.addEventListener(\"focus\", function () { return searchEl.classList.add(\"has-focus\"); });\n field.addEventListener(\"blur\", function () {\n if (!resultClicked) {\n resultClicked = false;\n searchEl.classList.remove(\"has-focus\");\n }\n });\n var state = {\n base: searchEl.dataset.base + \"/\",\n };\n bindEvents(searchEl, results, field, state);\n}\nfunction bindEvents(searchEl, results, field, state) {\n field.addEventListener(\"input\", (0,_utils_debounce__WEBPACK_IMPORTED_MODULE_0__.debounce)(function () {\n updateResults(searchEl, results, field, state);\n }, 200));\n var preventPress = false;\n field.addEventListener(\"keydown\", function (e) {\n preventPress = true;\n if (e.key == \"Enter\") {\n gotoCurrentResult(results, field);\n }\n else if (e.key == \"Escape\") {\n field.blur();\n }\n else if (e.key == \"ArrowUp\") {\n setCurrentResult(results, -1);\n }\n else if (e.key === \"ArrowDown\") {\n setCurrentResult(results, 1);\n }\n else {\n preventPress = false;\n }\n });\n field.addEventListener(\"keypress\", function (e) {\n if (preventPress)\n e.preventDefault();\n });\n /**\n * Start searching by pressing slash.\n */\n document.body.addEventListener(\"keydown\", function (e) {\n if (e.altKey || e.ctrlKey || e.metaKey)\n return;\n if (!field.matches(\":focus\") && e.key === \"/\") {\n field.focus();\n e.preventDefault();\n }\n });\n}\nfunction checkIndex(state, searchEl) {\n if (state.index)\n return;\n if (window.searchData) {\n searchEl.classList.remove(\"loading\");\n searchEl.classList.add(\"ready\");\n state.data = window.searchData;\n state.index = lunr__WEBPACK_IMPORTED_MODULE_1__.Index.load(window.searchData.index);\n }\n}\nfunction updateResults(searchEl, results, query, state) {\n checkIndex(state, searchEl);\n // Don't clear results if loading state is not ready,\n // because loading or error message can be removed.\n if (!state.index || !state.data)\n return;\n results.textContent = \"\";\n var searchText = query.value.trim();\n // Perform a wildcard search\n var res = state.index.search(\"*\" + searchText + \"*\");\n for (var i = 0, c = Math.min(10, res.length); i < c; i++) {\n var row = state.data.rows[Number(res[i].ref)];\n // Bold the matched part of the query in the search results\n var name_1 = boldMatches(row.name, searchText);\n if (row.parent) {\n name_1 = \"\" + boldMatches(row.parent, searchText) + \".\" + name_1;\n }\n var item = document.createElement(\"li\");\n item.classList.value = row.classes;\n var anchor = document.createElement(\"a\");\n anchor.href = state.base + row.url;\n anchor.classList.add(\"tsd-kind-icon\");\n anchor.innerHTML = name_1;\n item.append(anchor);\n results.appendChild(item);\n }\n}\n/**\n * Move the highlight within the result set.\n */\nfunction setCurrentResult(results, dir) {\n var current = results.querySelector(\".current\");\n if (!current) {\n current = results.querySelector(dir == 1 ? \"li:first-child\" : \"li:last-child\");\n if (current) {\n current.classList.add(\"current\");\n }\n }\n else {\n var rel = dir == 1\n ? current.nextElementSibling\n : current.previousElementSibling;\n if (rel) {\n current.classList.remove(\"current\");\n rel.classList.add(\"current\");\n }\n }\n}\n/**\n * Navigate to the highlighted result.\n */\nfunction gotoCurrentResult(results, field) {\n var current = results.querySelector(\".current\");\n if (!current) {\n current = results.querySelector(\"li:first-child\");\n }\n if (current) {\n var link = current.querySelector(\"a\");\n if (link) {\n window.location.href = link.href;\n }\n field.blur();\n }\n}\nfunction boldMatches(text, search) {\n if (search === \"\") {\n return text;\n }\n var lowerText = text.toLocaleLowerCase();\n var lowerSearch = search.toLocaleLowerCase();\n var parts = [];\n var lastIndex = 0;\n var index = lowerText.indexOf(lowerSearch);\n while (index != -1) {\n parts.push(escapeHtml(text.substring(lastIndex, index)), \"\" + escapeHtml(text.substring(index, index + lowerSearch.length)) + \"\");\n lastIndex = index + lowerSearch.length;\n index = lowerText.indexOf(lowerSearch, lastIndex);\n }\n parts.push(escapeHtml(text.substring(lastIndex)));\n return parts.join(\"\");\n}\nvar SPECIAL_HTML = {\n \"&\": \"&\",\n \"<\": \"<\",\n \">\": \">\",\n \"'\": \"'\",\n '\"': \""\",\n};\nfunction escapeHtml(text) {\n return text.replace(/[&<>\"'\"]/g, function (match) { return SPECIAL_HTML[match]; });\n}\n\n\n//# sourceURL=webpack:///./default/assets/js/src/typedoc/components/Search.ts?"); + +/***/ }), + +/***/ "./default/assets/js/src/typedoc/components/Signature.ts": +/*!***************************************************************!*\ + !*** ./default/assets/js/src/typedoc/components/Signature.ts ***! + \***************************************************************/ +/***/ ((__unused_webpack_module, __webpack_exports__, __webpack_require__) => { + +"use strict"; +eval("__webpack_require__.r(__webpack_exports__);\n/* harmony export */ __webpack_require__.d(__webpack_exports__, {\n/* harmony export */ \"Signature\": () => /* binding */ Signature\n/* harmony export */ });\n/* harmony import */ var _Component__WEBPACK_IMPORTED_MODULE_0__ = __webpack_require__(/*! ../Component */ \"./default/assets/js/src/typedoc/Component.ts\");\n/* harmony import */ var _services_Viewport__WEBPACK_IMPORTED_MODULE_1__ = __webpack_require__(/*! ../services/Viewport */ \"./default/assets/js/src/typedoc/services/Viewport.ts\");\nvar __extends = (undefined && undefined.__extends) || (function () {\n var extendStatics = function (d, b) {\n extendStatics = Object.setPrototypeOf ||\n ({ __proto__: [] } instanceof Array && function (d, b) { d.__proto__ = b; }) ||\n function (d, b) { for (var p in b) if (Object.prototype.hasOwnProperty.call(b, p)) d[p] = b[p]; };\n return extendStatics(d, b);\n };\n return function (d, b) {\n extendStatics(d, b);\n function __() { this.constructor = d; }\n d.prototype = b === null ? Object.create(b) : (__.prototype = b.prototype, new __());\n };\n})();\n\n\n/**\n * Holds a signature and its description.\n */\nvar SignatureGroup = /** @class */ (function () {\n /**\n * Create a new SignatureGroup instance.\n *\n * @param signature The target signature.\n * @param description The description for the signature.\n */\n function SignatureGroup(signature, description) {\n this.signature = signature;\n this.description = description;\n }\n /**\n * Add the given class to all elements of the group.\n *\n * @param className The class name to add.\n */\n SignatureGroup.prototype.addClass = function (className) {\n this.signature.classList.add(className);\n this.description.classList.add(className);\n return this;\n };\n /**\n * Remove the given class from all elements of the group.\n *\n * @param className The class name to remove.\n */\n SignatureGroup.prototype.removeClass = function (className) {\n this.signature.classList.remove(className);\n this.description.classList.remove(className);\n return this;\n };\n return SignatureGroup;\n}());\n/**\n * Controls the tab like behaviour of methods and functions with multiple signatures.\n */\nvar Signature = /** @class */ (function (_super) {\n __extends(Signature, _super);\n /**\n * Create a new Signature instance.\n *\n * @param options Backbone view constructor options.\n */\n function Signature(options) {\n var _this = _super.call(this, options) || this;\n /**\n * List of found signature groups.\n */\n _this.groups = [];\n /**\n * The index of the currently displayed signature.\n */\n _this.index = -1;\n _this.createGroups();\n if (_this.container) {\n _this.el.classList.add(\"active\");\n Array.from(_this.el.children).forEach(function (signature) {\n signature.addEventListener(\"touchstart\", function (event) {\n return _this.onClick(event);\n });\n signature.addEventListener(\"click\", function (event) {\n return _this.onClick(event);\n });\n });\n _this.container.classList.add(\"active\");\n _this.setIndex(0);\n }\n return _this;\n }\n /**\n * Set the index of the active signature.\n *\n * @param index The index of the signature to activate.\n */\n Signature.prototype.setIndex = function (index) {\n if (index < 0)\n index = 0;\n if (index > this.groups.length - 1)\n index = this.groups.length - 1;\n if (this.index == index)\n return;\n var to = this.groups[index];\n if (this.index > -1) {\n var from_1 = this.groups[this.index];\n from_1.removeClass(\"current\").addClass(\"fade-out\");\n to.addClass(\"current\");\n to.addClass(\"fade-in\");\n _services_Viewport__WEBPACK_IMPORTED_MODULE_1__.Viewport.instance.triggerResize();\n setTimeout(function () {\n from_1.removeClass(\"fade-out\");\n to.removeClass(\"fade-in\");\n }, 300);\n }\n else {\n to.addClass(\"current\");\n _services_Viewport__WEBPACK_IMPORTED_MODULE_1__.Viewport.instance.triggerResize();\n }\n this.index = index;\n };\n /**\n * Find all signature/description groups.\n */\n Signature.prototype.createGroups = function () {\n var signatures = this.el.children;\n if (signatures.length < 2)\n return;\n this.container = this.el.nextElementSibling;\n var descriptions = this.container.children;\n this.groups = [];\n for (var index = 0; index < signatures.length; index++) {\n this.groups.push(new SignatureGroup(signatures[index], descriptions[index]));\n }\n };\n /**\n * Triggered when the user clicks onto a signature header.\n *\n * @param e The related event object.\n */\n Signature.prototype.onClick = function (e) {\n var _this = this;\n this.groups.forEach(function (group, index) {\n if (group.signature === e.currentTarget) {\n _this.setIndex(index);\n }\n });\n };\n return Signature;\n}(_Component__WEBPACK_IMPORTED_MODULE_0__.Component));\n\n\n\n//# sourceURL=webpack:///./default/assets/js/src/typedoc/components/Signature.ts?"); + +/***/ }), + +/***/ "./default/assets/js/src/typedoc/components/Toggle.ts": +/*!************************************************************!*\ + !*** ./default/assets/js/src/typedoc/components/Toggle.ts ***! + \************************************************************/ +/***/ ((__unused_webpack_module, __webpack_exports__, __webpack_require__) => { + +"use strict"; +eval("__webpack_require__.r(__webpack_exports__);\n/* harmony export */ __webpack_require__.d(__webpack_exports__, {\n/* harmony export */ \"Toggle\": () => /* binding */ Toggle\n/* harmony export */ });\n/* harmony import */ var _Component__WEBPACK_IMPORTED_MODULE_0__ = __webpack_require__(/*! ../Component */ \"./default/assets/js/src/typedoc/Component.ts\");\n/* harmony import */ var _utils_pointer__WEBPACK_IMPORTED_MODULE_1__ = __webpack_require__(/*! ../utils/pointer */ \"./default/assets/js/src/typedoc/utils/pointer.ts\");\nvar __extends = (undefined && undefined.__extends) || (function () {\n var extendStatics = function (d, b) {\n extendStatics = Object.setPrototypeOf ||\n ({ __proto__: [] } instanceof Array && function (d, b) { d.__proto__ = b; }) ||\n function (d, b) { for (var p in b) if (Object.prototype.hasOwnProperty.call(b, p)) d[p] = b[p]; };\n return extendStatics(d, b);\n };\n return function (d, b) {\n extendStatics(d, b);\n function __() { this.constructor = d; }\n d.prototype = b === null ? Object.create(b) : (__.prototype = b.prototype, new __());\n };\n})();\n\n\nvar Toggle = /** @class */ (function (_super) {\n __extends(Toggle, _super);\n function Toggle(options) {\n var _this = _super.call(this, options) || this;\n _this.className = _this.el.dataset.toggle || \"\";\n _this.el.addEventListener(_utils_pointer__WEBPACK_IMPORTED_MODULE_1__.pointerUp, function (e) { return _this.onPointerUp(e); });\n _this.el.addEventListener(\"click\", function (e) { return e.preventDefault(); });\n document.addEventListener(_utils_pointer__WEBPACK_IMPORTED_MODULE_1__.pointerDown, function (e) {\n return _this.onDocumentPointerDown(e);\n });\n document.addEventListener(_utils_pointer__WEBPACK_IMPORTED_MODULE_1__.pointerUp, function (e) {\n return _this.onDocumentPointerUp(e);\n });\n return _this;\n }\n Toggle.prototype.setActive = function (value) {\n if (this.active == value)\n return;\n this.active = value;\n document.documentElement.classList.toggle(\"has-\" + this.className, value);\n this.el.classList.toggle(\"active\", value);\n var transition = (this.active ? \"to-has-\" : \"from-has-\") + this.className;\n document.documentElement.classList.add(transition);\n setTimeout(function () { return document.documentElement.classList.remove(transition); }, 500);\n };\n Toggle.prototype.onPointerUp = function (event) {\n if (_utils_pointer__WEBPACK_IMPORTED_MODULE_1__.hasPointerMoved)\n return;\n this.setActive(true);\n event.preventDefault();\n };\n Toggle.prototype.onDocumentPointerDown = function (e) {\n if (this.active) {\n if (e.target.closest(\".col-menu, .tsd-filter-group\")) {\n return;\n }\n this.setActive(false);\n }\n };\n Toggle.prototype.onDocumentPointerUp = function (e) {\n var _this = this;\n if (_utils_pointer__WEBPACK_IMPORTED_MODULE_1__.hasPointerMoved)\n return;\n if (this.active) {\n if (e.target.closest(\".col-menu\")) {\n var link = e.target.closest(\"a\");\n if (link) {\n var href = window.location.href;\n if (href.indexOf(\"#\") != -1) {\n href = href.substr(0, href.indexOf(\"#\"));\n }\n if (link.href.substr(0, href.length) == href) {\n setTimeout(function () { return _this.setActive(false); }, 250);\n }\n }\n }\n }\n };\n return Toggle;\n}(_Component__WEBPACK_IMPORTED_MODULE_0__.Component));\n\n\n\n//# sourceURL=webpack:///./default/assets/js/src/typedoc/components/Toggle.ts?"); + +/***/ }), + +/***/ "./default/assets/js/src/typedoc/services/Viewport.ts": +/*!************************************************************!*\ + !*** ./default/assets/js/src/typedoc/services/Viewport.ts ***! + \************************************************************/ +/***/ ((__unused_webpack_module, __webpack_exports__, __webpack_require__) => { + +"use strict"; +eval("__webpack_require__.r(__webpack_exports__);\n/* harmony export */ __webpack_require__.d(__webpack_exports__, {\n/* harmony export */ \"Viewport\": () => /* binding */ Viewport\n/* harmony export */ });\n/* harmony import */ var _EventTarget__WEBPACK_IMPORTED_MODULE_0__ = __webpack_require__(/*! ../EventTarget */ \"./default/assets/js/src/typedoc/EventTarget.ts\");\n/* harmony import */ var _utils_trottle__WEBPACK_IMPORTED_MODULE_1__ = __webpack_require__(/*! ../utils/trottle */ \"./default/assets/js/src/typedoc/utils/trottle.ts\");\nvar __extends = (undefined && undefined.__extends) || (function () {\n var extendStatics = function (d, b) {\n extendStatics = Object.setPrototypeOf ||\n ({ __proto__: [] } instanceof Array && function (d, b) { d.__proto__ = b; }) ||\n function (d, b) { for (var p in b) if (Object.prototype.hasOwnProperty.call(b, p)) d[p] = b[p]; };\n return extendStatics(d, b);\n };\n return function (d, b) {\n extendStatics(d, b);\n function __() { this.constructor = d; }\n d.prototype = b === null ? Object.create(b) : (__.prototype = b.prototype, new __());\n };\n})();\n\n\n/**\n * A global service that monitors the window size and scroll position.\n */\nvar Viewport = /** @class */ (function (_super) {\n __extends(Viewport, _super);\n /**\n * Create new Viewport instance.\n */\n function Viewport() {\n var _this = _super.call(this) || this;\n /**\n * The current scroll position.\n */\n _this.scrollTop = 0;\n /**\n * The previous scrollTop.\n */\n _this.lastY = 0;\n /**\n * The width of the window.\n */\n _this.width = 0;\n /**\n * The height of the window.\n */\n _this.height = 0;\n /**\n * Boolean indicating whether the toolbar is shown.\n */\n _this.showToolbar = true;\n _this.toolbar = (document.querySelector(\".tsd-page-toolbar\"));\n _this.secondaryNav = (document.querySelector(\".tsd-navigation.secondary\"));\n window.addEventListener(\"scroll\", (0,_utils_trottle__WEBPACK_IMPORTED_MODULE_1__.throttle)(function () { return _this.onScroll(); }, 10));\n window.addEventListener(\"resize\", (0,_utils_trottle__WEBPACK_IMPORTED_MODULE_1__.throttle)(function () { return _this.onResize(); }, 10));\n _this.onResize();\n _this.onScroll();\n return _this;\n }\n /**\n * Trigger a resize event.\n */\n Viewport.prototype.triggerResize = function () {\n var event = new CustomEvent(\"resize\", {\n detail: {\n width: this.width,\n height: this.height,\n },\n });\n this.dispatchEvent(event);\n };\n /**\n * Triggered when the size of the window has changed.\n */\n Viewport.prototype.onResize = function () {\n this.width = window.innerWidth || 0;\n this.height = window.innerHeight || 0;\n var event = new CustomEvent(\"resize\", {\n detail: {\n width: this.width,\n height: this.height,\n },\n });\n this.dispatchEvent(event);\n };\n /**\n * Triggered when the user scrolled the viewport.\n */\n Viewport.prototype.onScroll = function () {\n this.scrollTop = window.scrollY || 0;\n var event = new CustomEvent(\"scroll\", {\n detail: {\n scrollTop: this.scrollTop,\n },\n });\n this.dispatchEvent(event);\n this.hideShowToolbar();\n };\n /**\n * Handle hiding/showing of the toolbar.\n */\n Viewport.prototype.hideShowToolbar = function () {\n var isShown = this.showToolbar;\n this.showToolbar = this.lastY >= this.scrollTop || this.scrollTop <= 0;\n if (isShown !== this.showToolbar) {\n this.toolbar.classList.toggle(\"tsd-page-toolbar--hide\");\n this.secondaryNav.classList.toggle(\"tsd-navigation--toolbar-hide\");\n }\n this.lastY = this.scrollTop;\n };\n Viewport.instance = new Viewport();\n return Viewport;\n}(_EventTarget__WEBPACK_IMPORTED_MODULE_0__.EventTarget));\n\n\n\n//# sourceURL=webpack:///./default/assets/js/src/typedoc/services/Viewport.ts?"); + +/***/ }), + +/***/ "./default/assets/js/src/typedoc/utils/debounce.ts": +/*!*********************************************************!*\ + !*** ./default/assets/js/src/typedoc/utils/debounce.ts ***! + \*********************************************************/ +/***/ ((__unused_webpack_module, __webpack_exports__, __webpack_require__) => { + +"use strict"; +eval("__webpack_require__.r(__webpack_exports__);\n/* harmony export */ __webpack_require__.d(__webpack_exports__, {\n/* harmony export */ \"debounce\": () => /* binding */ debounce\n/* harmony export */ });\nvar debounce = function (fn, wait) {\n if (wait === void 0) { wait = 100; }\n var timeout;\n return function () {\n var args = [];\n for (var _i = 0; _i < arguments.length; _i++) {\n args[_i] = arguments[_i];\n }\n clearTimeout(timeout);\n timeout = setTimeout(function () { return fn(args); }, wait);\n };\n};\n\n\n//# sourceURL=webpack:///./default/assets/js/src/typedoc/utils/debounce.ts?"); + +/***/ }), + +/***/ "./default/assets/js/src/typedoc/utils/pointer.ts": +/*!********************************************************!*\ + !*** ./default/assets/js/src/typedoc/utils/pointer.ts ***! + \********************************************************/ +/***/ ((__unused_webpack_module, __webpack_exports__, __webpack_require__) => { + +"use strict"; +eval("__webpack_require__.r(__webpack_exports__);\n/* harmony export */ __webpack_require__.d(__webpack_exports__, {\n/* harmony export */ \"pointerDown\": () => /* binding */ pointerDown,\n/* harmony export */ \"pointerMove\": () => /* binding */ pointerMove,\n/* harmony export */ \"pointerUp\": () => /* binding */ pointerUp,\n/* harmony export */ \"pointerDownPosition\": () => /* binding */ pointerDownPosition,\n/* harmony export */ \"preventNextClick\": () => /* binding */ preventNextClick,\n/* harmony export */ \"isPointerDown\": () => /* binding */ isPointerDown,\n/* harmony export */ \"isPointerTouch\": () => /* binding */ isPointerTouch,\n/* harmony export */ \"hasPointerMoved\": () => /* binding */ hasPointerMoved,\n/* harmony export */ \"isMobile\": () => /* binding */ isMobile\n/* harmony export */ });\n/**\n * Event name of the pointer down event.\n */\nvar pointerDown = \"mousedown\";\n/**\n * Event name of the pointer move event.\n */\nvar pointerMove = \"mousemove\";\n/**\n * Event name of the pointer up event.\n */\nvar pointerUp = \"mouseup\";\n/**\n * Position the pointer was pressed at.\n */\nvar pointerDownPosition = { x: 0, y: 0 };\n/**\n * Should the next click on the document be supressed?\n */\nvar preventNextClick = false;\n/**\n * Is the pointer down?\n */\nvar isPointerDown = false;\n/**\n * Is the pointer a touch point?\n */\nvar isPointerTouch = false;\n/**\n * Did the pointer move since the last down event?\n */\nvar hasPointerMoved = false;\n/**\n * Is the user agent a mobile agent?\n */\nvar isMobile = /Android|webOS|iPhone|iPad|iPod|BlackBerry|IEMobile|Opera Mini/i.test(navigator.userAgent);\ndocument.documentElement.classList.add(isMobile ? \"is-mobile\" : \"not-mobile\");\nif (isMobile && \"ontouchstart\" in document.documentElement) {\n isPointerTouch = true;\n pointerDown = \"touchstart\";\n pointerMove = \"touchmove\";\n pointerUp = \"touchend\";\n}\ndocument.addEventListener(pointerDown, function (e) {\n isPointerDown = true;\n hasPointerMoved = false;\n var t = pointerDown == \"touchstart\"\n ? e.targetTouches[0]\n : e;\n pointerDownPosition.y = t.pageY || 0;\n pointerDownPosition.x = t.pageX || 0;\n});\ndocument.addEventListener(pointerMove, function (e) {\n if (!isPointerDown)\n return;\n if (!hasPointerMoved) {\n var t = pointerDown == \"touchstart\"\n ? e.targetTouches[0]\n : e;\n var x = pointerDownPosition.x - (t.pageX || 0);\n var y = pointerDownPosition.y - (t.pageY || 0);\n hasPointerMoved = Math.sqrt(x * x + y * y) > 10;\n }\n});\ndocument.addEventListener(pointerUp, function () {\n isPointerDown = false;\n});\ndocument.addEventListener(\"click\", function (e) {\n if (preventNextClick) {\n e.preventDefault();\n e.stopImmediatePropagation();\n preventNextClick = false;\n }\n});\n\n\n//# sourceURL=webpack:///./default/assets/js/src/typedoc/utils/pointer.ts?"); + +/***/ }), + +/***/ "./default/assets/js/src/typedoc/utils/trottle.ts": +/*!********************************************************!*\ + !*** ./default/assets/js/src/typedoc/utils/trottle.ts ***! + \********************************************************/ +/***/ ((__unused_webpack_module, __webpack_exports__, __webpack_require__) => { + +"use strict"; +eval("__webpack_require__.r(__webpack_exports__);\n/* harmony export */ __webpack_require__.d(__webpack_exports__, {\n/* harmony export */ \"throttle\": () => /* binding */ throttle\n/* harmony export */ });\nvar throttle = function (fn, wait) {\n if (wait === void 0) { wait = 100; }\n var time = Date.now();\n return function () {\n var args = [];\n for (var _i = 0; _i < arguments.length; _i++) {\n args[_i] = arguments[_i];\n }\n if (time + wait - Date.now() < 0) {\n fn.apply(void 0, args);\n time = Date.now();\n }\n };\n};\n\n\n//# sourceURL=webpack:///./default/assets/js/src/typedoc/utils/trottle.ts?"); + +/***/ }) + +/******/ }); +/************************************************************************/ +/******/ // The module cache +/******/ var __webpack_module_cache__ = {}; +/******/ +/******/ // The require function +/******/ function __webpack_require__(moduleId) { +/******/ // Check if module is in cache +/******/ if(__webpack_module_cache__[moduleId]) { +/******/ return __webpack_module_cache__[moduleId].exports; +/******/ } +/******/ // Create a new module (and put it into the cache) +/******/ var module = __webpack_module_cache__[moduleId] = { +/******/ // no module.id needed +/******/ // no module.loaded needed +/******/ exports: {} +/******/ }; +/******/ +/******/ // Execute the module function +/******/ __webpack_modules__[moduleId](module, module.exports, __webpack_require__); +/******/ +/******/ // Return the exports of the module +/******/ return module.exports; +/******/ } +/******/ +/************************************************************************/ +/******/ /* webpack/runtime/compat get default export */ +/******/ (() => { +/******/ // getDefaultExport function for compatibility with non-harmony modules +/******/ __webpack_require__.n = (module) => { +/******/ var getter = module && module.__esModule ? +/******/ () => module['default'] : +/******/ () => module; +/******/ __webpack_require__.d(getter, { a: getter }); +/******/ return getter; +/******/ }; +/******/ })(); +/******/ +/******/ /* webpack/runtime/define property getters */ +/******/ (() => { +/******/ // define getter functions for harmony exports +/******/ __webpack_require__.d = (exports, definition) => { +/******/ for(var key in definition) { +/******/ if(__webpack_require__.o(definition, key) && !__webpack_require__.o(exports, key)) { +/******/ Object.defineProperty(exports, key, { enumerable: true, get: definition[key] }); +/******/ } +/******/ } +/******/ }; +/******/ })(); +/******/ +/******/ /* webpack/runtime/hasOwnProperty shorthand */ +/******/ (() => { +/******/ __webpack_require__.o = (obj, prop) => Object.prototype.hasOwnProperty.call(obj, prop) +/******/ })(); +/******/ +/******/ /* webpack/runtime/make namespace object */ +/******/ (() => { +/******/ // define __esModule on exports +/******/ __webpack_require__.r = (exports) => { +/******/ if(typeof Symbol !== 'undefined' && Symbol.toStringTag) { +/******/ Object.defineProperty(exports, Symbol.toStringTag, { value: 'Module' }); +/******/ } +/******/ Object.defineProperty(exports, '__esModule', { value: true }); +/******/ }; +/******/ })(); +/******/ +/************************************************************************/ +/******/ // startup +/******/ // Load entry module +/******/ __webpack_require__("./default/assets/js/src/bootstrap.ts"); +/******/ // This entry module used 'exports' so it can't be inlined +/******/ })() +; \ No newline at end of file diff --git a/docs/assets/js/search.js b/docs/assets/js/search.js new file mode 100644 index 000000000..9cac81346 --- /dev/null +++ b/docs/assets/js/search.js @@ -0,0 +1 @@ +window.searchData = {"kinds":{"1":"Module","4":"Enumeration","16":"Enumeration member","64":"Function","128":"Class","256":"Interface","512":"Constructor","1024":"Property","65536":"Type literal","4194304":"Type alias"},"rows":[{"id":0,"kind":1,"name":"SelfServe","url":"modules/selfserve.html","classes":"tsd-kind-module"},{"id":1,"kind":1,"name":"SelfServe - What is currently supported?","url":"modules/selfserve___what_is_currently_supported_.html","classes":"tsd-kind-module"},{"id":2,"kind":1,"name":"SelfServe/Decorators","url":"modules/selfserve_decorators.html","classes":"tsd-kind-module"},{"id":3,"kind":256,"name":"NumberInputOptions","url":"interfaces/selfserve_decorators.numberinputoptions.html","classes":"tsd-kind-interface tsd-parent-kind-module","parent":"SelfServe/Decorators"},{"id":4,"kind":1024,"name":"min","url":"interfaces/selfserve_decorators.numberinputoptions.html#min","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/Decorators.NumberInputOptions"},{"id":5,"kind":1024,"name":"max","url":"interfaces/selfserve_decorators.numberinputoptions.html#max","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/Decorators.NumberInputOptions"},{"id":6,"kind":1024,"name":"step","url":"interfaces/selfserve_decorators.numberinputoptions.html#step","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/Decorators.NumberInputOptions"},{"id":7,"kind":1024,"name":"uiType","url":"interfaces/selfserve_decorators.numberinputoptions.html#uitype","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/Decorators.NumberInputOptions"},{"id":8,"kind":1024,"name":"labelTKey","url":"interfaces/selfserve_decorators.numberinputoptions.html#labeltkey","classes":"tsd-kind-property tsd-parent-kind-interface tsd-is-inherited","parent":"SelfServe/Decorators.NumberInputOptions"},{"id":9,"kind":256,"name":"StringInputOptions","url":"interfaces/selfserve_decorators.stringinputoptions.html","classes":"tsd-kind-interface tsd-parent-kind-module","parent":"SelfServe/Decorators"},{"id":10,"kind":1024,"name":"placeholderTKey","url":"interfaces/selfserve_decorators.stringinputoptions.html#placeholdertkey","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/Decorators.StringInputOptions"},{"id":11,"kind":1024,"name":"labelTKey","url":"interfaces/selfserve_decorators.stringinputoptions.html#labeltkey","classes":"tsd-kind-property tsd-parent-kind-interface tsd-is-inherited","parent":"SelfServe/Decorators.StringInputOptions"},{"id":12,"kind":256,"name":"BooleanInputOptions","url":"interfaces/selfserve_decorators.booleaninputoptions.html","classes":"tsd-kind-interface tsd-parent-kind-module","parent":"SelfServe/Decorators"},{"id":13,"kind":1024,"name":"trueLabelTKey","url":"interfaces/selfserve_decorators.booleaninputoptions.html#truelabeltkey","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/Decorators.BooleanInputOptions"},{"id":14,"kind":1024,"name":"falseLabelTKey","url":"interfaces/selfserve_decorators.booleaninputoptions.html#falselabeltkey","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/Decorators.BooleanInputOptions"},{"id":15,"kind":1024,"name":"labelTKey","url":"interfaces/selfserve_decorators.booleaninputoptions.html#labeltkey","classes":"tsd-kind-property tsd-parent-kind-interface tsd-is-inherited","parent":"SelfServe/Decorators.BooleanInputOptions"},{"id":16,"kind":256,"name":"ChoiceInputOptions","url":"interfaces/selfserve_decorators.choiceinputoptions.html","classes":"tsd-kind-interface tsd-parent-kind-module","parent":"SelfServe/Decorators"},{"id":17,"kind":1024,"name":"choices","url":"interfaces/selfserve_decorators.choiceinputoptions.html#choices","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/Decorators.ChoiceInputOptions"},{"id":18,"kind":1024,"name":"placeholderTKey","url":"interfaces/selfserve_decorators.choiceinputoptions.html#placeholdertkey","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/Decorators.ChoiceInputOptions"},{"id":19,"kind":1024,"name":"labelTKey","url":"interfaces/selfserve_decorators.choiceinputoptions.html#labeltkey","classes":"tsd-kind-property tsd-parent-kind-interface tsd-is-inherited","parent":"SelfServe/Decorators.ChoiceInputOptions"},{"id":20,"kind":256,"name":"DescriptionDisplayOptions","url":"interfaces/selfserve_decorators.descriptiondisplayoptions.html","classes":"tsd-kind-interface tsd-parent-kind-module","parent":"SelfServe/Decorators"},{"id":21,"kind":1024,"name":"labelTKey","url":"interfaces/selfserve_decorators.descriptiondisplayoptions.html#labeltkey","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/Decorators.DescriptionDisplayOptions"},{"id":22,"kind":1024,"name":"description","url":"interfaces/selfserve_decorators.descriptiondisplayoptions.html#description","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/Decorators.DescriptionDisplayOptions"},{"id":23,"kind":1024,"name":"isDynamicDescription","url":"interfaces/selfserve_decorators.descriptiondisplayoptions.html#isdynamicdescription","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/Decorators.DescriptionDisplayOptions"},{"id":24,"kind":4194304,"name":"InputOptions","url":"modules/selfserve_decorators.html#inputoptions","classes":"tsd-kind-type-alias tsd-parent-kind-module","parent":"SelfServe/Decorators"},{"id":25,"kind":64,"name":"OnChange","url":"modules/selfserve_decorators.html#onchange","classes":"tsd-kind-function tsd-parent-kind-module","parent":"SelfServe/Decorators"},{"id":26,"kind":64,"name":"PropertyInfo","url":"modules/selfserve_decorators.html#propertyinfo","classes":"tsd-kind-function tsd-parent-kind-module","parent":"SelfServe/Decorators"},{"id":27,"kind":64,"name":"Values","url":"modules/selfserve_decorators.html#values","classes":"tsd-kind-function tsd-parent-kind-module","parent":"SelfServe/Decorators"},{"id":28,"kind":64,"name":"IsDisplayable","url":"modules/selfserve_decorators.html#isdisplayable","classes":"tsd-kind-function tsd-parent-kind-module","parent":"SelfServe/Decorators"},{"id":29,"kind":64,"name":"RefreshOptions","url":"modules/selfserve_decorators.html#refreshoptions","classes":"tsd-kind-function tsd-parent-kind-module","parent":"SelfServe/Decorators"},{"id":30,"kind":1,"name":"SelfServe/SelfServeTypes","url":"modules/selfserve_selfservetypes.html","classes":"tsd-kind-module"},{"id":31,"kind":4194304,"name":"initializeCallback","url":"modules/selfserve_selfservetypes.html#initializecallback","classes":"tsd-kind-type-alias tsd-parent-kind-module","parent":"SelfServe/SelfServeTypes"},{"id":32,"kind":65536,"name":"__type","url":"modules/selfserve_selfservetypes.html#initializecallback.__type-2","classes":"tsd-kind-type-literal tsd-parent-kind-type-alias","parent":"SelfServe/SelfServeTypes.initializeCallback"},{"id":33,"kind":4194304,"name":"onSaveCallback","url":"modules/selfserve_selfservetypes.html#onsavecallback","classes":"tsd-kind-type-alias tsd-parent-kind-module","parent":"SelfServe/SelfServeTypes"},{"id":34,"kind":65536,"name":"__type","url":"modules/selfserve_selfservetypes.html#onsavecallback.__type-3","classes":"tsd-kind-type-literal tsd-parent-kind-type-alias","parent":"SelfServe/SelfServeTypes.onSaveCallback"},{"id":35,"kind":128,"name":"SelfServeBaseClass","url":"classes/selfserve_selfservetypes.selfservebaseclass.html","classes":"tsd-kind-class tsd-parent-kind-module","parent":"SelfServe/SelfServeTypes"},{"id":36,"kind":512,"name":"constructor","url":"classes/selfserve_selfservetypes.selfservebaseclass.html#constructor","classes":"tsd-kind-constructor tsd-parent-kind-class","parent":"SelfServe/SelfServeTypes.SelfServeBaseClass"},{"id":37,"kind":1024,"name":"initialize","url":"classes/selfserve_selfservetypes.selfservebaseclass.html#initialize","classes":"tsd-kind-property tsd-parent-kind-class","parent":"SelfServe/SelfServeTypes.SelfServeBaseClass"},{"id":38,"kind":1024,"name":"onSave","url":"classes/selfserve_selfservetypes.selfservebaseclass.html#onsave","classes":"tsd-kind-property tsd-parent-kind-class","parent":"SelfServe/SelfServeTypes.SelfServeBaseClass"},{"id":39,"kind":1024,"name":"onRefresh","url":"classes/selfserve_selfservetypes.selfservebaseclass.html#onrefresh","classes":"tsd-kind-property tsd-parent-kind-class","parent":"SelfServe/SelfServeTypes.SelfServeBaseClass"},{"id":40,"kind":65536,"name":"__type","url":"classes/selfserve_selfservetypes.selfservebaseclass.html#__type","classes":"tsd-kind-type-literal tsd-parent-kind-class","parent":"SelfServe/SelfServeTypes.SelfServeBaseClass"},{"id":41,"kind":4194304,"name":"OnChangeCallback","url":"modules/selfserve_selfservetypes.html#onchangecallback","classes":"tsd-kind-type-alias tsd-parent-kind-module","parent":"SelfServe/SelfServeTypes"},{"id":42,"kind":65536,"name":"__type","url":"modules/selfserve_selfservetypes.html#onchangecallback.__type-1","classes":"tsd-kind-type-literal tsd-parent-kind-type-alias","parent":"SelfServe/SelfServeTypes.OnChangeCallback"},{"id":43,"kind":4,"name":"NumberUiType","url":"enums/selfserve_selfservetypes.numberuitype.html","classes":"tsd-kind-enum tsd-parent-kind-module","parent":"SelfServe/SelfServeTypes"},{"id":44,"kind":16,"name":"Spinner","url":"enums/selfserve_selfservetypes.numberuitype.html#spinner","classes":"tsd-kind-enum-member tsd-parent-kind-enum","parent":"SelfServe/SelfServeTypes.NumberUiType"},{"id":45,"kind":16,"name":"Slider","url":"enums/selfserve_selfservetypes.numberuitype.html#slider","classes":"tsd-kind-enum-member tsd-parent-kind-enum","parent":"SelfServe/SelfServeTypes.NumberUiType"},{"id":46,"kind":4194304,"name":"ChoiceItem","url":"modules/selfserve_selfservetypes.html#choiceitem","classes":"tsd-kind-type-alias tsd-parent-kind-module","parent":"SelfServe/SelfServeTypes"},{"id":47,"kind":65536,"name":"__type","url":"modules/selfserve_selfservetypes.html#choiceitem.__type","classes":"tsd-kind-type-literal tsd-parent-kind-type-alias","parent":"SelfServe/SelfServeTypes.ChoiceItem"},{"id":48,"kind":1024,"name":"labelTKey","url":"modules/selfserve_selfservetypes.html#choiceitem.__type.labeltkey","classes":"tsd-kind-property tsd-parent-kind-type-literal","parent":"SelfServe/SelfServeTypes.ChoiceItem.__type"},{"id":49,"kind":1024,"name":"key","url":"modules/selfserve_selfservetypes.html#choiceitem.__type.key","classes":"tsd-kind-property tsd-parent-kind-type-literal","parent":"SelfServe/SelfServeTypes.ChoiceItem.__type"},{"id":50,"kind":4194304,"name":"InputType","url":"modules/selfserve_selfservetypes.html#inputtype","classes":"tsd-kind-type-alias tsd-parent-kind-module","parent":"SelfServe/SelfServeTypes"},{"id":51,"kind":256,"name":"Info","url":"interfaces/selfserve_selfservetypes.info.html","classes":"tsd-kind-interface tsd-parent-kind-module","parent":"SelfServe/SelfServeTypes"},{"id":52,"kind":1024,"name":"messageTKey","url":"interfaces/selfserve_selfservetypes.info.html#messagetkey","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/SelfServeTypes.Info"},{"id":53,"kind":1024,"name":"link","url":"interfaces/selfserve_selfservetypes.info.html#link","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/SelfServeTypes.Info"},{"id":54,"kind":65536,"name":"__type","url":"interfaces/selfserve_selfservetypes.info.html#__type","classes":"tsd-kind-type-literal tsd-parent-kind-interface","parent":"SelfServe/SelfServeTypes.Info"},{"id":55,"kind":1024,"name":"href","url":"interfaces/selfserve_selfservetypes.info.html#__type.href","classes":"tsd-kind-property tsd-parent-kind-type-literal","parent":"SelfServe/SelfServeTypes.Info.__type"},{"id":56,"kind":1024,"name":"textTKey","url":"interfaces/selfserve_selfservetypes.info.html#__type.texttkey","classes":"tsd-kind-property tsd-parent-kind-type-literal","parent":"SelfServe/SelfServeTypes.Info.__type"},{"id":57,"kind":4,"name":"DescriptionType","url":"enums/selfserve_selfservetypes.descriptiontype.html","classes":"tsd-kind-enum tsd-parent-kind-module","parent":"SelfServe/SelfServeTypes"},{"id":58,"kind":16,"name":"Text","url":"enums/selfserve_selfservetypes.descriptiontype.html#text","classes":"tsd-kind-enum-member tsd-parent-kind-enum","parent":"SelfServe/SelfServeTypes.DescriptionType"},{"id":59,"kind":16,"name":"InfoMessageBar","url":"enums/selfserve_selfservetypes.descriptiontype.html#infomessagebar","classes":"tsd-kind-enum-member tsd-parent-kind-enum","parent":"SelfServe/SelfServeTypes.DescriptionType"},{"id":60,"kind":16,"name":"WarningMessageBar","url":"enums/selfserve_selfservetypes.descriptiontype.html#warningmessagebar","classes":"tsd-kind-enum-member tsd-parent-kind-enum","parent":"SelfServe/SelfServeTypes.DescriptionType"},{"id":61,"kind":256,"name":"Description","url":"interfaces/selfserve_selfservetypes.description.html","classes":"tsd-kind-interface tsd-parent-kind-module","parent":"SelfServe/SelfServeTypes"},{"id":62,"kind":1024,"name":"textTKey","url":"interfaces/selfserve_selfservetypes.description.html#texttkey-1","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/SelfServeTypes.Description"},{"id":63,"kind":1024,"name":"type","url":"interfaces/selfserve_selfservetypes.description.html#type","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/SelfServeTypes.Description"},{"id":64,"kind":1024,"name":"link","url":"interfaces/selfserve_selfservetypes.description.html#link","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/SelfServeTypes.Description"},{"id":65,"kind":65536,"name":"__type","url":"interfaces/selfserve_selfservetypes.description.html#__type","classes":"tsd-kind-type-literal tsd-parent-kind-interface","parent":"SelfServe/SelfServeTypes.Description"},{"id":66,"kind":1024,"name":"href","url":"interfaces/selfserve_selfservetypes.description.html#__type.href","classes":"tsd-kind-property tsd-parent-kind-type-literal","parent":"SelfServe/SelfServeTypes.Description.__type"},{"id":67,"kind":1024,"name":"textTKey","url":"interfaces/selfserve_selfservetypes.description.html#__type.texttkey","classes":"tsd-kind-property tsd-parent-kind-type-literal","parent":"SelfServe/SelfServeTypes.Description.__type"},{"id":68,"kind":256,"name":"SmartUiInput","url":"interfaces/selfserve_selfservetypes.smartuiinput.html","classes":"tsd-kind-interface tsd-parent-kind-module","parent":"SelfServe/SelfServeTypes"},{"id":69,"kind":1024,"name":"value","url":"interfaces/selfserve_selfservetypes.smartuiinput.html#value","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/SelfServeTypes.SmartUiInput"},{"id":70,"kind":1024,"name":"hidden","url":"interfaces/selfserve_selfservetypes.smartuiinput.html#hidden","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/SelfServeTypes.SmartUiInput"},{"id":71,"kind":1024,"name":"disabled","url":"interfaces/selfserve_selfservetypes.smartuiinput.html#disabled","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/SelfServeTypes.SmartUiInput"},{"id":72,"kind":256,"name":"OnSaveResult","url":"interfaces/selfserve_selfservetypes.onsaveresult.html","classes":"tsd-kind-interface tsd-parent-kind-module","parent":"SelfServe/SelfServeTypes"},{"id":73,"kind":1024,"name":"operationStatusUrl","url":"interfaces/selfserve_selfservetypes.onsaveresult.html#operationstatusurl","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/SelfServeTypes.OnSaveResult"},{"id":74,"kind":1024,"name":"portalNotification","url":"interfaces/selfserve_selfservetypes.onsaveresult.html#portalnotification","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/SelfServeTypes.OnSaveResult"},{"id":75,"kind":65536,"name":"__type","url":"interfaces/selfserve_selfservetypes.onsaveresult.html#__type","classes":"tsd-kind-type-literal tsd-parent-kind-interface","parent":"SelfServe/SelfServeTypes.OnSaveResult"},{"id":76,"kind":1024,"name":"initialize","url":"interfaces/selfserve_selfservetypes.onsaveresult.html#__type.initialize","classes":"tsd-kind-property tsd-parent-kind-type-literal","parent":"SelfServe/SelfServeTypes.OnSaveResult.__type"},{"id":77,"kind":65536,"name":"__type","url":"interfaces/selfserve_selfservetypes.onsaveresult.html#__type.__type-2","classes":"tsd-kind-type-literal tsd-parent-kind-type-literal","parent":"SelfServe/SelfServeTypes.OnSaveResult.__type"},{"id":78,"kind":1024,"name":"titleTKey","url":"interfaces/selfserve_selfservetypes.onsaveresult.html#__type.__type-2.titletkey-1","classes":"tsd-kind-property tsd-parent-kind-type-literal","parent":"SelfServe/SelfServeTypes.OnSaveResult.__type.__type"},{"id":79,"kind":1024,"name":"messageTKey","url":"interfaces/selfserve_selfservetypes.onsaveresult.html#__type.__type-2.messagetkey-1","classes":"tsd-kind-property tsd-parent-kind-type-literal","parent":"SelfServe/SelfServeTypes.OnSaveResult.__type.__type"},{"id":80,"kind":1024,"name":"success","url":"interfaces/selfserve_selfservetypes.onsaveresult.html#__type.success","classes":"tsd-kind-property tsd-parent-kind-type-literal","parent":"SelfServe/SelfServeTypes.OnSaveResult.__type"},{"id":81,"kind":65536,"name":"__type","url":"interfaces/selfserve_selfservetypes.onsaveresult.html#__type.__type-3","classes":"tsd-kind-type-literal tsd-parent-kind-type-literal","parent":"SelfServe/SelfServeTypes.OnSaveResult.__type"},{"id":82,"kind":1024,"name":"titleTKey","url":"interfaces/selfserve_selfservetypes.onsaveresult.html#__type.__type-3.titletkey-2","classes":"tsd-kind-property tsd-parent-kind-type-literal","parent":"SelfServe/SelfServeTypes.OnSaveResult.__type.__type"},{"id":83,"kind":1024,"name":"messageTKey","url":"interfaces/selfserve_selfservetypes.onsaveresult.html#__type.__type-3.messagetkey-2","classes":"tsd-kind-property tsd-parent-kind-type-literal","parent":"SelfServe/SelfServeTypes.OnSaveResult.__type.__type"},{"id":84,"kind":1024,"name":"failure","url":"interfaces/selfserve_selfservetypes.onsaveresult.html#__type.failure","classes":"tsd-kind-property tsd-parent-kind-type-literal","parent":"SelfServe/SelfServeTypes.OnSaveResult.__type"},{"id":85,"kind":65536,"name":"__type","url":"interfaces/selfserve_selfservetypes.onsaveresult.html#__type.__type-1","classes":"tsd-kind-type-literal tsd-parent-kind-type-literal","parent":"SelfServe/SelfServeTypes.OnSaveResult.__type"},{"id":86,"kind":1024,"name":"titleTKey","url":"interfaces/selfserve_selfservetypes.onsaveresult.html#__type.__type-1.titletkey","classes":"tsd-kind-property tsd-parent-kind-type-literal","parent":"SelfServe/SelfServeTypes.OnSaveResult.__type.__type"},{"id":87,"kind":1024,"name":"messageTKey","url":"interfaces/selfserve_selfservetypes.onsaveresult.html#__type.__type-1.messagetkey","classes":"tsd-kind-property tsd-parent-kind-type-literal","parent":"SelfServe/SelfServeTypes.OnSaveResult.__type.__type"},{"id":88,"kind":256,"name":"RefreshResult","url":"interfaces/selfserve_selfservetypes.refreshresult.html","classes":"tsd-kind-interface tsd-parent-kind-module","parent":"SelfServe/SelfServeTypes"},{"id":89,"kind":1024,"name":"isUpdateInProgress","url":"interfaces/selfserve_selfservetypes.refreshresult.html#isupdateinprogress","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/SelfServeTypes.RefreshResult"},{"id":90,"kind":1024,"name":"updateInProgressMessageTKey","url":"interfaces/selfserve_selfservetypes.refreshresult.html#updateinprogressmessagetkey","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/SelfServeTypes.RefreshResult"},{"id":91,"kind":256,"name":"RefreshParams","url":"interfaces/selfserve_selfservetypes.refreshparams.html","classes":"tsd-kind-interface tsd-parent-kind-module","parent":"SelfServe/SelfServeTypes"},{"id":92,"kind":1024,"name":"retryIntervalInMs","url":"interfaces/selfserve_selfservetypes.refreshparams.html#retryintervalinms","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/SelfServeTypes.RefreshParams"},{"id":93,"kind":256,"name":"SelfServeTelemetryMessage","url":"interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html","classes":"tsd-kind-interface tsd-parent-kind-module","parent":"SelfServe/SelfServeTypes"},{"id":94,"kind":1024,"name":"selfServeClassName","url":"interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html#selfserveclassname","classes":"tsd-kind-property tsd-parent-kind-interface","parent":"SelfServe/SelfServeTypes.SelfServeTelemetryMessage"},{"id":95,"kind":1,"name":"SelfServe/SelfServeUtils","url":"modules/selfserve_selfserveutils.html","classes":"tsd-kind-module"},{"id":96,"kind":4,"name":"SelfServeType","url":"enums/selfserve_selfserveutils.selfservetype.html","classes":"tsd-kind-enum tsd-parent-kind-module","parent":"SelfServe/SelfServeUtils"},{"id":97,"kind":16,"name":"invalid","url":"enums/selfserve_selfserveutils.selfservetype.html#invalid","classes":"tsd-kind-enum-member tsd-parent-kind-enum","parent":"SelfServe/SelfServeUtils.SelfServeType"},{"id":98,"kind":16,"name":"example","url":"enums/selfserve_selfserveutils.selfservetype.html#example","classes":"tsd-kind-enum-member tsd-parent-kind-enum","parent":"SelfServe/SelfServeUtils.SelfServeType"},{"id":99,"kind":16,"name":"sqlx","url":"enums/selfserve_selfserveutils.selfservetype.html#sqlx","classes":"tsd-kind-enum-member tsd-parent-kind-enum","parent":"SelfServe/SelfServeUtils.SelfServeType"},{"id":100,"kind":4,"name":"BladeType","url":"enums/selfserve_selfserveutils.bladetype.html","classes":"tsd-kind-enum tsd-parent-kind-module","parent":"SelfServe/SelfServeUtils"},{"id":101,"kind":16,"name":"SqlKeys","url":"enums/selfserve_selfserveutils.bladetype.html#sqlkeys","classes":"tsd-kind-enum-member tsd-parent-kind-enum","parent":"SelfServe/SelfServeUtils.BladeType"},{"id":102,"kind":16,"name":"MongoKeys","url":"enums/selfserve_selfserveutils.bladetype.html#mongokeys","classes":"tsd-kind-enum-member tsd-parent-kind-enum","parent":"SelfServe/SelfServeUtils.BladeType"},{"id":103,"kind":16,"name":"CassandraKeys","url":"enums/selfserve_selfserveutils.bladetype.html#cassandrakeys","classes":"tsd-kind-enum-member tsd-parent-kind-enum","parent":"SelfServe/SelfServeUtils.BladeType"},{"id":104,"kind":16,"name":"GremlinKeys","url":"enums/selfserve_selfserveutils.bladetype.html#gremlinkeys","classes":"tsd-kind-enum-member tsd-parent-kind-enum","parent":"SelfServe/SelfServeUtils.BladeType"},{"id":105,"kind":16,"name":"TableKeys","url":"enums/selfserve_selfserveutils.bladetype.html#tablekeys","classes":"tsd-kind-enum-member tsd-parent-kind-enum","parent":"SelfServe/SelfServeUtils.BladeType"},{"id":106,"kind":16,"name":"Metrics","url":"enums/selfserve_selfserveutils.bladetype.html#metrics","classes":"tsd-kind-enum-member tsd-parent-kind-enum","parent":"SelfServe/SelfServeUtils.BladeType"},{"id":107,"kind":64,"name":"generateBladeLink","url":"modules/selfserve_selfserveutils.html#generatebladelink","classes":"tsd-kind-function tsd-parent-kind-module","parent":"SelfServe/SelfServeUtils"},{"id":108,"kind":1,"name":"SelfServe/SelfServeTelemetryProcessor","url":"modules/selfserve_selfservetelemetryprocessor.html","classes":"tsd-kind-module"},{"id":109,"kind":64,"name":"selfServeTrace","url":"modules/selfserve_selfservetelemetryprocessor.html#selfservetrace","classes":"tsd-kind-function tsd-parent-kind-module","parent":"SelfServe/SelfServeTelemetryProcessor"},{"id":110,"kind":64,"name":"selfServeTraceStart","url":"modules/selfserve_selfservetelemetryprocessor.html#selfservetracestart","classes":"tsd-kind-function tsd-parent-kind-module","parent":"SelfServe/SelfServeTelemetryProcessor"},{"id":111,"kind":64,"name":"selfServeTraceSuccess","url":"modules/selfserve_selfservetelemetryprocessor.html#selfservetracesuccess","classes":"tsd-kind-function tsd-parent-kind-module","parent":"SelfServe/SelfServeTelemetryProcessor"},{"id":112,"kind":64,"name":"selfServeTraceFailure","url":"modules/selfserve_selfservetelemetryprocessor.html#selfservetracefailure","classes":"tsd-kind-function tsd-parent-kind-module","parent":"SelfServe/SelfServeTelemetryProcessor"},{"id":113,"kind":64,"name":"selfServeTraceCancel","url":"modules/selfserve_selfservetelemetryprocessor.html#selfservetracecancel","classes":"tsd-kind-function tsd-parent-kind-module","parent":"SelfServe/SelfServeTelemetryProcessor"}],"index":{"version":"2.3.9","fields":["name","parent"],"fieldVectors":[["name/0",[0,38.825]],["parent/0",[]],["name/1",[0,14.915,1,16.905,2,16.905,3,16.905,4,16.905]],["parent/1",[]],["name/2",[5,22.504]],["parent/2",[]],["name/3",[6,44.005]],["parent/3",[5,2.17]],["name/4",[7,44.005]],["parent/4",[8,2.973]],["name/5",[9,44.005]],["parent/5",[8,2.973]],["name/6",[10,44.005]],["parent/6",[8,2.973]],["name/7",[11,44.005]],["parent/7",[8,2.973]],["name/8",[12,29.135]],["parent/8",[8,2.973]],["name/9",[13,44.005]],["parent/9",[5,2.17]],["name/10",[14,38.825]],["parent/10",[15,3.744]],["name/11",[12,29.135]],["parent/11",[15,3.744]],["name/12",[16,44.005]],["parent/12",[5,2.17]],["name/13",[17,44.005]],["parent/13",[18,3.415]],["name/14",[19,44.005]],["parent/14",[18,3.415]],["name/15",[12,29.135]],["parent/15",[18,3.415]],["name/16",[20,44.005]],["parent/16",[5,2.17]],["name/17",[21,44.005]],["parent/17",[22,3.415]],["name/18",[14,38.825]],["parent/18",[22,3.415]],["name/19",[12,29.135]],["parent/19",[22,3.415]],["name/20",[23,44.005]],["parent/20",[5,2.17]],["name/21",[12,29.135]],["parent/21",[24,3.415]],["name/22",[25,38.825]],["parent/22",[24,3.415]],["name/23",[26,44.005]],["parent/23",[24,3.415]],["name/24",[27,44.005]],["parent/24",[5,2.17]],["name/25",[28,44.005]],["parent/25",[5,2.17]],["name/26",[29,44.005]],["parent/26",[5,2.17]],["name/27",[30,44.005]],["parent/27",[5,2.17]],["name/28",[31,44.005]],["parent/28",[5,2.17]],["name/29",[32,44.005]],["parent/29",[5,2.17]],["name/30",[33,19.689]],["parent/30",[]],["name/31",[34,44.005]],["parent/31",[33,1.898]],["name/32",[35,23.35]],["parent/32",[36,4.243]],["name/33",[37,44.005]],["parent/33",[33,1.898]],["name/34",[35,23.35]],["parent/34",[38,4.243]],["name/35",[39,44.005]],["parent/35",[33,1.898]],["name/36",[40,44.005]],["parent/36",[41,2.973]],["name/37",[42,38.825]],["parent/37",[41,2.973]],["name/38",[43,44.005]],["parent/38",[41,2.973]],["name/39",[44,44.005]],["parent/39",[41,2.973]],["name/40",[35,23.35]],["parent/40",[41,2.973]],["name/41",[45,44.005]],["parent/41",[33,1.898]],["name/42",[35,23.35]],["parent/42",[46,4.243]],["name/43",[47,44.005]],["parent/43",[33,1.898]],["name/44",[48,44.005]],["parent/44",[49,3.744]],["name/45",[50,44.005]],["parent/45",[49,3.744]],["name/46",[51,44.005]],["parent/46",[33,1.898]],["name/47",[35,23.35]],["parent/47",[52,4.243]],["name/48",[12,29.135]],["parent/48",[53,3.744]],["name/49",[54,44.005]],["parent/49",[53,3.744]],["name/50",[55,44.005]],["parent/50",[33,1.898]],["name/51",[56,44.005]],["parent/51",[33,1.898]],["name/52",[57,32.864]],["parent/52",[58,3.415]],["name/53",[59,38.825]],["parent/53",[58,3.415]],["name/54",[35,23.35]],["parent/54",[58,3.415]],["name/55",[60,38.825]],["parent/55",[61,3.744]],["name/56",[62,35.413]],["parent/56",[61,3.744]],["name/57",[63,44.005]],["parent/57",[33,1.898]],["name/58",[64,44.005]],["parent/58",[65,3.415]],["name/59",[66,44.005]],["parent/59",[65,3.415]],["name/60",[67,44.005]],["parent/60",[65,3.415]],["name/61",[25,38.825]],["parent/61",[33,1.898]],["name/62",[62,35.413]],["parent/62",[68,3.169]],["name/63",[69,44.005]],["parent/63",[68,3.169]],["name/64",[59,38.825]],["parent/64",[68,3.169]],["name/65",[35,23.35]],["parent/65",[68,3.169]],["name/66",[60,38.825]],["parent/66",[70,3.744]],["name/67",[62,35.413]],["parent/67",[70,3.744]],["name/68",[71,44.005]],["parent/68",[33,1.898]],["name/69",[72,44.005]],["parent/69",[73,3.415]],["name/70",[74,44.005]],["parent/70",[73,3.415]],["name/71",[75,44.005]],["parent/71",[73,3.415]],["name/72",[76,44.005]],["parent/72",[33,1.898]],["name/73",[77,44.005]],["parent/73",[78,3.415]],["name/74",[79,44.005]],["parent/74",[78,3.415]],["name/75",[35,23.35]],["parent/75",[78,3.415]],["name/76",[42,38.825]],["parent/76",[80,2.809]],["name/77",[35,23.35]],["parent/77",[80,2.809]],["name/78",[81,35.413]],["parent/78",[82,2.809]],["name/79",[57,32.864]],["parent/79",[82,2.809]],["name/80",[83,44.005]],["parent/80",[80,2.809]],["name/81",[35,23.35]],["parent/81",[80,2.809]],["name/82",[81,35.413]],["parent/82",[82,2.809]],["name/83",[57,32.864]],["parent/83",[82,2.809]],["name/84",[84,44.005]],["parent/84",[80,2.809]],["name/85",[35,23.35]],["parent/85",[80,2.809]],["name/86",[81,35.413]],["parent/86",[82,2.809]],["name/87",[57,32.864]],["parent/87",[82,2.809]],["name/88",[85,44.005]],["parent/88",[33,1.898]],["name/89",[86,44.005]],["parent/89",[87,3.744]],["name/90",[88,44.005]],["parent/90",[87,3.744]],["name/91",[89,44.005]],["parent/91",[33,1.898]],["name/92",[90,44.005]],["parent/92",[91,4.243]],["name/93",[92,44.005]],["parent/93",[33,1.898]],["name/94",[93,44.005]],["parent/94",[94,4.243]],["name/95",[95,32.864]],["parent/95",[]],["name/96",[96,44.005]],["parent/96",[95,3.169]],["name/97",[97,44.005]],["parent/97",[98,3.415]],["name/98",[99,44.005]],["parent/98",[98,3.415]],["name/99",[100,44.005]],["parent/99",[98,3.415]],["name/100",[101,44.005]],["parent/100",[95,3.169]],["name/101",[102,44.005]],["parent/101",[103,2.809]],["name/102",[104,44.005]],["parent/102",[103,2.809]],["name/103",[105,44.005]],["parent/103",[103,2.809]],["name/104",[106,44.005]],["parent/104",[103,2.809]],["name/105",[107,44.005]],["parent/105",[103,2.809]],["name/106",[108,44.005]],["parent/106",[103,2.809]],["name/107",[109,44.005]],["parent/107",[95,3.169]],["name/108",[110,29.135]],["parent/108",[]],["name/109",[111,44.005]],["parent/109",[110,2.809]],["name/110",[112,44.005]],["parent/110",[110,2.809]],["name/111",[113,44.005]],["parent/111",[110,2.809]],["name/112",[114,44.005]],["parent/112",[110,2.809]],["name/113",[115,44.005]],["parent/113",[110,2.809]]],"invertedIndex":[["__type",{"_index":35,"name":{"32":{},"34":{},"40":{},"42":{},"47":{},"54":{},"65":{},"75":{},"77":{},"81":{},"85":{}},"parent":{}}],["bladetype",{"_index":101,"name":{"100":{}},"parent":{}}],["booleaninputoptions",{"_index":16,"name":{"12":{}},"parent":{}}],["cassandrakeys",{"_index":105,"name":{"103":{}},"parent":{}}],["choiceinputoptions",{"_index":20,"name":{"16":{}},"parent":{}}],["choiceitem",{"_index":51,"name":{"46":{}},"parent":{}}],["choices",{"_index":21,"name":{"17":{}},"parent":{}}],["constructor",{"_index":40,"name":{"36":{}},"parent":{}}],["currently",{"_index":3,"name":{"1":{}},"parent":{}}],["description",{"_index":25,"name":{"22":{},"61":{}},"parent":{}}],["descriptiondisplayoptions",{"_index":23,"name":{"20":{}},"parent":{}}],["descriptiontype",{"_index":63,"name":{"57":{}},"parent":{}}],["disabled",{"_index":75,"name":{"71":{}},"parent":{}}],["example",{"_index":99,"name":{"98":{}},"parent":{}}],["failure",{"_index":84,"name":{"84":{}},"parent":{}}],["falselabeltkey",{"_index":19,"name":{"14":{}},"parent":{}}],["generatebladelink",{"_index":109,"name":{"107":{}},"parent":{}}],["gremlinkeys",{"_index":106,"name":{"104":{}},"parent":{}}],["hidden",{"_index":74,"name":{"70":{}},"parent":{}}],["href",{"_index":60,"name":{"55":{},"66":{}},"parent":{}}],["info",{"_index":56,"name":{"51":{}},"parent":{}}],["infomessagebar",{"_index":66,"name":{"59":{}},"parent":{}}],["initialize",{"_index":42,"name":{"37":{},"76":{}},"parent":{}}],["initializecallback",{"_index":34,"name":{"31":{}},"parent":{}}],["inputoptions",{"_index":27,"name":{"24":{}},"parent":{}}],["inputtype",{"_index":55,"name":{"50":{}},"parent":{}}],["invalid",{"_index":97,"name":{"97":{}},"parent":{}}],["is",{"_index":2,"name":{"1":{}},"parent":{}}],["isdisplayable",{"_index":31,"name":{"28":{}},"parent":{}}],["isdynamicdescription",{"_index":26,"name":{"23":{}},"parent":{}}],["isupdateinprogress",{"_index":86,"name":{"89":{}},"parent":{}}],["key",{"_index":54,"name":{"49":{}},"parent":{}}],["labeltkey",{"_index":12,"name":{"8":{},"11":{},"15":{},"19":{},"21":{},"48":{}},"parent":{}}],["link",{"_index":59,"name":{"53":{},"64":{}},"parent":{}}],["max",{"_index":9,"name":{"5":{}},"parent":{}}],["messagetkey",{"_index":57,"name":{"52":{},"79":{},"83":{},"87":{}},"parent":{}}],["metrics",{"_index":108,"name":{"106":{}},"parent":{}}],["min",{"_index":7,"name":{"4":{}},"parent":{}}],["mongokeys",{"_index":104,"name":{"102":{}},"parent":{}}],["numberinputoptions",{"_index":6,"name":{"3":{}},"parent":{}}],["numberuitype",{"_index":47,"name":{"43":{}},"parent":{}}],["onchange",{"_index":28,"name":{"25":{}},"parent":{}}],["onchangecallback",{"_index":45,"name":{"41":{}},"parent":{}}],["onrefresh",{"_index":44,"name":{"39":{}},"parent":{}}],["onsave",{"_index":43,"name":{"38":{}},"parent":{}}],["onsavecallback",{"_index":37,"name":{"33":{}},"parent":{}}],["onsaveresult",{"_index":76,"name":{"72":{}},"parent":{}}],["operationstatusurl",{"_index":77,"name":{"73":{}},"parent":{}}],["placeholdertkey",{"_index":14,"name":{"10":{},"18":{}},"parent":{}}],["portalnotification",{"_index":79,"name":{"74":{}},"parent":{}}],["propertyinfo",{"_index":29,"name":{"26":{}},"parent":{}}],["refreshoptions",{"_index":32,"name":{"29":{}},"parent":{}}],["refreshparams",{"_index":89,"name":{"91":{}},"parent":{}}],["refreshresult",{"_index":85,"name":{"88":{}},"parent":{}}],["retryintervalinms",{"_index":90,"name":{"92":{}},"parent":{}}],["selfserve",{"_index":0,"name":{"0":{},"1":{}},"parent":{}}],["selfserve/decorators",{"_index":5,"name":{"2":{}},"parent":{"3":{},"9":{},"12":{},"16":{},"20":{},"24":{},"25":{},"26":{},"27":{},"28":{},"29":{}}}],["selfserve/decorators.booleaninputoptions",{"_index":18,"name":{},"parent":{"13":{},"14":{},"15":{}}}],["selfserve/decorators.choiceinputoptions",{"_index":22,"name":{},"parent":{"17":{},"18":{},"19":{}}}],["selfserve/decorators.descriptiondisplayoptions",{"_index":24,"name":{},"parent":{"21":{},"22":{},"23":{}}}],["selfserve/decorators.numberinputoptions",{"_index":8,"name":{},"parent":{"4":{},"5":{},"6":{},"7":{},"8":{}}}],["selfserve/decorators.stringinputoptions",{"_index":15,"name":{},"parent":{"10":{},"11":{}}}],["selfserve/selfservetelemetryprocessor",{"_index":110,"name":{"108":{}},"parent":{"109":{},"110":{},"111":{},"112":{},"113":{}}}],["selfserve/selfservetypes",{"_index":33,"name":{"30":{}},"parent":{"31":{},"33":{},"35":{},"41":{},"43":{},"46":{},"50":{},"51":{},"57":{},"61":{},"68":{},"72":{},"88":{},"91":{},"93":{}}}],["selfserve/selfservetypes.choiceitem",{"_index":52,"name":{},"parent":{"47":{}}}],["selfserve/selfservetypes.choiceitem.__type",{"_index":53,"name":{},"parent":{"48":{},"49":{}}}],["selfserve/selfservetypes.description",{"_index":68,"name":{},"parent":{"62":{},"63":{},"64":{},"65":{}}}],["selfserve/selfservetypes.description.__type",{"_index":70,"name":{},"parent":{"66":{},"67":{}}}],["selfserve/selfservetypes.descriptiontype",{"_index":65,"name":{},"parent":{"58":{},"59":{},"60":{}}}],["selfserve/selfservetypes.info",{"_index":58,"name":{},"parent":{"52":{},"53":{},"54":{}}}],["selfserve/selfservetypes.info.__type",{"_index":61,"name":{},"parent":{"55":{},"56":{}}}],["selfserve/selfservetypes.initializecallback",{"_index":36,"name":{},"parent":{"32":{}}}],["selfserve/selfservetypes.numberuitype",{"_index":49,"name":{},"parent":{"44":{},"45":{}}}],["selfserve/selfservetypes.onchangecallback",{"_index":46,"name":{},"parent":{"42":{}}}],["selfserve/selfservetypes.onsavecallback",{"_index":38,"name":{},"parent":{"34":{}}}],["selfserve/selfservetypes.onsaveresult",{"_index":78,"name":{},"parent":{"73":{},"74":{},"75":{}}}],["selfserve/selfservetypes.onsaveresult.__type",{"_index":80,"name":{},"parent":{"76":{},"77":{},"80":{},"81":{},"84":{},"85":{}}}],["selfserve/selfservetypes.onsaveresult.__type.__type",{"_index":82,"name":{},"parent":{"78":{},"79":{},"82":{},"83":{},"86":{},"87":{}}}],["selfserve/selfservetypes.refreshparams",{"_index":91,"name":{},"parent":{"92":{}}}],["selfserve/selfservetypes.refreshresult",{"_index":87,"name":{},"parent":{"89":{},"90":{}}}],["selfserve/selfservetypes.selfservebaseclass",{"_index":41,"name":{},"parent":{"36":{},"37":{},"38":{},"39":{},"40":{}}}],["selfserve/selfservetypes.selfservetelemetrymessage",{"_index":94,"name":{},"parent":{"94":{}}}],["selfserve/selfservetypes.smartuiinput",{"_index":73,"name":{},"parent":{"69":{},"70":{},"71":{}}}],["selfserve/selfserveutils",{"_index":95,"name":{"95":{}},"parent":{"96":{},"100":{},"107":{}}}],["selfserve/selfserveutils.bladetype",{"_index":103,"name":{},"parent":{"101":{},"102":{},"103":{},"104":{},"105":{},"106":{}}}],["selfserve/selfserveutils.selfservetype",{"_index":98,"name":{},"parent":{"97":{},"98":{},"99":{}}}],["selfservebaseclass",{"_index":39,"name":{"35":{}},"parent":{}}],["selfserveclassname",{"_index":93,"name":{"94":{}},"parent":{}}],["selfservetelemetrymessage",{"_index":92,"name":{"93":{}},"parent":{}}],["selfservetrace",{"_index":111,"name":{"109":{}},"parent":{}}],["selfservetracecancel",{"_index":115,"name":{"113":{}},"parent":{}}],["selfservetracefailure",{"_index":114,"name":{"112":{}},"parent":{}}],["selfservetracestart",{"_index":112,"name":{"110":{}},"parent":{}}],["selfservetracesuccess",{"_index":113,"name":{"111":{}},"parent":{}}],["selfservetype",{"_index":96,"name":{"96":{}},"parent":{}}],["slider",{"_index":50,"name":{"45":{}},"parent":{}}],["smartuiinput",{"_index":71,"name":{"68":{}},"parent":{}}],["spinner",{"_index":48,"name":{"44":{}},"parent":{}}],["sqlkeys",{"_index":102,"name":{"101":{}},"parent":{}}],["sqlx",{"_index":100,"name":{"99":{}},"parent":{}}],["step",{"_index":10,"name":{"6":{}},"parent":{}}],["stringinputoptions",{"_index":13,"name":{"9":{}},"parent":{}}],["success",{"_index":83,"name":{"80":{}},"parent":{}}],["supported",{"_index":4,"name":{"1":{}},"parent":{}}],["tablekeys",{"_index":107,"name":{"105":{}},"parent":{}}],["text",{"_index":64,"name":{"58":{}},"parent":{}}],["texttkey",{"_index":62,"name":{"56":{},"62":{},"67":{}},"parent":{}}],["titletkey",{"_index":81,"name":{"78":{},"82":{},"86":{}},"parent":{}}],["truelabeltkey",{"_index":17,"name":{"13":{}},"parent":{}}],["type",{"_index":69,"name":{"63":{}},"parent":{}}],["uitype",{"_index":11,"name":{"7":{}},"parent":{}}],["updateinprogressmessagetkey",{"_index":88,"name":{"90":{}},"parent":{}}],["value",{"_index":72,"name":{"69":{}},"parent":{}}],["values",{"_index":30,"name":{"27":{}},"parent":{}}],["warningmessagebar",{"_index":67,"name":{"60":{}},"parent":{}}],["what",{"_index":1,"name":{"1":{}},"parent":{}}]],"pipeline":[]}} \ No newline at end of file diff --git a/docs/classes/selfserve_selfservetypes.selfservebaseclass.html b/docs/classes/selfserve_selfservetypes.selfservebaseclass.html new file mode 100644 index 000000000..5cd632443 --- /dev/null +++ b/docs/classes/selfserve_selfservetypes.selfservebaseclass.html @@ -0,0 +1,306 @@ + + + + + + SelfServeBaseClass | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Class SelfServeBaseClass

+
+
+
+
+
+
+
+
+
+

All SelfServe feature classes need to derive from the SelfServeBaseClass

+
+
+
+
+

Hierarchy

+
    +
  • + SelfServeBaseClass +
    • +
+
+
+

Index

+
+
+
+

Constructors

+ +
+
+

Properties

+ +
+
+
+
+
+

Constructors

+
+ +

constructor

+ + +
+
+
+

Properties

+
+ +

Abstract initialize

+
initialize: initializeCallback
+ +
+
+

Sets default values for the properties of the Self Serve Class. Typically, you can make rest calls here + to fetch the initial values for the properties. This is also called after the onSave callback, to reinitialize the defaults.

+
+
+
+
+ +

Abstract onRefresh

+
onRefresh: () => Promise<RefreshResult>
+ +
+
+

Callback that is triggered when the refresh button is clicked. Here, you should perform the your rest API + call to check if the update action is completed.

+
+
+
+

Type declaration

+ +
+
+
+ +

Abstract onSave

+
onSave: onSaveCallback
+ +
+
+

Callback that is triggerred when the submit button is clicked. You should perform your rest API + calls here using the data from the different inputs passed as a Map to this callback function.

+
+
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/enums/selfserve_selfservetypes.descriptiontype.html b/docs/enums/selfserve_selfservetypes.descriptiontype.html new file mode 100644 index 000000000..ccce7d7c0 --- /dev/null +++ b/docs/enums/selfserve_selfservetypes.descriptiontype.html @@ -0,0 +1,245 @@ + + + + + + DescriptionType | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Enumeration DescriptionType

+
+
+
+
+
+
+
+

Index

+
+
+
+

Enumeration members

+ +
+
+
+
+
+

Enumeration members

+
+ +

InfoMessageBar

+
InfoMessageBar: = 1
+ +
+
+

Show the description as a Info Message bar.

+
+
+
+
+ +

Text

+
Text: = 0
+ +
+
+

Show the description as a text

+
+
+
+
+ +

WarningMessageBar

+
WarningMessageBar: = 2
+ +
+
+

Show the description as a Warning Message bar.

+
+
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/enums/selfserve_selfservetypes.numberuitype.html b/docs/enums/selfserve_selfservetypes.numberuitype.html new file mode 100644 index 000000000..28dcadc76 --- /dev/null +++ b/docs/enums/selfserve_selfservetypes.numberuitype.html @@ -0,0 +1,229 @@ + + + + + + NumberUiType | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Enumeration NumberUiType

+
+
+
+
+
+
+
+

Index

+
+
+
+

Enumeration members

+ +
+
+
+
+
+

Enumeration members

+
+ +

Slider

+
Slider: = "Slider"
+ +
+
+

The numeric input UI element corresponding to the property is a Slider

+
+
+
+
+ +

Spinner

+
Spinner: = "Spinner"
+ +
+
+

The numeric input UI element corresponding to the property is a Spinner

+
+
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/enums/selfserve_selfserveutils.bladetype.html b/docs/enums/selfserve_selfserveutils.bladetype.html new file mode 100644 index 000000000..9283b498f --- /dev/null +++ b/docs/enums/selfserve_selfserveutils.bladetype.html @@ -0,0 +1,264 @@ + + + + + + BladeType | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Enumeration BladeType

+
+
+
+
+
+
+
+
+
+

Portal Blade types

+
+
+
+
+

Index

+
+
+
+

Enumeration members

+ +
+
+
+
+
+

Enumeration members

+
+ +

CassandraKeys

+
CassandraKeys: = "cassandraDbKeys"
+ +
+
+

Keys blade of a Cassandra API account.

+
+
+
+
+ +

GremlinKeys

+
GremlinKeys: = "keys"
+ +
+
+

Keys blade of a Gremlin API account.

+
+
+
+
+ +

Metrics

+
Metrics: = "metrics"
+ +
+
+

Metrics blade of an Azure Cosmos DB account.

+
+
+
+
+ +

MongoKeys

+
MongoKeys: = "mongoDbKeys"
+ +
+
+

Keys blade of a Mongo API account.

+
+
+
+
+ +

SqlKeys

+
SqlKeys: = "keys"
+ +
+
+

Keys blade of a SQL API account.

+
+
+
+
+ +

TableKeys

+
TableKeys: = "tableKeys"
+ +
+
+

Keys blade of a Table API account.

+
+
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/enums/selfserve_selfserveutils.selfservetype.html b/docs/enums/selfserve_selfserveutils.selfservetype.html new file mode 100644 index 000000000..b291557ef --- /dev/null +++ b/docs/enums/selfserve_selfserveutils.selfservetype.html @@ -0,0 +1,201 @@ + + + + + + SelfServeType | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Enumeration SelfServeType

+
+
+
+
+
+
+
+
+
+

The type used to identify the Self Serve Class

+
+
+
+
+

Index

+
+
+
+

Enumeration members

+ +
+
+
+
+
+

Enumeration members

+
+ +

example

+
example: = "example"
+ +
+
+ +

invalid

+
invalid: = "invalid"
+ +
+
+ +

sqlx

+
sqlx: = "sqlx"
+ +
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/index.html b/docs/index.html new file mode 100644 index 000000000..f62e4c4f2 --- /dev/null +++ b/docs/index.html @@ -0,0 +1,209 @@ + + + + + + cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+

cosmos-explorer

+
+
+
+
+
+
+
+ +

Cosmos DB Explorer

+ +

UI for Azure Cosmos DB. Powers the Azure Portal, https://cosmos.azure.com/, and the Cosmos DB Emulator

+

+ +

Getting Started

+ +
    +
  • npm install
    • +
  • npm run build
    • +
+ +

Developing

+ + +

Watch mode

+ +

Run npm start to start the development server and automatically rebuild on changes

+ +

Hosted Development (https://cosmos.azure.com)

+ +
    +
  • Visit: https://localhost:1234/hostedExplorer.html
    • +
  • The default webpack dev server configuration will proxy requests to the production portal backend: https://main.documentdb.ext.azure.com. This will allow you to use production connection strings on your local machine.
    • +
+ +

Emulator Development

+ + + +

Setting up a Remote Emulator

+ +

The Cosmos emulator currently only runs in Windows environments. You can still develop on a non-Windows machine by setting up an emulator on a windows box and exposing its ports publicly:

+
    +

  1. Expose these ports publicly: 8081, 8900, 8979, 10250, 10251, 10252, 10253, 10254, 10255, 10256

    +
    2. +

  2. Download and install the emulator: https://docs.microsoft.com/en-us/azure/cosmos-db/local-emulator

    +
    3. +

  3. Start the emulator from PowerShell:

    +
    4. +
+ 
> cd C:/
+
+> .\CosmosDB.Emulator.exe -AllowNetworkAccess -Key="<EMULATOR MASTER KEY>"
+
+ +

Portal Development

+ + + +

Testing

+ + +

Unit Tests

+ +

Unit tests are located adjacent to the code under test and run with Jest:

+

npm run test

+ +

End to End CI Tests

+ +

Jest and Puppeteer are used for end to end browser based tests and are contained in test/. To run these tests locally:

+
    +
  1. Copy .env.example to .env
    2. +
  2. Update the values in .env including your local data explorer endpoint (ask a teammate/codeowner for help with .env values)
    3. +
  3. Make sure all packages are installed npm install
    4. +
  4. Run the server npm run start and wait for it to start
    5. +
  5. Run npm run test:e2e
    6. +
+ +

Releasing

+ +

We generally adhere to the release strategy documented by the Azure SDK Guidelines. Most releases should happen from the master branch. If master contains commits that cannot be released, you may create a release from a release/ or hotfix/ branch. See linked documentation for more details.

+ +

Architecture

+ +

+ +

Contributing

+ +

Please read the contribution guidelines.

+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/interfaces/selfserve_decorators.booleaninputoptions.html b/docs/interfaces/selfserve_decorators.booleaninputoptions.html new file mode 100644 index 000000000..d489484dc --- /dev/null +++ b/docs/interfaces/selfserve_decorators.booleaninputoptions.html @@ -0,0 +1,255 @@ + + + + + + BooleanInputOptions | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Interface BooleanInputOptions

+
+
+
+
+
+
+
+
+
+

Toggle is rendered.

+
+
+
+
+

Hierarchy

+
    +
  • + InputOptionsBase +
      +
    • + BooleanInputOptions +
      • +
    +
    • +
+
+
+

Index

+
+
+
+

Properties

+ +
+
+
+
+
+

Properties

+
+ +

falseLabelTKey

+
falseLabelTKey: string | (() => Promise<string>)
+ +
+
+

Key used to pickup the string corresponding to the false label of the toggle, from the strings JSON file.

+
+
+
+
+ +

labelTKey

+
labelTKey: string
+ +
+
+

Key used to pickup the string corresponding to the label of the UI element, from the strings JSON file.

+
+
+
+
+ +

trueLabelTKey

+
trueLabelTKey: string | (() => Promise<string>)
+ +
+
+

Key used to pickup the string corresponding to the true label of the toggle, from the strings JSON file.

+
+
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/interfaces/selfserve_decorators.choiceinputoptions.html b/docs/interfaces/selfserve_decorators.choiceinputoptions.html new file mode 100644 index 000000000..583e71512 --- /dev/null +++ b/docs/interfaces/selfserve_decorators.choiceinputoptions.html @@ -0,0 +1,255 @@ + + + + + + ChoiceInputOptions | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Interface ChoiceInputOptions

+
+
+
+
+
+
+
+
+
+

Dropdown is rendered.

+
+
+
+
+

Hierarchy

+
    +
  • + InputOptionsBase +
      +
    • + ChoiceInputOptions +
      • +
    +
    • +
+
+
+

Index

+
+
+
+

Properties

+ +
+
+
+
+
+

Properties

+
+ +

choices

+
choices: (() => Promise<ChoiceItem[]>) | ChoiceItem[]
+ +
+
+

Choices to be shown in the dropdown

+
+
+
+
+ +

labelTKey

+
labelTKey: string
+ +
+
+

Key used to pickup the string corresponding to the label of the UI element, from the strings JSON file.

+
+
+
+
+ +

Optional placeholderTKey

+
placeholderTKey: string | (() => Promise<string>)
+ +
+
+

Key used to pickup the string corresponding to the placeholder text of the dropdown, from the strings JSON file.

+
+
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/interfaces/selfserve_decorators.descriptiondisplayoptions.html b/docs/interfaces/selfserve_decorators.descriptiondisplayoptions.html new file mode 100644 index 000000000..1347ad4d1 --- /dev/null +++ b/docs/interfaces/selfserve_decorators.descriptiondisplayoptions.html @@ -0,0 +1,249 @@ + + + + + + DescriptionDisplayOptions | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Interface DescriptionDisplayOptions

+
+
+
+
+
+
+
+
+
+

Text is rendered.

+
+
+
+
+

Hierarchy

+
    +
  • + DescriptionDisplayOptions +
    • +
+
+
+

Index

+
+
+
+

Properties

+ +
+
+
+
+
+

Properties

+
+ +

Optional description

+
description: (() => Promise<Description>) | Description
+ +
+
+

Static description to be shown as text.

+
+
+
+
+ +

Optional isDynamicDescription

+
isDynamicDescription: boolean
+ +
+
+

If true, Indicates that the Description will be populated dynamically and that it may not be present in some scenarios.

+
+
+
+
+ +

Optional labelTKey

+
labelTKey: string
+ +
+
+

Optional heading for the text displayed by this description element.

+
+
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/interfaces/selfserve_decorators.numberinputoptions.html b/docs/interfaces/selfserve_decorators.numberinputoptions.html new file mode 100644 index 000000000..d99ddd07f --- /dev/null +++ b/docs/interfaces/selfserve_decorators.numberinputoptions.html @@ -0,0 +1,287 @@ + + + + + + NumberInputOptions | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Interface NumberInputOptions

+
+
+
+
+
+
+
+
+
+

Numeric input UI element is rendered. The current options are to render it as a slider or a spinner.

+
+
+
+
+

Hierarchy

+
    +
  • + InputOptionsBase +
      +
    • + NumberInputOptions +
      • +
    +
    • +
+
+
+

Index

+
+
+
+

Properties

+ +
+
+
+
+
+

Properties

+
+ +

labelTKey

+
labelTKey: string
+ +
+
+

Key used to pickup the string corresponding to the label of the UI element, from the strings JSON file.

+
+
+
+
+ +

max

+
max: number | (() => Promise<number>)
+ +
+
+

Max value of the numeric input UI element

+
+
+
+
+ +

min

+
min: number | (() => Promise<number>)
+ +
+
+

Min value of the numeric input UI element

+
+
+
+
+ +

step

+
step: number | (() => Promise<number>)
+ +
+
+

Value by which the numeric input is incremented or decremented in the UI.

+
+
+
+
+ +

uiType

+
uiType: NumberUiType
+ +
+
+

The type of the numeric input UI element

+
+
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/interfaces/selfserve_decorators.stringinputoptions.html b/docs/interfaces/selfserve_decorators.stringinputoptions.html new file mode 100644 index 000000000..a0424a0e6 --- /dev/null +++ b/docs/interfaces/selfserve_decorators.stringinputoptions.html @@ -0,0 +1,239 @@ + + + + + + StringInputOptions | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Interface StringInputOptions

+
+
+
+
+
+
+
+
+
+

Text box is rendered.

+
+
+
+
+

Hierarchy

+
    +
  • + InputOptionsBase +
      +
    • + StringInputOptions +
      • +
    +
    • +
+
+
+

Index

+
+
+
+

Properties

+ +
+
+
+
+
+

Properties

+
+ +

labelTKey

+
labelTKey: string
+ +
+
+

Key used to pickup the string corresponding to the label of the UI element, from the strings JSON file.

+
+
+
+
+ +

Optional placeholderTKey

+
placeholderTKey: string | (() => Promise<string>)
+ +
+
+

Key used to pickup the string corresponding to the place holder text of the text box, from the strings JSON file.

+
+
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/interfaces/selfserve_selfservetypes.description.html b/docs/interfaces/selfserve_selfservetypes.description.html new file mode 100644 index 000000000..f95fdcfcf --- /dev/null +++ b/docs/interfaces/selfserve_selfservetypes.description.html @@ -0,0 +1,277 @@ + + + + + + Description | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Interface Description

+
+
+
+
+
+
+
+
+
+

Data to be shown as a description.

+
+
+
+
+

Hierarchy

+
    +
  • + Description +
    • +
+
+
+

Index

+
+
+
+

Properties

+ +
+
+
+
+
+

Properties

+
+ +

Optional link

+
link: { href: string; textTKey: string }
+ +
+
+

Optional link to be shown as part of the description, after the text.

+
+
+
+

Type declaration

+
    +
  • +
    href: string
    +
    +
    +

    The URL of the link

    +
    +
    +
    • +
  • +
    textTKey: string
    +
    +
    +

    Key used to pickup the string corresponding to the text of the link, from the strings JSON file.

    +
    +
    +
    • +
+
+
+
+ +

textTKey

+
textTKey: string
+ +
+
+

Key used to pickup the string corresponding to the text to be shown as part of the description, from the strings JSON file.

+
+
+
+
+ +

type

+
type: DescriptionType
+ +
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/interfaces/selfserve_selfservetypes.info.html b/docs/interfaces/selfserve_selfservetypes.info.html new file mode 100644 index 000000000..c774dcc52 --- /dev/null +++ b/docs/interfaces/selfserve_selfservetypes.info.html @@ -0,0 +1,266 @@ + + + + + + Info | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Interface Info

+
+
+
+
+
+
+
+
+
+

Data to be shown within the info bubble of the property.

+
+
+
+
+

Hierarchy

+
    +
  • + Info +
    • +
+
+
+

Index

+
+
+
+

Properties

+ +
+
+
+
+
+

Properties

+
+ +

Optional link

+
link: { href: string; textTKey: string }
+ +
+
+

Optional link to be shown within the info bubble, after the text.

+
+
+
+

Type declaration

+
    +
  • +
    href: string
    +
    +
    +

    The URL of the link

    +
    +
    +
    • +
  • +
    textTKey: string
    +
    +
    +

    Key used to pickup the string corresponding to the text of the link, from the strings JSON file.

    +
    +
    +
    • +
+
+
+
+ +

messageTKey

+
messageTKey: string
+ +
+
+

Key used to pickup the string corresponding to the text to be shown within the info bubble, from the strings JSON file.

+
+
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/interfaces/selfserve_selfservetypes.onsaveresult.html b/docs/interfaces/selfserve_selfservetypes.onsaveresult.html new file mode 100644 index 000000000..45f6ffb36 --- /dev/null +++ b/docs/interfaces/selfserve_selfservetypes.onsaveresult.html @@ -0,0 +1,321 @@ + + + + + + OnSaveResult | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Interface OnSaveResult

+
+
+
+
+
+
+
+

Hierarchy

+
    +
  • + OnSaveResult +
    • +
+
+
+

Index

+
+
+
+

Properties

+ +
+
+
+
+
+

Properties

+
+ +

operationStatusUrl

+
operationStatusUrl: string
+ +
+
+

The polling url returned by the RP call.

+
+
+
+
+ +

Optional portalNotification

+
portalNotification: { failure: { messageTKey: string; titleTKey: string }; initialize: { messageTKey: string; titleTKey: string }; success: { messageTKey: string; titleTKey: string } }
+ +
+
+

Notifications that need to be shown on the portal for different stages of a scenario (initialized, success/failure).

+
+
+
+

Type declaration

+
    +
  • +
    failure: { messageTKey: string; titleTKey: string }
    +
    +
    +

    Notification that need to be shown when the save operation failed.

    +
    +
    +
      +
    • +
      messageTKey: string
      +
      +
      +

      Key used to pickup the string corresponding to the notification message, from the strings JSON file.

      +
      +
      +
      • +
    • +
      titleTKey: string
      +
      +
      +

      Key used to pickup the string corresponding to the notification title, from the strings JSON file.

      +
      +
      +
      • +
    +
    • +
  • +
    initialize: { messageTKey: string; titleTKey: string }
    +
    +
    +

    Notification that need to be shown when the save operation has been triggered.

    +
    +
    +
      +
    • +
      messageTKey: string
      +
      +
      +

      Key used to pickup the string corresponding to the notification message, from the strings JSON file.

      +
      +
      +
      • +
    • +
      titleTKey: string
      +
      +
      +

      Key used to pickup the string corresponding to the notification title, from the strings JSON file.

      +
      +
      +
      • +
    +
    • +
  • +
    success: { messageTKey: string; titleTKey: string }
    +
    +
    +

    Notification that need to be shown when the save operation has successfully completed.

    +
    +
    +
      +
    • +
      messageTKey: string
      +
      +
      +

      Key used to pickup the string corresponding to the notification message, from the strings JSON file.

      +
      +
      +
      • +
    • +
      titleTKey: string
      +
      +
      +

      Key used to pickup the string corresponding to the notification title, from the strings JSON file.

      +
      +
      +
      • +
    +
    • +
+
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/interfaces/selfserve_selfservetypes.refreshparams.html b/docs/interfaces/selfserve_selfservetypes.refreshparams.html new file mode 100644 index 000000000..c7815c97c --- /dev/null +++ b/docs/interfaces/selfserve_selfservetypes.refreshparams.html @@ -0,0 +1,222 @@ + + + + + + RefreshParams | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Interface RefreshParams

+
+
+
+
+
+
+
+

Hierarchy

+
    +
  • + RefreshParams +
    • +
+
+
+

Index

+
+
+
+

Properties

+ +
+
+
+
+
+

Properties

+
+ +

retryIntervalInMs

+
retryIntervalInMs: number
+ +
+
+

The time interval between refresh attempts when an update in ongoing

+
+
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/interfaces/selfserve_selfservetypes.refreshresult.html b/docs/interfaces/selfserve_selfservetypes.refreshresult.html new file mode 100644 index 000000000..41159e1de --- /dev/null +++ b/docs/interfaces/selfserve_selfservetypes.refreshresult.html @@ -0,0 +1,239 @@ + + + + + + RefreshResult | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Interface RefreshResult

+
+
+
+
+
+
+
+

Hierarchy

+
    +
  • + RefreshResult +
    • +
+
+
+

Index

+
+
+
+

Properties

+ +
+
+
+
+
+

Properties

+
+ +

isUpdateInProgress

+
isUpdateInProgress: boolean
+ +
+
+

Indicate if the update is still ongoing

+
+
+
+
+ +

updateInProgressMessageTKey

+
updateInProgressMessageTKey: string
+ +
+
+

Key used to pickup the string corresponding to the message that will be shown on the UI if the update is still ongoing, from the strings JSON file. + Will be shown only if isUpdateInProgress is true.

+
+
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html b/docs/interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html new file mode 100644 index 000000000..200ea0c44 --- /dev/null +++ b/docs/interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html @@ -0,0 +1,227 @@ + + + + + + SelfServeTelemetryMessage | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Interface SelfServeTelemetryMessage

+
+
+
+
+
+
+
+

Hierarchy

+
    +
  • + TelemetryData +
      +
    • + SelfServeTelemetryMessage +
      • +
    +
    • +
+
+
+

Index

+
+
+
+

Properties

+ +
+
+
+
+
+

Properties

+
+ +

selfServeClassName

+
selfServeClassName: string
+ +
+
+

The className used to identify a SelfServe telemetry record

+
+
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/interfaces/selfserve_selfservetypes.smartuiinput.html b/docs/interfaces/selfserve_selfservetypes.smartuiinput.html new file mode 100644 index 000000000..ad6416a34 --- /dev/null +++ b/docs/interfaces/selfserve_selfservetypes.smartuiinput.html @@ -0,0 +1,254 @@ + + + + + + SmartUiInput | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Interface SmartUiInput

+
+
+
+
+
+
+
+

Hierarchy

+
    +
  • + SmartUiInput +
    • +
+
+
+

Index

+
+
+
+

Properties

+ +
+
+
+
+
+

Properties

+
+ +

Optional disabled

+
disabled: boolean
+ +
+
+

Indicates whether the UI element corresponding to the property is disabled

+
+
+
+
+ +

Optional hidden

+
hidden: boolean
+ +
+
+

Indicates whether the UI element corresponding to the property is hidden

+
+
+
+
+ +

value

+
value: InputType
+ +
+
+

The value to be set for the UI element corresponding to the property

+
+
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/modules.html b/docs/modules.html new file mode 100644 index 000000000..923454972 --- /dev/null +++ b/docs/modules.html @@ -0,0 +1,138 @@ + + + + + + cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+

cosmos-explorer

+
+
+
+
+
+
+
+

Index

+
+
+
+

Modules

+ +
+
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/modules/selfserve.html b/docs/modules/selfserve.html new file mode 100644 index 000000000..6e5a4c6a6 --- /dev/null +++ b/docs/modules/selfserve.html @@ -0,0 +1,498 @@ + + + + + + SelfServe | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Module SelfServe

+
+
+
+
+
+
+
+
+
+ +

Self Serve Model

+ +

The Self Serve Model allows you to write classes that auto generate UI components for your feature. The idea is to allow developers from other feature teams, who may not be familiar with writing UI, to develop and own UX components. This is accomplished by just writing simpler TypeScript classes for their features.

+

What this means for the feature team

+
    +
  • Can concentrate just on the logic behind showing, hiding and disabling UI components
    • +
  • Need not worry about specifics of the UI language or UX requirements (Accessibility, Localization, Themes, etc.)
    • +
  • Can own the REST API calls made as part of the feature, which can change in the future
    • +
  • Quicker turn around time for development and bug fixes since they have deeper knowledge of the feature
    • +
+

What this means for the UI team

+
    +
  • No need to ramp up on the intricacies of every feature which requires UI changes
    • +
  • Own only the framework and not every feature, giving more bandwidth to prioritize inhouse features as well
    • +
+ +

Getting Started

+ +

Clone the cosmos-explorer repo and run

+
    +
  • npm install
    • +
  • npm run build
    • +
+

Click here for more info on setting up the cosmos-explorer repo.

+ +

Code Changes

+ +

Code changes need to be made only in the following files

+
    +
  • A JSON file - for strings to be displayed
    • +
  • A Types File - for defining the data models
    • +
  • A RP file - for defining the REST calls
    • +
  • A Class file - for defining the UI
    • +
  • SelfServeUtils.tsx and SelfServe.tsx - for defning the entrypoint for the UI
    • +
+ +

1. JSON file for UI strings

+ + +

Naming Convention

+ +

Localization/en/<FEATURE_NAME>.json
Please place your files only under "Localization/en" folder. If not, the UI strings will not be picked up by the framework.

+ +

Example

+ +

SelfServeExample.json

+ +

Description

+ +

This is a JSON file where the values are the strings that needs to be displayed in the UI. These strings are referenced using their corresponding unique keys.

+

For example, If your class file defines properties as follows

+ 
  @Values({
+    labelTKey: "stringPropertylabel"
+  })
+  stringProperty: string;
+
+  @Values({
+    labelTKey: "booleanPropertyLabel",
+    trueLabelTKey: "trueLabel",
+    falseLabelTKey: "falseLabel",
+  })
+  booleanProperty: boolean;
+
+

Then the content of Localization/en/FeatureName.json should be

+ 
{
+    stringPropertyLabel: "string property",
+    booleanPropertyLabel: "boolean property",
+    trueLabel: "Enable",
+    falseLabel: "Disable"
+}
+
+

You can learn more on how to define the class file here.

+ +

2. Types file

+ + +

Naming Convention

+ +

<FEATURE_NAME>.types.ts

+ +

Example

+ +

SelfServeExample.types.ts

+ +

Description

+ +

This file contains the definitions of all the data models to be used in your Class file and RP file.

+

For example, if your RP call takes/returns the stringProperty and booleanProperty of your SelfServe class, then you can define an interface in your FeatureName.types.ts file like this.

+ 
export RpDataModel {
+  stringProperty: string,
+  booleanProperty: boolean
+}
+
+ +

3. RP file

+ + +

Naming Convention

+ +

<FEATURE_NAME>.rp.ts

+ +

Example

+ +

SelfServeExample.rp.ts

+ +

Description

+ +

The RP file will host the REST calls needed for the initialize, save and refresh functions. This decouples the view and the model of the feature.

+

To make the ARM call, we need some information about the Azure Cosmos DB databaseAccount - the subscription id, resource group name and database account name. These are readily available through the userContext object, exposed through

+
    +
  • userContext.subscriptionId
    • +
  • userContext.resourceGroup
    • +
  • userContext.databaseAccount.name
    • +
+

You can use the armRequestWithoutPolling function to make the ARM api call.

+

Your FeatureName.rp.ts file can look like the following.

+ 
import { userContext } from "../../UserContext";
+import { armRequestWithoutPolling } from "../../Utils/arm/request";
+import { configContext } from "../../ConfigContext";
+
+const apiVersion = "2020-06-01-preview";
+
+export const saveData = async (properties: RpDataModel): Promise<string> => {
+  const path = `/subscriptions/${userContext.subscriptionId}/resourceGroups/${userContext.resourceGroup}/providers/Microsoft.DocumentDB/databaseAccounts/${userContext.databaseAccount.name}/<REST_OF_THE_PATH>`
+  const body = {
+      data : properties
+  }
+  const armRequestResult = await armRequestWithoutPolling({
+    host: configContext.ARM_ENDPOINT,
+    path,
+    method: "PUT",
+    apiVersion,
+    body,
+  });
+
+  return armRequestResult.operationStatusUrl;
+};
+
+
+ +

4. Class file

+ + +

Naming Convention

+ +

<FEATURE_NAME>.tsx

+ +

Example

+ +

SelfServeExample.tsx

+ +

Description

+ +

This file will contain the actual code that is translated into the UI component by the Self Serve framework.

+
    +

  • Each Self Serve class

    +
      +
    • Needs to extends the SelfServeBase class.
      • +
    • Needs to have the @IsDisplayable() decorator to tell the compiler that UI needs to be generated from this class.
      • +
    • Needs to define an initialize() function, to set default values for the inputs.
      • +
    • Needs to define an onSave() function, a callback for when the save button is clicked.
      • +
    • Needs to define an onRefresh() function, a callback for when the refresh button is clicked.
      • +
    • Can have an optional @RefreshOptions() decorator that determines how often the auto refresh of the UI component should take place.
      • +
    +
    • +

  • For every UI element needed, add a property to the Self Serve class. Each of these properties

    +
      +
    • Needs to have a @Values() decorator.
      • +
    • Can have an optional @PropertyInfo() decorator that describes it's info bubble.
      • +
    • Can have an optional @OnChange() decorator that dictates the effects of the change of the UI element tied to this property.
      • +
    +
    • +
+

Your FeatureName.tsx file will look like the following.

+ 
@IsDisplayable()
+@RefreshOptions({ retryIntervalInMs: 2000 })
+export default class FeatureName extends SelfServeBaseClass {
+
+  public initialize = async (): Promise<Map<string, SmartUiInput>> => {
+      // initialize RP call and processing logic
+  }
+
+  public onSave = async (
+    currentValues: Map<string, SmartUiInput>,
+    baselineValues: ReadonlyMap<string, SmartUiInput>
+  ): Promise<OnSaveResult> => {
+      // onSave RP call and processing logic
+  }
+
+  public onRefresh = async (): Promise<RefreshResult> => {
+      // refresh RP call and processing logic
+  };
+
+  @Values(...)
+  stringProperty: string;
+
+  @OnChange(...)
+  @PropertyInfo(...)
+  @Values(...)
+  booleanProperty: boolean;
+}
+
+ +

5. Update SelfServeType

+ +

Once you have written your Self Serve Class, add a corresponding type to SelfServeType

+ 
export enum SelfServeType {
+  invalid = "invalid",
+  example = "example",
+  ...
+  // Add the type for your new feature
+  featureName = "featurename"
+}
+
+ +

6. Update SelfServe.tsx (landing page)

+ +

Once the SelfServeType has been updated, update SelfServe.tsx for your feature. This ensures that the framework picks up your SelfServe Class.

+ 
const getDescriptor = async (selfServeType: SelfServeType): Promise<SelfServeDescriptor> => {
+  switch (selfServeType) {
+    case SelfServeType.example: {
+        ....
+    }
+    ...
+    ...
+    ...
+    // Add this for your new feature
+    case SelfServeType.featureName: {
+      // The 'webpackChunkName' is used during debugging, to identify if the correct class has been loaded
+      const FeatureName = await import(/* webpackChunkName: "FeatureName" */ "./FeatureName/FeatureName");
+      const featureName = new FeatureName.default();
+      await loadTranslations(featureName.constructor.name);
+      return featureName.toSelfServeDescriptor();
+    }
+    ...
+    ...
+    default:
+      return undefined;
+  }
+};
+
+
+ +

Telemetry

+ +

You can add telemetry for your feature using the functions in SelfServeTelemetryProcessor

+

For example, in your SelfServe class, you can call the trace method in your onSave function.

+ 
import { saveData } from "./FeatureName.rp"
+import { RpDataModel } from "./FeatureName.types"
+
+@IsDisplayable()
+export default class FeatureName extends SelfServeBaseClass {
+
+  .
+  .
+  .
+
+  public onSave = async (
+    currentValues: Map<string, SmartUiInput>,
+    baselineValues: ReadonlyMap<string, SmartUiInput>
+  ): Promise<OnSaveResult> => {
+
+    stringPropertyValue = currentValues.get("stringProperty")
+    booleanPropertyValue = currentValues.get("booleanProperty")
+    
+    const propertiesToSave : RpDataModel = { 
+      stringProperty: stringPropertyValue,
+      booleanProperty: booleanPropertyValue
+    }
+    const telemetryData = { ...propertiesToSave, selfServeClassName: FeatureName.name }
+    const onSaveTimeStamp = selfServeTraceStart(telemetryData)
+
+    await saveData(propertiesToSave)
+
+    selfServeTraceSuccess(telemetryData, onSaveTimeStamp)
+
+    // return required values
+  }
+
+  .
+  .
+  .
+
+  @Values(...)
+  stringProperty: string;
+
+  @Values(...)
+  booleanProperty: boolean;
+}
+
+ +

Portal Notifications

+ +

You can enable portal notifications for your feature by passing in the required strings as part of the portalNotification property of the onSaveResult.

+ 
@IsDisplayable()
+export default class SqlX extends SelfServeBaseClass {
+
+.
+.
+.
+
+  public onSave = async (
+      currentValues: Map<string, SmartUiInput>,
+      baselineValues: Map<string, SmartUiInput>
+  ): Promise<OnSaveResult> => {
+
+    stringPropertyValue = currentValues.get("stringProperty")
+    booleanPropertyValue = currentValues.get("booleanProperty")
+    
+    const propertiesToSave : RpDataModel = { 
+      stringProperty: stringPropertyValue,
+      booleanProperty: booleanPropertyValue
+    }
+
+    const operationStatusUrl = await saveData(propertiesToSave);
+    return {
+      operationStatusUrl: operationStatusUrl,
+      portalNotification: {
+        initialize: {
+          titleTKey: "DeleteInitializeTitle",
+          messageTKey: "DeleteInitializeMessage",
+        },
+        success: {
+          titleTKey: "DeleteSuccessTitle",
+          messageTKey: "DeleteSuccesseMessage",
+        },
+        failure: {
+          titleTKey: "DeleteFailureTitle",
+          messageTKey: "DeleteFailureMessage",
+        },
+      },
+    };
+  }
+
+  .
+  .
+  .
+
+  @Values(...)
+  stringProperty: string;
+
+  @Values(...)
+  booleanProperty: boolean;
+}
+
+ +

Execution

+ + +

Watch mode

+ +

Run npm start to start the development server and automatically rebuild on changes

+ +

Local Development

+ +

Ensure that you have made the Code changes.

+
    +
  • Go to https://ms.portal.azure.com/
    • +
  • Add the query string feature.showSelfServeExample=true&feature.selfServeSource=https://localhost:1234/selfServe.html?selfServeType%3D<SELF_SERVE_TYPE>
    • +
  • Click on the Self Serve Example menu item on the left panel.
    • +
+

For example, if you want to open up the the UI of a class with the type sqlx, then visit https://ms.portal.azure.com/?feature.showSelfServeExample=true&feature.selfServeSource=https://localhost:1234/selfServe.html?selfServeType%3Dsqlx

+

+
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/modules/selfserve___what_is_currently_supported_.html b/docs/modules/selfserve___what_is_currently_supported_.html new file mode 100644 index 000000000..e044d593f --- /dev/null +++ b/docs/modules/selfserve___what_is_currently_supported_.html @@ -0,0 +1,149 @@ + + + + + + SelfServe - What is currently supported? | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Module SelfServe - What is currently supported?

+
+
+
+
+
+
+
+
+
+

The Self Serve framework has integrated support for

+
    +
  1. Portal Notifications
    2. +
  2. Telemetry
    3. +
  3. the following UI controls: +
    4. +
+
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/modules/selfserve_decorators.html b/docs/modules/selfserve_decorators.html new file mode 100644 index 000000000..2605197ce --- /dev/null +++ b/docs/modules/selfserve_decorators.html @@ -0,0 +1,341 @@ + + + + + + SelfServe/Decorators | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Module SelfServe/Decorators

+
+
+
+
+
+
+
+

Index

+
+
+
+

Interfaces

+ +
+
+

Type aliases

+ +
+
+

Functions

+ +
+
+
+
+
+

Type aliases

+
+ +

InputOptions

+
InputOptions: NumberInputOptions | StringInputOptions | BooleanInputOptions | ChoiceInputOptions | DescriptionDisplayOptions
+ +
+
+

Interprets the type of the UI element and correspondingly renders

+
    +
  • slider or spinner
    • +
  • text box
    • +
  • toggle
    • +
  • drop down
    • +
  • plain text or message bar
    • +
+
+
+
+
+
+

Functions

+
+ +

Const IsDisplayable

+
    +
  • IsDisplayable(): ClassDecorator
    • +
+
    +
  • + +
    +
    +

    Indicates to the compiler that UI should be generated from this class.

    +
    +
    +

    Returns ClassDecorator

    +
    • +
+
+
+ +

Const OnChange

+ +
    +
  • + +
    +
    +

    Indicates the callback to be fired when the UI element corresponding to the property is changed.

    +
    +
    +

    Parameters

    + +

    Returns PropertyDecorator

    +
    • +
+
+
+ +

Const PropertyInfo

+
    +
  • PropertyInfo(info: Info | (() => Promise<Info>)): PropertyDecorator
    • +
+
    +
  • + +
    +
    +

    Indicates that the UI element corresponding to the property should have an Info bubble. The Info + bubble is the icon that looks like an "i" which users click on to get more information about the UI element.

    +
    +
    +

    Parameters

    +
      +
    • +
      info: Info | (() => Promise<Info>)
      +
      • +
    +

    Returns PropertyDecorator

    +
    • +
+
+
+ +

Const RefreshOptions

+
    +
  • RefreshOptions(refreshParams: RefreshParams): ClassDecorator
    • +
+
    +
  • + +
    +
    +

    If there is a long running operation in your page after the onSave action, the page can + optionally auto refresh itself using the onRefresh action. The 'RefreshOptions' indicate + how often the auto refresh of the page occurs.

    +
    +
    +

    Parameters

    + +

    Returns ClassDecorator

    +
    • +
+
+
+ +

Const Values

+ +
    +
  • + +
    +
    +

    Indicates that this property should correspond to a UI element with the given parameters.

    +
    +
    +

    Parameters

    + +

    Returns PropertyDecorator

    +
    • +
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/modules/selfserve_selfservetelemetryprocessor.html b/docs/modules/selfserve_selfservetelemetryprocessor.html new file mode 100644 index 000000000..b70d893a9 --- /dev/null +++ b/docs/modules/selfserve_selfservetelemetryprocessor.html @@ -0,0 +1,323 @@ + + + + + + SelfServe/SelfServeTelemetryProcessor | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Module SelfServe/SelfServeTelemetryProcessor

+
+
+
+
+
+
+
+

Index

+
+
+
+

Functions

+ +
+
+
+
+
+

Functions

+
+ +

Const selfServeTrace

+ +
    +
  • + +
    +
    +

    Log an action.

    +
    +
    +

    Parameters

    + +

    Returns void

    +
    • +
+
+
+ +

Const selfServeTraceCancel

+ +
    +
  • + +
    +
    +

    Log an action as cancelled.

    +
    +
    +

    Parameters

    +
      +
    • +
      data: SelfServeTelemetryMessage
      +
      +

      Data to be sent as part of the Self Serve Telemetry.

      +
      +
      • +
    • +
      Optional timestamp: number
      +
      +

      Timestamp of the action's start trace.

      +
      +
      • +
    +

    Returns void

    +
    • +
+
+
+ +

Const selfServeTraceFailure

+ +
    +
  • + +
    +
    +

    Log an action as a failure.

    +
    +
    +

    Parameters

    +
      +
    • +
      data: SelfServeTelemetryMessage
      +
      +

      Data to be sent as part of the Self Serve Telemetry.

      +
      +
      • +
    • +
      Optional timestamp: number
      +
      +

      Timestamp of the action's start trace.

      +
      +
      • +
    +

    Returns void

    +
    • +
+
+
+ +

Const selfServeTraceStart

+ +
    +
  • + +
    +
    +

    Start logging an action.

    +
    +
    +

    Parameters

    + +

    Returns number

    +

    Timestamp of the trace start, that can be used in other trace actions. + The timestamp is used to identify all the logs associated with an action.

    +
    • +
+
+
+ +

Const selfServeTraceSuccess

+ +
    +
  • + +
    +
    +

    Log an action as a success.

    +
    +
    +

    Parameters

    +
      +
    • +
      data: SelfServeTelemetryMessage
      +
      +

      Data to be sent as part of the Self Serve Telemetry.

      +
      +
      • +
    • +
      Optional timestamp: number
      +
      +

      Timestamp of the action's start trace.

      +
      +
      • +
    +

    Returns void

    +
    • +
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/modules/selfserve_selfservetypes.html b/docs/modules/selfserve_selfservetypes.html new file mode 100644 index 000000000..7edda26ee --- /dev/null +++ b/docs/modules/selfserve_selfservetypes.html @@ -0,0 +1,363 @@ + + + + + + SelfServe/SelfServeTypes | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Module SelfServe/SelfServeTypes

+
+
+
+
+
+
+
+

Index

+
+
+
+

Enumerations

+ +
+
+

Classes

+ +
+
+

Interfaces

+ +
+
+

Type aliases

+ +
+
+
+
+
+

Type aliases

+
+ +

ChoiceItem

+
ChoiceItem: { key: string; labelTKey: string }
+ +
+

Type declaration

+
    +
  • +
    key: string
    +
    +
    +

    Key used to pickup the string that uniquely identifies the dropdown choice item, from the strings JSON file.

    +
    +
    +
    • +
  • +
    labelTKey: string
    +
    +
    +

    Key used to pickup the string corresponding to the label of the dropdown choice item, from the strings JSON file.

    +
    +
    +
    • +
+
+
+
+ +

InputType

+
InputType: number | string | boolean | ChoiceItem | Description
+ +
+
+ +

OnChangeCallback

+
OnChangeCallback: (newValue: InputType, currentValues: Map<string, SmartUiInput>, baselineValues: ReadonlyMap<string, SmartUiInput>) => Map<string, SmartUiInput>
+ +
+
+

Function that dictates how the overall UI should transform when the UI element corresponding to a property, say prop1, is changed. + The callback can be used to
* Change the value (and reflect it in the UI) for another property, say prop2
* Change the visibility for prop2 in the UI
* Disable or enable the UI element corresponding to prop2
depending on logic based on the newValue of prop1, the currentValues Map and baselineValues Map.

+
+
+
+

Type declaration

+
    +
  • + +
      +
    • +

      Parameters

      +
        +
      • +
        newValue: InputType
        +
        +

        The newValue that the property needs to be set to, after the change in the UI element corresponding to this property.

        +
        +
        • +
      • +
        currentValues: Map<string, SmartUiInput>
        +
        +

        The map of propertyName => SmartUiInput corresponding to the current state of the UI.

        +
        +
        • +
      • +
        baselineValues: ReadonlyMap<string, SmartUiInput>
        +
        +

        The map of propertyName => SmartUiInput corresponding to the initial state of the UI.

        +
        +
        • +
      +

      Returns Map<string, SmartUiInput>

      +

      A new Map of propertyName => SmartUiInput corresponding to the new state of the overall UI

      +
      • +
    +
    • +
+
+
+
+ +

initializeCallback

+
initializeCallback: () => Promise<Map<string, SmartUiInput>>
+ +
+

Type declaration

+
    +
  • + +
      +
    • +

      Returns Promise<Map<string, SmartUiInput>>

      +

      Promise of Map of propertyName => SmartUiInput which will become the current state of the UI.

      +
      • +
    +
    • +
+
+
+
+ +

onSaveCallback

+
onSaveCallback: (currentValues: Map<string, SmartUiInput>, baselineValues: ReadonlyMap<string, SmartUiInput>) => Promise<OnSaveResult>
+ +
+

Type declaration

+ +
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/docs/modules/selfserve_selfserveutils.html b/docs/modules/selfserve_selfserveutils.html new file mode 100644 index 000000000..6dcb66f55 --- /dev/null +++ b/docs/modules/selfserve_selfserveutils.html @@ -0,0 +1,185 @@ + + + + + + SelfServe/SelfServeUtils | cosmos-explorer + + + + + + +
+
+
+
+ +
+
+ Options +
+
+ All +
    +
  • Public
    • +
  • Public/Protected
    • +
  • All
    • +
+
+ + + + +
+
+ Menu +
+
+
+
+
+
+ +

Module SelfServe/SelfServeUtils

+
+
+
+
+
+
+
+

Index

+
+
+
+

Enumerations

+ +
+
+

Functions

+ +
+
+
+
+
+

Functions

+
+ +

Const generateBladeLink

+
    +
  • generateBladeLink(blade: BladeType): string
    • +
+
    +
  • + +
    +
    +

    Generate the URL corresponding to the portal blade for the current Azure Cosmos DB account

    +
    +
    +

    Parameters

    + +

    Returns string

    +
    • +
+
+
+
+
+ + +
+
+
+ +
+

Generated using TypeDoc

+
+
+ + + \ No newline at end of file diff --git a/externals/iframeResizer.contentWindow.min.js b/externals/iframeResizer.contentWindow.min.js new file mode 100644 index 000000000..f711ae4fe --- /dev/null +++ b/externals/iframeResizer.contentWindow.min.js @@ -0,0 +1,10 @@ +/*! iFrame Resizer (iframeSizer.contentWindow.min.js) - v4.3.1 - 2021-01-11 + * Desc: Include this file in any page being loaded into an iframe + * to force the iframe to resize to the content size. + * Requires: iframeResizer.min.js on host page. + * Copyright: (c) 2021 David J. Bradshaw - dave@bradshaw.net + * License: MIT + */ + +!function(u){if("undefined"!=typeof window){var n=!0,o=10,i="",r=0,a="",t=null,c="",s=!1,d={resize:1,click:1},l=128,f=!0,m=1,h="bodyOffset",g=h,p=!0,v="",y={},w=32,b=null,T=!1,E=!1,O="[iFrameSizer]",S=O.length,M="",I={max:1,min:1,bodyScroll:1,documentElementScroll:1},N="child",A=!0,C=window.parent,z="*",k=0,R=!1,e=null,x=16,L=1,F="scroll",P=F,D=window,j=function(){ae("onMessage function not defined")},q=function(){},H=function(){},W={height:function(){return ae("Custom height calculation function not defined"),document.documentElement.offsetHeight},width:function(){return ae("Custom width calculation function not defined"),document.body.scrollWidth}},B={},J=!1;try{var U=Object.create({},{passive:{get:function(){J=!0}}});window.addEventListener("test",te,U),window.removeEventListener("test",te,U)}catch(e){}var V,X,Y,K,Q,G,Z=Date.now||function(){return(new Date).getTime()},$={bodyOffset:function(){return document.body.offsetHeight+ve("marginTop")+ve("marginBottom")},offset:function(){return $.bodyOffset()},bodyScroll:function(){return document.body.scrollHeight},custom:function(){return W.height()},documentElementOffset:function(){return document.documentElement.offsetHeight},documentElementScroll:function(){return document.documentElement.scrollHeight},max:function(){return Math.max.apply(null,we($))},min:function(){return Math.min.apply(null,we($))},grow:function(){return $.max()},lowestElement:function(){return Math.max($.bodyOffset()||$.documentElementOffset(),ye("bottom",Te()))},taggedElement:function(){return be("bottom","data-iframe-height")}},_={bodyScroll:function(){return document.body.scrollWidth},bodyOffset:function(){return document.body.offsetWidth},custom:function(){return W.width()},documentElementScroll:function(){return document.documentElement.scrollWidth},documentElementOffset:function(){return document.documentElement.offsetWidth},scroll:function(){return Math.max(_.bodyScroll(),_.documentElementScroll())},max:function(){return Math.max.apply(null,we(_))},min:function(){return Math.min.apply(null,we(_))},rightMostElement:function(){return ye("right",Te())},taggedElement:function(){return be("right","data-iframe-width")}},ee=(V=Ee,Q=null,G=0,function(){var e=Z(),t=x-(e-(G=G||e));return X=this,Y=arguments,t<=0||x/test/**/*.spec.[jt]s?(x)"], - setupFiles: ["dotenv/config"], -}; diff --git a/jest.config.js b/jest.config.js index 5151e71c7..889b544e0 100644 --- a/jest.config.js +++ b/jest.config.js @@ -21,17 +21,13 @@ module.exports = { collectCoverage: true, // An array of glob patterns indicating a set of files for which coverage information should be collected - // collectCoverageFrom: [ - // "src/Common/Headers*" - // ], + collectCoverageFrom: ["src/**/*.{js,jsx,ts,tsx}"], // The directory where Jest should output its coverage files coverageDirectory: "coverage", // An array of regexp pattern strings used to skip coverage collection - // coveragePathIgnorePatterns: [ - // "/node_modules/" - // ], + coveragePathIgnorePatterns: ["/node_modules/"], // A list of reporter names that Jest uses when writing coverage reports coverageReporters: ["json", "text", "cobertura"], @@ -39,10 +35,10 @@ module.exports = { // An object that configures minimum threshold enforcement for coverage results coverageThreshold: { global: { - branches: 22, - functions: 28, - lines: 33, - statements: 31, + branches: 25, + functions: 25, + lines: 30, + statements: 30, }, }, @@ -71,9 +67,10 @@ module.exports = { // A map from regular expressions to module names that allow to stub out resources with a single module moduleNameMapper: { - "^.*[.](svg|png|gif|less)$": "/mockModule", - "worker-loader": "/mockModule", - "office-ui-fabric-react/lib/(.*)$": "office-ui-fabric-react/lib-commonjs/$1", // https://github.com/OfficeDev/office-ui-fabric-react/wiki/Fabric-6-Release-Notes + "^.*[.](svg|png|gif|less|css)$": "/mockModule", + "@nteract/stateful-components/(.*)$": "/mockModule", + "@fluentui/react/lib/(.*)$": "@fluentui/react/lib-commonjs/$1", // https://github.com/microsoft/fluentui/wiki/Version-8-release-notes + "monaco-editor/(.*)$": "/__mocks__/monaco-editor", "^dnd-core$": "dnd-core/dist/cjs", "^react-dnd$": "react-dnd/dist/cjs", "^react-dnd-html5-backend$": "react-dnd-html5-backend/dist/cjs", diff --git a/jest.config.playwright.js b/jest.config.playwright.js new file mode 100644 index 000000000..c452a5368 --- /dev/null +++ b/jest.config.playwright.js @@ -0,0 +1,7 @@ +module.exports = { + preset: "jest-playwright-preset", + testMatch: ["/test/**/*.spec.[jt]s?(x)"], + setupFiles: ["dotenv/config"], + testEnvironment: "./test/playwrightEnv.js", + setupFilesAfterEnv: ["expect-playwright"], +}; diff --git a/less/Common/Constants.less b/less/Common/Constants.less index 8039450b4..50bdd7d91 100644 --- a/less/Common/Constants.less +++ b/less/Common/Constants.less @@ -4,7 +4,7 @@ @font-face { font-family: wf_segoe-ui_normal; - src: url("../../fonts/segoe-ui/west-european/normal/latest.woff"); + src: local("Segoe UI"), url("../../fonts/segoe-ui/west-european/normal/latest.woff"); } @DataExplorerFont: wf_segoe-ui_normal, "Segoe UI", "Segoe WP", Tahoma, Arial, sans-serif; diff --git a/less/documentDB.less b/less/documentDB.less index 72ed44c00..271f53992 100644 --- a/less/documentDB.less +++ b/less/documentDB.less @@ -718,51 +718,30 @@ execute-sproc-params-pane { } } -stored-procedure-tab { +.stored-procedure-tab { @ToggleHeight: 30px; @ToggleWidth: 180px; .results-container, .errors-container { - padding: @MediumSpace 0px 0px @MediumSpace; height: 100%; .flex-display(); .flex-direction(); overflow: hidden; - .toggles { - height: @ToggleHeight; - width: @ToggleWidth; - margin-left: @MediumSpace; - - &:focus { - .focus(); - } - - .tab { - margin-right: @MediumSpace; - } - - .toggleSwitch { - .toggleSwitch(); - } - - .selectedToggle { - .selectedToggle(); - } - - .unselectedToggle { - .unselectedToggle(); - } - } - .enterInputParameters { padding: @LargeSpace @MediumSpace; } + + div[role="tabpanel"] { + height: 100%; + padding-bottom: 50px; + } } .errors-container { padding-left: (2 * @MediumSpace); + padding: @MediumSpace 0px 0px @MediumSpace; .errors-header { font-weight: 700; font-size: @DefaultFontSize; @@ -1757,7 +1736,7 @@ input::-webkit-calendar-picker-indicator { cursor: pointer; } -.contextual-pane .paneMainContent { +.paneMainContent { flex: 1; padding-left: 34px; padding-right: 34px; @@ -3085,3 +3064,14 @@ settings-pane { padding-left: @SmallSpace; } } +.hiddenMain { + display: none; + height: 0px; +} +.spinner { + width: 100%; + position: absolute; + z-index: 1; + background: white; + height: 100%; +} diff --git a/less/forms.less b/less/forms.less index ba771a108..572134c26 100644 --- a/less/forms.less +++ b/less/forms.less @@ -200,4 +200,12 @@ .migration:disabled { background-color: #ccc; +} + +.trigger-field { + width: 40%; + margin-top: 10px +} +.trigger-form { + padding: 10px 30px 10px 30px; } \ No newline at end of file diff --git a/less/resourceTree.less b/less/resourceTree.less index cac3f049f..39bced9da 100644 --- a/less/resourceTree.less +++ b/less/resourceTree.less @@ -2,6 +2,7 @@ .dataResourceTree { margin-left: @MediumSpace; + overflow: auto; .databaseHeader { font-size: 14px; diff --git a/less/tree.less b/less/tree.less index 56a5ee38e..ed0fbf71f 100644 --- a/less/tree.less +++ b/less/tree.less @@ -1,272 +1,270 @@ @import "./Common/Constants"; - .resourceTree { + height: 100%; + flex: 0 0 auto; + .main { height: 100%; - flex: 0 0 auto; - .main { - height: 100%; - } + } } .resourceTreeScroll { - height: 100%; - display: flex; - overflow-y: auto; - overflow-x: hidden; - padding-right: 10px; + height: 100%; + display: flex; + overflow-y: auto; + overflow-x: hidden; + padding-right: 10px; } .userSelectNone { - -webkit-user-select: none; - -moz-user-select: none; - -ms-user-select: none; + -webkit-user-select: none; + -moz-user-select: none; + -ms-user-select: none; } .treeHovermargin { - margin-left: 16px; + margin-left: 16px; } .highlight { - padding: @SmallSpace 2px; - outline: 0; + padding: @SmallSpace 2px; + outline: 0; - &:hover { - .hover(); - } + &:hover { + .hover(); + } - &:active { - .active(); - } + &:active { + .active(); + } - &:focus { - .focus(); - } + &:focus { + .focus(); + } } .contextmenushowing { - background-color: #EEE; + background-color: #eee; } .collectionstree { - width: 100%; - margin-top: @DefaultSpace; + width: 100%; + margin-top: @DefaultSpace; + .databaseList { + list-style-type: none; + padding-left: 0px; - .databaseList { - list-style-type: none; - padding-left: 0px; - - .collectionList { - padding-left:(2 * @MediumSpace); - } - - .collectionChildList { - padding-left: @LargeSpace; - } - - .databaseDocuments { - padding-left: (5 * @MediumSpace); - } + .collectionList { + padding-left: (2 * @MediumSpace); } + + .collectionChildList { + padding-left: @LargeSpace; + } + + .databaseDocuments { + padding-left: (5 * @MediumSpace); + } + } } .pointerCursor { - cursor: pointer; + cursor: pointer; } .menuEllipsis { - padding-right: 6px; - font-weight: bold; - font-size: 18px; - position: relative; - top: -5px; - left: 0px; - float: right; - display: none; - padding-left: 6px!important; - line-height: @TreeLineHeight; + padding-right: 6px; + font-weight: bold; + font-size: 18px; + position: relative; + top: -5px; + left: 0px; + float: right; + display: none; + padding-left: 6px !important; + line-height: @TreeLineHeight; } .databaseMenu { - .flex-display(); + .flex-display(); } .databaseMenu:hover .menuEllipsis, .databaseMenu:focus .menuEllipsis { - display: block; + display: block; } .databaseCollChildTextOverflow { - text-overflow: ellipsis; - white-space: nowrap; - overflow: hidden; - flex: 1; + text-overflow: ellipsis; + white-space: nowrap; + overflow: hidden; + flex: 1; } .collectionMenu { - .flex-display(); + .flex-display(); } .collectionMenu:hover .menuEllipsis, .collectionMenu:focus .menuEllipsis { - display: block; + display: block; } .documentsMenu:hover .menuEllipsis, .documentsMenu:focus .menuEllipsis { - display: block; + display: block; } .treeChildMenu { - display: flex; + display: flex; } .storedProcedureMenu:hover .menuEllipsis, .storedProcedureMenu:focus .menuEllipsis { - display: block; + display: block; } .childMenu { - overflow: hidden; - text-overflow: ellipsis; - white-space: nowrap; - padding-left: (6 * @MediumSpace); - width: 100%; + overflow: hidden; + text-overflow: ellipsis; + white-space: nowrap; + padding-left: (6 * @MediumSpace); + width: 100%; } .storedChildMenu:hover .menuEllipsis, .storedChildMenu:focus .menuEllipsis { - display: block; + display: block; } .contextmenu6 { - top: -29px; + top: -29px; } .userDefinedMenu:hover .contextmenu6 { - display: block; + display: block; } .userDefinedchildMenu:hover .menuEllipsis, .userDefinedchildMenu:focus .menuEllipsis { - display: block; + display: block; } .triggersMenu:hover .menuEllipsis, .triggersMenu:focus .menuEllipsis { - display: block; + display: block; } .triggersChildMenu:hover .menuEllipsis, .triggersChildMenu:focus .menuEllipsis { - display: block; + display: block; } .databaseId { - font-size: 14px; + font-size: 14px; } .storedUdfTriggerMenu { - padding-left: 0px; + padding-left: 0px; } .collectionstree img { - width: 16px; - height: 16px; - vertical-align: text-top; + width: 16px; + height: 16px; + vertical-align: text-top; } img.collectionsTreeCollapseExpand { - width: 10px; - height: 10px; - vertical-align: middle; - margin-bottom: 5px; + width: 10px; + height: 10px; + vertical-align: middle; + margin-bottom: 5px; } .collapsed::before { - content: "\23F5"; - margin-left: 0px; - font-size: 15px; + content: "\23F5"; + margin-left: 0px; + font-size: 15px; } .expanded::before { - content: '\23F7'; - margin-left: 0px; - font-size: 15px; + content: "\23F7"; + margin-left: 0px; + font-size: 15px; } .collectionMenuChildren { - padding-left: 42px; + padding-left: 42px; } .main-nav { - width: 100vh; - height: 40px; - background: white; - transform-origin: left top; - -webkit-transform-origin: left top; - -ms-transform-origin: left top; - transform: rotate(-90deg) translateX(-100%); - -webkit-transform: rotate(-90deg) translateX(-100%); - -ms-transform: rotate(-90deg) translateX(-100%); - border-bottom: 1px solid #CCC; + width: 100vh; + height: 40px; + background: white; + transform-origin: left top; + -webkit-transform-origin: left top; + -ms-transform-origin: left top; + transform: rotate(-90deg) translateX(-100%); + -webkit-transform: rotate(-90deg) translateX(-100%); + -ms-transform: rotate(-90deg) translateX(-100%); + border-bottom: 1px solid #ccc; } .main-nav-img { - width: 16px; - height: 16px; - margin: -32px 0 0 0; - transform: rotate(-90deg) translateX(-100%); - -webkit-transform: rotate(-90deg) translateX(-100%); - -ms-transform: rotate(-90deg) translateX(-100%); + width: 16px; + height: 16px; + margin: -32px 0 0 0; + transform: rotate(-90deg) translateX(-100%); + -webkit-transform: rotate(-90deg) translateX(-100%); + -ms-transform: rotate(-90deg) translateX(-100%); } .main-nav-img.main-nav-sub-img { - width: 16px; - height: 16px; - margin: 0px 0px 0 0; - transform: rotate(180deg) translateX(0%); - -webkit-transform: rotate(180deg) translateX(0%); - -ms-transform: rotate(180deg) translateX(0%); - position: absolute; - right: -8px; - top: 16px; + width: 16px; + height: 16px; + margin: 0px 0px 0 0; + transform: rotate(180deg) translateX(0%); + -webkit-transform: rotate(180deg) translateX(0%); + -ms-transform: rotate(180deg) translateX(0%); + position: absolute; + right: -8px; + top: 16px; } ul.nav { - margin: 0 auto; - margin-top: 0px; - margin-left: 0px; + margin: 0 auto; + margin-top: 0px; + margin-left: 0px; } .mini ul.nav li { - float: right; - line-height: 25px; - height: auto; - margin-top: 3px; + float: right; + line-height: 25px; + height: auto; + margin-top: 3px; } .spancolchildstyle { - padding: 4px; + padding: 4px; } .contextmenubutton { - float: right; - display: none; + float: right; + display: none; } -.highlight:hover>.contextmenubutton { - display: unset; +.highlight:hover > .contextmenubutton { + display: unset; } -.highlight:hover>.contextmenubutton::after { - content: "\2026"; - font-size: 12px; +.highlight:hover > .contextmenubutton::after { + content: "\2026"; + font-size: 12px; } .showEllipsis { - text-overflow: ellipsis; - white-space: nowrap; - overflow: hidden; -} \ No newline at end of file + text-overflow: ellipsis; + white-space: nowrap; + overflow: hidden; +} diff --git a/package-lock.json b/package-lock.json index 01f5a2c47..79d3475da 100644 --- a/package-lock.json +++ b/package-lock.json @@ -117,27 +117,41 @@ } }, "@azure/cosmos": { - "version": "3.9.0", - "resolved": "https://registry.npmjs.org/@azure/cosmos/-/cosmos-3.9.0.tgz", - "integrity": "sha512-SA+QB54I8Dvg/ZolHpsEDLK/sbSB9sFmSU1ElnMTFw88TVik+LYHq4o/srU2TY6Gr1BketjPmgLVEqrmnRvjkw==", + "version": "3.10.5", + "resolved": "https://registry.npmjs.org/@azure/cosmos/-/cosmos-3.10.5.tgz", + "integrity": "sha512-if1uApYNjNXzB+reNFvzEBHvinxdQOzU8fni9e9Fs9jcPv9m76t2pzmYJNrxxCiFLP0vbNr/QCfQzIPQVw6v/A==", "requires": { - "@types/debug": "^4.1.4", + "@azure/core-auth": "^1.2.0", "debug": "^4.1.1", "fast-json-stable-stringify": "^2.0.0", "jsbi": "^3.1.3", - "node-abort-controller": "^1.0.4", + "node-abort-controller": "^1.2.0", "node-fetch": "^2.6.0", - "os-name": "^3.1.0", "priorityqueuejs": "^1.0.0", "semaphore": "^1.0.5", "tslib": "^2.0.0", - "uuid": "^8.1.0" + "universal-user-agent": "^6.0.0", + "uuid": "^8.3.0" }, "dependencies": { + "@azure/core-auth": { + "version": "1.3.0", + "resolved": "https://registry.npmjs.org/@azure/core-auth/-/core-auth-1.3.0.tgz", + "integrity": "sha512-kSDSZBL6c0CYdhb+7KuutnKGf2geeT+bCJAgccB0DD7wmNJSsQPcF7TcuoZX83B7VK4tLz/u+8sOO/CnCsYp8A==", + "requires": { + "@azure/abort-controller": "^1.0.0", + "tslib": "^2.0.0" + } + }, "tslib": { - "version": "2.1.0", - "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.1.0.tgz", - "integrity": "sha512-hcVC3wYEziELGGmEEXue7D75zbwIIVUMWAVbHItGPx0ziyXxrOMQx4rQEVEV45Ut/1IotuEvwqPopzIOkDMf0A==" + "version": "2.2.0", + "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.2.0.tgz", + "integrity": "sha512-gS9GVHRU+RGn5KQM2rllAlR3dU6m7AcpJKdtH8gFvQiC4Otgk98XnmMU+nZenHt/+VhnBPWwgrJsyrdcw6i23w==" + }, + "universal-user-agent": { + "version": "6.0.0", + "resolved": "https://registry.npmjs.org/universal-user-agent/-/universal-user-agent-6.0.0.tgz", + "integrity": "sha512-isyNax3wXoKaulPDZWHQqbmIx1k2tb9fb3GGDBRxCscfYV2Ch7WxPArBsFEG8s/safwXTT7H4QGhaIkTp9447w==" }, "uuid": { "version": "8.3.2", @@ -218,6 +232,11 @@ } } }, + "@azure/ms-rest-azure-env": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/@azure/ms-rest-azure-env/-/ms-rest-azure-env-2.0.0.tgz", + "integrity": "sha512-dG76W7ElfLi+fbTjnZVGj+M9e0BIEJmRxU6fHaUQ12bZBe8EJKYb2GV50YWNaP2uJiVQ5+7nXEVj1VN1UQtaEw==" + }, "@azure/ms-rest-azure-js": { "version": "2.1.0", "resolved": "https://registry.npmjs.org/@azure/ms-rest-azure-js/-/ms-rest-azure-js-2.1.0.tgz", @@ -246,6 +265,34 @@ "xml2js": "^0.4.19" } }, + "@azure/ms-rest-nodeauth": { + "version": "3.0.7", + "resolved": "https://registry.npmjs.org/@azure/ms-rest-nodeauth/-/ms-rest-nodeauth-3.0.7.tgz", + "integrity": "sha512-7Q1MyMB+eqUQy8JO+virSIzAjqR2UbKXE/YQZe+53gC8yakm8WOQ5OzGfPP+eyHqeRs6bQESyw2IC5feLWlT2A==", + "requires": { + "@azure/ms-rest-azure-env": "^2.0.0", + "@azure/ms-rest-js": "^2.0.4", + "adal-node": "^0.1.28" + } + }, + "@azure/msal-browser": { + "version": "2.14.2", + "resolved": "https://registry.npmjs.org/@azure/msal-browser/-/msal-browser-2.14.2.tgz", + "integrity": "sha512-JKHE9Rer41CI8tweiyE91M8ZbGvQV9P+jOPB4ZtPxyxCi2f7ED3jNfdzyUJ1eGB+hCRnvO56M1Xc61T1R+JfYg==", + "requires": { + "@azure/msal-common": "^4.3.0" + }, + "dependencies": { + "@azure/msal-common": { + "version": "4.3.0", + "resolved": "https://registry.npmjs.org/@azure/msal-common/-/msal-common-4.3.0.tgz", + "integrity": "sha512-jFqUWe83wVb6O8cNGGBFg2QlKvqM1ezUgJTEV7kIsAPX0RXhGFE4B1DLNt6hCnkTXDbw+KGW0zgxOEr4MJQwLw==", + "requires": { + "debug": "^4.1.1" + } + } + } + }, "@azure/msal-common": { "version": "1.7.2", "resolved": "https://registry.npmjs.org/@azure/msal-common/-/msal-common-1.7.2.tgz", @@ -281,17 +328,17 @@ } }, "@babel/code-frame": { - "version": "7.12.11", - "resolved": "https://registry.npmjs.org/@babel/code-frame/-/code-frame-7.12.11.tgz", - "integrity": "sha512-Zt1yodBx1UcyiePMSkWnU4hPqhwq7hGi2nFL1LeA3EUl+q2LQx16MISgJ0+z7dnmgvP9QtIleuETGOiOH1RcIw==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/code-frame/-/code-frame-7.12.13.tgz", + "integrity": "sha512-HV1Cm0Q3ZrpCR93tkWOYiuYIgLxZXZFVG2VgK+MBWjUqZTundupbfx2aXarXuw5Ko5aMcjtJgbSs4vUGBS5v6g==", "requires": { - "@babel/highlight": "^7.10.4" + "@babel/highlight": "^7.12.13" } }, "@babel/compat-data": { - "version": "7.12.7", - "resolved": "https://registry.npmjs.org/@babel/compat-data/-/compat-data-7.12.7.tgz", - "integrity": "sha512-YaxPMGs/XIWtYqrdEOZOCPsVWfEoriXopnsz3/i7apYPXQ3698UFhS6dVT1KN5qOsWmVgw/FOrmQgpRaZayGsw==", + "version": "7.13.8", + "resolved": "https://registry.npmjs.org/@babel/compat-data/-/compat-data-7.13.8.tgz", + "integrity": "sha512-EaI33z19T4qN3xLXsGf48M2cDqa6ei9tPZlfLdb2HC+e/cFtREiRd8hdSqDbwdLB0/+gLwqJmCYASH0z2bUdog==", "dev": true }, "@babel/core": { @@ -319,152 +366,349 @@ } }, "@babel/generator": { - "version": "7.12.11", - "resolved": "https://registry.npmjs.org/@babel/generator/-/generator-7.12.11.tgz", - "integrity": "sha512-Ggg6WPOJtSi8yYQvLVjG8F/TlpWDlKx0OpS4Kt+xMQPs5OaGYWy+v1A+1TvxI6sAMGZpKWWoAQ1DaeQbImlItA==", + "version": "7.13.9", + "resolved": "https://registry.npmjs.org/@babel/generator/-/generator-7.13.9.tgz", + "integrity": "sha512-mHOOmY0Axl/JCTkxTU6Lf5sWOg/v8nUa+Xkt4zMTftX0wqmb6Sh7J8gvcehBw7q0AhrhAR+FDacKjCZ2X8K+Sw==", "requires": { - "@babel/types": "^7.12.11", + "@babel/types": "^7.13.0", "jsesc": "^2.5.1", "source-map": "^0.5.0" + }, + "dependencies": { + "@babel/types": { + "version": "7.13.14", + "resolved": "https://registry.npmjs.org/@babel/types/-/types-7.13.14.tgz", + "integrity": "sha512-A2aa3QTkWoyqsZZFl56MLUsfmh7O0gN41IPvXAE/++8ojpbz12SszD7JEGYVdn4f9Kt4amIei07swF1h4AqmmQ==", + "requires": { + "@babel/helper-validator-identifier": "^7.12.11", + "lodash": "^4.17.19", + "to-fast-properties": "^2.0.0" + } + } } }, "@babel/helper-annotate-as-pure": { - "version": "7.12.10", - "resolved": "https://registry.npmjs.org/@babel/helper-annotate-as-pure/-/helper-annotate-as-pure-7.12.10.tgz", - "integrity": "sha512-XplmVbC1n+KY6jL8/fgLVXXUauDIB+lD5+GsQEh6F6GBF1dq1qy4DP4yXWzDKcoqXB3X58t61e85Fitoww4JVQ==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/helper-annotate-as-pure/-/helper-annotate-as-pure-7.12.13.tgz", + "integrity": "sha512-7YXfX5wQ5aYM/BOlbSccHDbuXXFPxeoUmfWtz8le2yTkTZc+BxsiEnENFoi2SlmA8ewDkG2LgIMIVzzn2h8kfw==", "requires": { - "@babel/types": "^7.12.10" + "@babel/types": "^7.12.13" + }, + "dependencies": { + "@babel/types": { + "version": "7.13.14", + "resolved": "https://registry.npmjs.org/@babel/types/-/types-7.13.14.tgz", + "integrity": "sha512-A2aa3QTkWoyqsZZFl56MLUsfmh7O0gN41IPvXAE/++8ojpbz12SszD7JEGYVdn4f9Kt4amIei07swF1h4AqmmQ==", + "requires": { + "@babel/helper-validator-identifier": "^7.12.11", + "lodash": "^4.17.19", + "to-fast-properties": "^2.0.0" + } + } } }, "@babel/helper-builder-binary-assignment-operator-visitor": { - "version": "7.10.4", - "resolved": "https://registry.npmjs.org/@babel/helper-builder-binary-assignment-operator-visitor/-/helper-builder-binary-assignment-operator-visitor-7.10.4.tgz", - "integrity": "sha512-L0zGlFrGWZK4PbT8AszSfLTM5sDU1+Az/En9VrdT8/LmEiJt4zXt+Jve9DCAnQcbqDhCI+29y/L93mrDzddCcg==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/helper-builder-binary-assignment-operator-visitor/-/helper-builder-binary-assignment-operator-visitor-7.12.13.tgz", + "integrity": "sha512-CZOv9tGphhDRlVjVkAgm8Nhklm9RzSmWpX2my+t7Ua/KT616pEzXsQCjinzvkRvHWJ9itO4f296efroX23XCMA==", "dev": true, "requires": { - "@babel/helper-explode-assignable-expression": "^7.10.4", - "@babel/types": "^7.10.4" + "@babel/helper-explode-assignable-expression": "^7.12.13", + "@babel/types": "^7.12.13" + }, + "dependencies": { + "@babel/types": { + "version": "7.13.14", + "resolved": "https://registry.npmjs.org/@babel/types/-/types-7.13.14.tgz", + "integrity": "sha512-A2aa3QTkWoyqsZZFl56MLUsfmh7O0gN41IPvXAE/++8ojpbz12SszD7JEGYVdn4f9Kt4amIei07swF1h4AqmmQ==", + "dev": true, + "requires": { + "@babel/helper-validator-identifier": "^7.12.11", + "lodash": "^4.17.19", + "to-fast-properties": "^2.0.0" + } + } } }, "@babel/helper-compilation-targets": { - "version": "7.12.5", - "resolved": "https://registry.npmjs.org/@babel/helper-compilation-targets/-/helper-compilation-targets-7.12.5.tgz", - "integrity": "sha512-+qH6NrscMolUlzOYngSBMIOQpKUGPPsc61Bu5W10mg84LxZ7cmvnBHzARKbDoFxVvqqAbj6Tg6N7bSrWSPXMyw==", + "version": "7.13.10", + "resolved": "https://registry.npmjs.org/@babel/helper-compilation-targets/-/helper-compilation-targets-7.13.10.tgz", + "integrity": "sha512-/Xju7Qg1GQO4mHZ/Kcs6Au7gfafgZnwm+a7sy/ow/tV1sHeraRUHbjdat8/UvDor4Tez+siGKDk6zIKtCPKVJA==", "dev": true, "requires": { - "@babel/compat-data": "^7.12.5", - "@babel/helper-validator-option": "^7.12.1", + "@babel/compat-data": "^7.13.8", + "@babel/helper-validator-option": "^7.12.17", "browserslist": "^4.14.5", - "semver": "^5.5.0" + "semver": "^6.3.0" + }, + "dependencies": { + "semver": { + "version": "6.3.0", + "resolved": "https://registry.npmjs.org/semver/-/semver-6.3.0.tgz", + "integrity": "sha512-b39TBaTSfV6yBrapU89p5fKekE2m/NwnDocOVruQFS1/veMgdzuPcnOM34M6CwxW8jH/lxEa5rBoDeUwu5HHTw==", + "dev": true + } } }, "@babel/helper-create-class-features-plugin": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/helper-create-class-features-plugin/-/helper-create-class-features-plugin-7.12.1.tgz", - "integrity": "sha512-hkL++rWeta/OVOBTRJc9a5Azh5mt5WgZUGAKMD8JM141YsE08K//bp1unBBieO6rUKkIPyUE0USQ30jAy3Sk1w==", + "version": "7.13.10", + "resolved": "https://registry.npmjs.org/@babel/helper-create-class-features-plugin/-/helper-create-class-features-plugin-7.13.10.tgz", + "integrity": "sha512-YV7r2YxdTUaw84EwNkyrRke/TJHR/UXGiyvACRqvdVJ2/syV2rQuJNnaRLSuYiop8cMRXOgseTGoJCWX0q2fFg==", "requires": { - "@babel/helper-function-name": "^7.10.4", - "@babel/helper-member-expression-to-functions": "^7.12.1", - "@babel/helper-optimise-call-expression": "^7.10.4", - "@babel/helper-replace-supers": "^7.12.1", - "@babel/helper-split-export-declaration": "^7.10.4" + "@babel/helper-function-name": "^7.12.13", + "@babel/helper-member-expression-to-functions": "^7.13.0", + "@babel/helper-optimise-call-expression": "^7.12.13", + "@babel/helper-replace-supers": "^7.13.0", + "@babel/helper-split-export-declaration": "^7.12.13" } }, "@babel/helper-create-regexp-features-plugin": { - "version": "7.12.7", - "resolved": "https://registry.npmjs.org/@babel/helper-create-regexp-features-plugin/-/helper-create-regexp-features-plugin-7.12.7.tgz", - "integrity": "sha512-idnutvQPdpbduutvi3JVfEgcVIHooQnhvhx0Nk9isOINOIGYkZea1Pk2JlJRiUnMefrlvr0vkByATBY/mB4vjQ==", + "version": "7.12.17", + "resolved": "https://registry.npmjs.org/@babel/helper-create-regexp-features-plugin/-/helper-create-regexp-features-plugin-7.12.17.tgz", + "integrity": "sha512-p2VGmBu9oefLZ2nQpgnEnG0ZlRPvL8gAGvPUMQwUdaE8k49rOMuZpOwdQoy5qJf6K8jL3bcAMhVUlHAjIgJHUg==", "dev": true, "requires": { - "@babel/helper-annotate-as-pure": "^7.10.4", + "@babel/helper-annotate-as-pure": "^7.12.13", "regexpu-core": "^4.7.1" } }, - "@babel/helper-define-map": { - "version": "7.10.5", - "resolved": "https://registry.npmjs.org/@babel/helper-define-map/-/helper-define-map-7.10.5.tgz", - "integrity": "sha512-fMw4kgFB720aQFXSVaXr79pjjcW5puTCM16+rECJ/plGS+zByelE8l9nCpV1GibxTnFVmUuYG9U8wYfQHdzOEQ==", - "dev": true, - "requires": { - "@babel/helper-function-name": "^7.10.4", - "@babel/types": "^7.10.5", - "lodash": "^4.17.19" - } - }, "@babel/helper-explode-assignable-expression": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/helper-explode-assignable-expression/-/helper-explode-assignable-expression-7.12.1.tgz", - "integrity": "sha512-dmUwH8XmlrUpVqgtZ737tK88v07l840z9j3OEhCLwKTkjlvKpfqXVIZ0wpK3aeOxspwGrf/5AP5qLx4rO3w5rA==", + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-explode-assignable-expression/-/helper-explode-assignable-expression-7.13.0.tgz", + "integrity": "sha512-qS0peLTDP8kOisG1blKbaoBg/o9OSa1qoumMjTK5pM+KDTtpxpsiubnCGP34vK8BXGcb2M9eigwgvoJryrzwWA==", "dev": true, "requires": { - "@babel/types": "^7.12.1" + "@babel/types": "^7.13.0" + }, + "dependencies": { + "@babel/types": { + "version": "7.13.14", + "resolved": "https://registry.npmjs.org/@babel/types/-/types-7.13.14.tgz", + "integrity": "sha512-A2aa3QTkWoyqsZZFl56MLUsfmh7O0gN41IPvXAE/++8ojpbz12SszD7JEGYVdn4f9Kt4amIei07swF1h4AqmmQ==", + "dev": true, + "requires": { + "@babel/helper-validator-identifier": "^7.12.11", + "lodash": "^4.17.19", + "to-fast-properties": "^2.0.0" + } + } } }, "@babel/helper-function-name": { - "version": "7.12.11", - "resolved": "https://registry.npmjs.org/@babel/helper-function-name/-/helper-function-name-7.12.11.tgz", - "integrity": "sha512-AtQKjtYNolKNi6nNNVLQ27CP6D9oFR6bq/HPYSizlzbp7uC1M59XJe8L+0uXjbIaZaUJF99ruHqVGiKXU/7ybA==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/helper-function-name/-/helper-function-name-7.12.13.tgz", + "integrity": "sha512-TZvmPn0UOqmvi5G4vvw0qZTpVptGkB1GL61R6lKvrSdIxGm5Pky7Q3fpKiIkQCAtRCBUwB0PaThlx9vebCDSwA==", "requires": { - "@babel/helper-get-function-arity": "^7.12.10", - "@babel/template": "^7.12.7", - "@babel/types": "^7.12.11" + "@babel/helper-get-function-arity": "^7.12.13", + "@babel/template": "^7.12.13", + "@babel/types": "^7.12.13" + }, + "dependencies": { + "@babel/template": { + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/template/-/template-7.12.13.tgz", + "integrity": "sha512-/7xxiGA57xMo/P2GVvdEumr8ONhFOhfgq2ihK3h1e6THqzTAkHbkXgB0xI9yeTfIUoH3+oAeHhqm/I43OTbbjA==", + "requires": { + "@babel/code-frame": "^7.12.13", + "@babel/parser": "^7.12.13", + "@babel/types": "^7.12.13" + } + }, + "@babel/types": { + "version": "7.13.14", + "resolved": "https://registry.npmjs.org/@babel/types/-/types-7.13.14.tgz", + "integrity": "sha512-A2aa3QTkWoyqsZZFl56MLUsfmh7O0gN41IPvXAE/++8ojpbz12SszD7JEGYVdn4f9Kt4amIei07swF1h4AqmmQ==", + "requires": { + "@babel/helper-validator-identifier": "^7.12.11", + "lodash": "^4.17.19", + "to-fast-properties": "^2.0.0" + } + } } }, "@babel/helper-get-function-arity": { - "version": "7.12.10", - "resolved": "https://registry.npmjs.org/@babel/helper-get-function-arity/-/helper-get-function-arity-7.12.10.tgz", - "integrity": "sha512-mm0n5BPjR06wh9mPQaDdXWDoll/j5UpCAPl1x8fS71GHm7HA6Ua2V4ylG1Ju8lvcTOietbPNNPaSilKj+pj+Ag==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/helper-get-function-arity/-/helper-get-function-arity-7.12.13.tgz", + "integrity": "sha512-DjEVzQNz5LICkzN0REdpD5prGoidvbdYk1BVgRUOINaWJP2t6avB27X1guXK1kXNrX0WMfsrm1A/ZBthYuIMQg==", "requires": { - "@babel/types": "^7.12.10" + "@babel/types": "^7.12.13" + }, + "dependencies": { + "@babel/types": { + "version": "7.13.14", + "resolved": "https://registry.npmjs.org/@babel/types/-/types-7.13.14.tgz", + "integrity": "sha512-A2aa3QTkWoyqsZZFl56MLUsfmh7O0gN41IPvXAE/++8ojpbz12SszD7JEGYVdn4f9Kt4amIei07swF1h4AqmmQ==", + "requires": { + "@babel/helper-validator-identifier": "^7.12.11", + "lodash": "^4.17.19", + "to-fast-properties": "^2.0.0" + } + } } }, "@babel/helper-hoist-variables": { - "version": "7.10.4", - "resolved": "https://registry.npmjs.org/@babel/helper-hoist-variables/-/helper-hoist-variables-7.10.4.tgz", - "integrity": "sha512-wljroF5PgCk2juF69kanHVs6vrLwIPNp6DLD+Lrl3hoQ3PpPPikaDRNFA+0t81NOoMt2DL6WW/mdU8k4k6ZzuA==", + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-hoist-variables/-/helper-hoist-variables-7.13.0.tgz", + "integrity": "sha512-0kBzvXiIKfsCA0y6cFEIJf4OdzfpRuNk4+YTeHZpGGc666SATFKTz6sRncwFnQk7/ugJ4dSrCj6iJuvW4Qwr2g==", "dev": true, "requires": { - "@babel/types": "^7.10.4" + "@babel/traverse": "^7.13.0", + "@babel/types": "^7.13.0" + }, + "dependencies": { + "@babel/parser": { + "version": "7.13.13", + "resolved": "https://registry.npmjs.org/@babel/parser/-/parser-7.13.13.tgz", + "integrity": "sha512-OhsyMrqygfk5v8HmWwOzlYjJrtLaFhF34MrfG/Z73DgYCI6ojNUTUp2TYbtnjo8PegeJp12eamsNettCQjKjVw==", + "dev": true + }, + "@babel/traverse": { + "version": "7.13.13", + "resolved": "https://registry.npmjs.org/@babel/traverse/-/traverse-7.13.13.tgz", + "integrity": "sha512-CblEcwmXKR6eP43oQGG++0QMTtCjAsa3frUuzHoiIJWpaIIi8dwMyEFUJoXRLxagGqCK+jALRwIO+o3R9p/uUg==", + "dev": true, + "requires": { + "@babel/code-frame": "^7.12.13", + "@babel/generator": "^7.13.9", + "@babel/helper-function-name": "^7.12.13", + "@babel/helper-split-export-declaration": "^7.12.13", + "@babel/parser": "^7.13.13", + "@babel/types": "^7.13.13", + "debug": "^4.1.0", + "globals": "^11.1.0" + } + }, + "@babel/types": { + "version": "7.13.14", + "resolved": "https://registry.npmjs.org/@babel/types/-/types-7.13.14.tgz", + "integrity": "sha512-A2aa3QTkWoyqsZZFl56MLUsfmh7O0gN41IPvXAE/++8ojpbz12SszD7JEGYVdn4f9Kt4amIei07swF1h4AqmmQ==", + "dev": true, + "requires": { + "@babel/helper-validator-identifier": "^7.12.11", + "lodash": "^4.17.19", + "to-fast-properties": "^2.0.0" + } + } } }, "@babel/helper-member-expression-to-functions": { - "version": "7.12.7", - "resolved": "https://registry.npmjs.org/@babel/helper-member-expression-to-functions/-/helper-member-expression-to-functions-7.12.7.tgz", - "integrity": "sha512-DCsuPyeWxeHgh1Dus7APn7iza42i/qXqiFPWyBDdOFtvS581JQePsc1F/nD+fHrcswhLlRc2UpYS1NwERxZhHw==", + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-member-expression-to-functions/-/helper-member-expression-to-functions-7.13.0.tgz", + "integrity": "sha512-yvRf8Ivk62JwisqV1rFRMxiSMDGnN6KH1/mDMmIrij4jztpQNRoHqqMG3U6apYbGRPJpgPalhva9Yd06HlUxJQ==", "requires": { - "@babel/types": "^7.12.7" + "@babel/types": "^7.13.0" + }, + "dependencies": { + "@babel/types": { + "version": "7.13.14", + "resolved": "https://registry.npmjs.org/@babel/types/-/types-7.13.14.tgz", + "integrity": "sha512-A2aa3QTkWoyqsZZFl56MLUsfmh7O0gN41IPvXAE/++8ojpbz12SszD7JEGYVdn4f9Kt4amIei07swF1h4AqmmQ==", + "requires": { + "@babel/helper-validator-identifier": "^7.12.11", + "lodash": "^4.17.19", + "to-fast-properties": "^2.0.0" + } + } } }, "@babel/helper-module-imports": { - "version": "7.12.5", - "resolved": "https://registry.npmjs.org/@babel/helper-module-imports/-/helper-module-imports-7.12.5.tgz", - "integrity": "sha512-SR713Ogqg6++uexFRORf/+nPXMmWIn80TALu0uaFb+iQIUoR7bOC7zBWyzBs5b3tBBJXuyD0cRu1F15GyzjOWA==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/helper-module-imports/-/helper-module-imports-7.12.13.tgz", + "integrity": "sha512-NGmfvRp9Rqxy0uHSSVP+SRIW1q31a7Ji10cLBcqSDUngGentY4FRiHOFZFE1CLU5eiL0oE8reH7Tg1y99TDM/g==", "requires": { - "@babel/types": "^7.12.5" + "@babel/types": "^7.12.13" + }, + "dependencies": { + "@babel/types": { + "version": "7.13.14", + "resolved": "https://registry.npmjs.org/@babel/types/-/types-7.13.14.tgz", + "integrity": "sha512-A2aa3QTkWoyqsZZFl56MLUsfmh7O0gN41IPvXAE/++8ojpbz12SszD7JEGYVdn4f9Kt4amIei07swF1h4AqmmQ==", + "requires": { + "@babel/helper-validator-identifier": "^7.12.11", + "lodash": "^4.17.19", + "to-fast-properties": "^2.0.0" + } + } } }, "@babel/helper-module-transforms": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/helper-module-transforms/-/helper-module-transforms-7.12.1.tgz", - "integrity": "sha512-QQzehgFAZ2bbISiCpmVGfiGux8YVFXQ0abBic2Envhej22DVXV9nCFaS5hIQbkyo1AdGb+gNME2TSh3hYJVV/w==", + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-module-transforms/-/helper-module-transforms-7.13.0.tgz", + "integrity": "sha512-Ls8/VBwH577+pw7Ku1QkUWIyRRNHpYlts7+qSqBBFCW3I8QteB9DxfcZ5YJpOwH6Ihe/wn8ch7fMGOP1OhEIvw==", "requires": { - "@babel/helper-module-imports": "^7.12.1", - "@babel/helper-replace-supers": "^7.12.1", - "@babel/helper-simple-access": "^7.12.1", - "@babel/helper-split-export-declaration": "^7.11.0", - "@babel/helper-validator-identifier": "^7.10.4", - "@babel/template": "^7.10.4", - "@babel/traverse": "^7.12.1", - "@babel/types": "^7.12.1", + "@babel/helper-module-imports": "^7.12.13", + "@babel/helper-replace-supers": "^7.13.0", + "@babel/helper-simple-access": "^7.12.13", + "@babel/helper-split-export-declaration": "^7.12.13", + "@babel/helper-validator-identifier": "^7.12.11", + "@babel/template": "^7.12.13", + "@babel/traverse": "^7.13.0", + "@babel/types": "^7.13.0", "lodash": "^4.17.19" + }, + "dependencies": { + "@babel/template": { + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/template/-/template-7.12.13.tgz", + "integrity": "sha512-/7xxiGA57xMo/P2GVvdEumr8ONhFOhfgq2ihK3h1e6THqzTAkHbkXgB0xI9yeTfIUoH3+oAeHhqm/I43OTbbjA==", + "requires": { + "@babel/code-frame": "^7.12.13", + "@babel/parser": "^7.12.13", + "@babel/types": "^7.12.13" + } + }, + "@babel/traverse": { + "version": "7.13.13", + "resolved": "https://registry.npmjs.org/@babel/traverse/-/traverse-7.13.13.tgz", + "integrity": "sha512-CblEcwmXKR6eP43oQGG++0QMTtCjAsa3frUuzHoiIJWpaIIi8dwMyEFUJoXRLxagGqCK+jALRwIO+o3R9p/uUg==", + "requires": { + "@babel/code-frame": "^7.12.13", + "@babel/generator": "^7.13.9", + "@babel/helper-function-name": "^7.12.13", + "@babel/helper-split-export-declaration": "^7.12.13", + "@babel/parser": "^7.13.13", + "@babel/types": "^7.13.13", + "debug": "^4.1.0", + "globals": "^11.1.0" + }, + "dependencies": { + "@babel/parser": { + "version": "7.13.13", + "resolved": "https://registry.npmjs.org/@babel/parser/-/parser-7.13.13.tgz", + "integrity": "sha512-OhsyMrqygfk5v8HmWwOzlYjJrtLaFhF34MrfG/Z73DgYCI6ojNUTUp2TYbtnjo8PegeJp12eamsNettCQjKjVw==" + } + } + }, + "@babel/types": { + "version": "7.13.14", + "resolved": "https://registry.npmjs.org/@babel/types/-/types-7.13.14.tgz", + "integrity": "sha512-A2aa3QTkWoyqsZZFl56MLUsfmh7O0gN41IPvXAE/++8ojpbz12SszD7JEGYVdn4f9Kt4amIei07swF1h4AqmmQ==", + "requires": { + "@babel/helper-validator-identifier": "^7.12.11", + "lodash": "^4.17.19", + "to-fast-properties": "^2.0.0" + } + } } }, "@babel/helper-optimise-call-expression": { - "version": "7.12.10", - "resolved": "https://registry.npmjs.org/@babel/helper-optimise-call-expression/-/helper-optimise-call-expression-7.12.10.tgz", - "integrity": "sha512-4tpbU0SrSTjjt65UMWSrUOPZTsgvPgGG4S8QSTNHacKzpS51IVWGDj0yCwyeZND/i+LSN2g/O63jEXEWm49sYQ==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/helper-optimise-call-expression/-/helper-optimise-call-expression-7.12.13.tgz", + "integrity": "sha512-BdWQhoVJkp6nVjB7nkFWcn43dkprYauqtk++Py2eaf/GRDFm5BxRqEIZCiHlZUGAVmtwKcsVL1dC68WmzeFmiA==", "requires": { - "@babel/types": "^7.12.10" + "@babel/types": "^7.12.13" + }, + "dependencies": { + "@babel/types": { + "version": "7.13.14", + "resolved": "https://registry.npmjs.org/@babel/types/-/types-7.13.14.tgz", + "integrity": "sha512-A2aa3QTkWoyqsZZFl56MLUsfmh7O0gN41IPvXAE/++8ojpbz12SszD7JEGYVdn4f9Kt4amIei07swF1h4AqmmQ==", + "requires": { + "@babel/helper-validator-identifier": "^7.12.11", + "lodash": "^4.17.19", + "to-fast-properties": "^2.0.0" + } + } } }, "@babel/helper-plugin-utils": { @@ -473,33 +717,90 @@ "integrity": "sha512-O4KCvQA6lLiMU9l2eawBPMf1xPP8xPfB3iEQw150hOVTqj/rfXz0ThTb4HEzqQfs2Bmo5Ay8BzxfzVtBrr9dVg==" }, "@babel/helper-remap-async-to-generator": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/helper-remap-async-to-generator/-/helper-remap-async-to-generator-7.12.1.tgz", - "integrity": "sha512-9d0KQCRM8clMPcDwo8SevNs+/9a8yWVVmaE80FGJcEP8N1qToREmWEGnBn8BUlJhYRFz6fqxeRL1sl5Ogsed7A==", + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-remap-async-to-generator/-/helper-remap-async-to-generator-7.13.0.tgz", + "integrity": "sha512-pUQpFBE9JvC9lrQbpX0TmeNIy5s7GnZjna2lhhcHC7DzgBs6fWn722Y5cfwgrtrqc7NAJwMvOa0mKhq6XaE4jg==", "dev": true, "requires": { - "@babel/helper-annotate-as-pure": "^7.10.4", - "@babel/helper-wrap-function": "^7.10.4", - "@babel/types": "^7.12.1" + "@babel/helper-annotate-as-pure": "^7.12.13", + "@babel/helper-wrap-function": "^7.13.0", + "@babel/types": "^7.13.0" + }, + "dependencies": { + "@babel/types": { + "version": "7.13.14", + "resolved": "https://registry.npmjs.org/@babel/types/-/types-7.13.14.tgz", + "integrity": "sha512-A2aa3QTkWoyqsZZFl56MLUsfmh7O0gN41IPvXAE/++8ojpbz12SszD7JEGYVdn4f9Kt4amIei07swF1h4AqmmQ==", + "dev": true, + "requires": { + "@babel/helper-validator-identifier": "^7.12.11", + "lodash": "^4.17.19", + "to-fast-properties": "^2.0.0" + } + } } }, "@babel/helper-replace-supers": { - "version": "7.12.11", - "resolved": "https://registry.npmjs.org/@babel/helper-replace-supers/-/helper-replace-supers-7.12.11.tgz", - "integrity": "sha512-q+w1cqmhL7R0FNzth/PLLp2N+scXEK/L2AHbXUyydxp828F4FEa5WcVoqui9vFRiHDQErj9Zof8azP32uGVTRA==", + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-replace-supers/-/helper-replace-supers-7.13.0.tgz", + "integrity": "sha512-Segd5me1+Pz+rmN/NFBOplMbZG3SqRJOBlY+mA0SxAv6rjj7zJqr1AVr3SfzUVTLCv7ZLU5FycOM/SBGuLPbZw==", "requires": { - "@babel/helper-member-expression-to-functions": "^7.12.7", - "@babel/helper-optimise-call-expression": "^7.12.10", - "@babel/traverse": "^7.12.10", - "@babel/types": "^7.12.11" + "@babel/helper-member-expression-to-functions": "^7.13.0", + "@babel/helper-optimise-call-expression": "^7.12.13", + "@babel/traverse": "^7.13.0", + "@babel/types": "^7.13.0" + }, + "dependencies": { + "@babel/parser": { + "version": "7.13.13", + "resolved": "https://registry.npmjs.org/@babel/parser/-/parser-7.13.13.tgz", + "integrity": "sha512-OhsyMrqygfk5v8HmWwOzlYjJrtLaFhF34MrfG/Z73DgYCI6ojNUTUp2TYbtnjo8PegeJp12eamsNettCQjKjVw==" + }, + "@babel/traverse": { + "version": "7.13.13", + "resolved": "https://registry.npmjs.org/@babel/traverse/-/traverse-7.13.13.tgz", + "integrity": "sha512-CblEcwmXKR6eP43oQGG++0QMTtCjAsa3frUuzHoiIJWpaIIi8dwMyEFUJoXRLxagGqCK+jALRwIO+o3R9p/uUg==", + "requires": { + "@babel/code-frame": "^7.12.13", + "@babel/generator": "^7.13.9", + "@babel/helper-function-name": "^7.12.13", + "@babel/helper-split-export-declaration": "^7.12.13", + "@babel/parser": "^7.13.13", + "@babel/types": "^7.13.13", + "debug": "^4.1.0", + "globals": "^11.1.0" + } + }, + "@babel/types": { + "version": "7.13.14", + "resolved": "https://registry.npmjs.org/@babel/types/-/types-7.13.14.tgz", + "integrity": "sha512-A2aa3QTkWoyqsZZFl56MLUsfmh7O0gN41IPvXAE/++8ojpbz12SszD7JEGYVdn4f9Kt4amIei07swF1h4AqmmQ==", + "requires": { + "@babel/helper-validator-identifier": "^7.12.11", + "lodash": "^4.17.19", + "to-fast-properties": "^2.0.0" + } + } } }, "@babel/helper-simple-access": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/helper-simple-access/-/helper-simple-access-7.12.1.tgz", - "integrity": "sha512-OxBp7pMrjVewSSC8fXDFrHrBcJATOOFssZwv16F3/6Xtc138GHybBfPbm9kfiqQHKhYQrlamWILwlDCeyMFEaA==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/helper-simple-access/-/helper-simple-access-7.12.13.tgz", + "integrity": "sha512-0ski5dyYIHEfwpWGx5GPWhH35j342JaflmCeQmsPWcrOQDtCN6C1zKAVRFVbK53lPW2c9TsuLLSUDf0tIGJ5hA==", "requires": { - "@babel/types": "^7.12.1" + "@babel/types": "^7.12.13" + }, + "dependencies": { + "@babel/types": { + "version": "7.13.14", + "resolved": "https://registry.npmjs.org/@babel/types/-/types-7.13.14.tgz", + "integrity": "sha512-A2aa3QTkWoyqsZZFl56MLUsfmh7O0gN41IPvXAE/++8ojpbz12SszD7JEGYVdn4f9Kt4amIei07swF1h4AqmmQ==", + "requires": { + "@babel/helper-validator-identifier": "^7.12.11", + "lodash": "^4.17.19", + "to-fast-properties": "^2.0.0" + } + } } }, "@babel/helper-skip-transparent-expression-wrappers": { @@ -512,11 +813,23 @@ } }, "@babel/helper-split-export-declaration": { - "version": "7.12.11", - "resolved": "https://registry.npmjs.org/@babel/helper-split-export-declaration/-/helper-split-export-declaration-7.12.11.tgz", - "integrity": "sha512-LsIVN8j48gHgwzfocYUSkO/hjYAOJqlpJEc7tGXcIm4cubjVUf8LGW6eWRyxEu7gA25q02p0rQUWoCI33HNS5g==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/helper-split-export-declaration/-/helper-split-export-declaration-7.12.13.tgz", + "integrity": "sha512-tCJDltF83htUtXx5NLcaDqRmknv652ZWCHyoTETf1CXYJdPC7nohZohjUgieXhv0hTJdRf2FjDueFehdNucpzg==", "requires": { - "@babel/types": "^7.12.11" + "@babel/types": "^7.12.13" + }, + "dependencies": { + "@babel/types": { + "version": "7.13.14", + "resolved": "https://registry.npmjs.org/@babel/types/-/types-7.13.14.tgz", + "integrity": "sha512-A2aa3QTkWoyqsZZFl56MLUsfmh7O0gN41IPvXAE/++8ojpbz12SszD7JEGYVdn4f9Kt4amIei07swF1h4AqmmQ==", + "requires": { + "@babel/helper-validator-identifier": "^7.12.11", + "lodash": "^4.17.19", + "to-fast-properties": "^2.0.0" + } + } } }, "@babel/helper-validator-identifier": { @@ -525,57 +838,157 @@ "integrity": "sha512-np/lG3uARFybkoHokJUmf1QfEvRVCPbmQeUQpKow5cQ3xWrV9i3rUHodKDJPQfTVX61qKi+UdYk8kik84n7XOw==" }, "@babel/helper-validator-option": { - "version": "7.12.11", - "resolved": "https://registry.npmjs.org/@babel/helper-validator-option/-/helper-validator-option-7.12.11.tgz", - "integrity": "sha512-TBFCyj939mFSdeX7U7DDj32WtzYY7fDcalgq8v3fBZMNOJQNn7nOYzMaUCiPxPYfCup69mtIpqlKgMZLvQ8Xhw==", + "version": "7.12.17", + "resolved": "https://registry.npmjs.org/@babel/helper-validator-option/-/helper-validator-option-7.12.17.tgz", + "integrity": "sha512-TopkMDmLzq8ngChwRlyjR6raKD6gMSae4JdYDB8bByKreQgG0RBTuKe9LRxW3wFtUnjxOPRKBDwEH6Mg5KeDfw==", "dev": true }, "@babel/helper-wrap-function": { - "version": "7.12.3", - "resolved": "https://registry.npmjs.org/@babel/helper-wrap-function/-/helper-wrap-function-7.12.3.tgz", - "integrity": "sha512-Cvb8IuJDln3rs6tzjW3Y8UeelAOdnpB8xtQ4sme2MSZ9wOxrbThporC0y/EtE16VAtoyEfLM404Xr1e0OOp+ow==", + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-wrap-function/-/helper-wrap-function-7.13.0.tgz", + "integrity": "sha512-1UX9F7K3BS42fI6qd2A4BjKzgGjToscyZTdp1DjknHLCIvpgne6918io+aL5LXFcER/8QWiwpoY902pVEqgTXA==", "dev": true, "requires": { - "@babel/helper-function-name": "^7.10.4", - "@babel/template": "^7.10.4", - "@babel/traverse": "^7.10.4", - "@babel/types": "^7.10.4" + "@babel/helper-function-name": "^7.12.13", + "@babel/template": "^7.12.13", + "@babel/traverse": "^7.13.0", + "@babel/types": "^7.13.0" + }, + "dependencies": { + "@babel/template": { + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/template/-/template-7.12.13.tgz", + "integrity": "sha512-/7xxiGA57xMo/P2GVvdEumr8ONhFOhfgq2ihK3h1e6THqzTAkHbkXgB0xI9yeTfIUoH3+oAeHhqm/I43OTbbjA==", + "dev": true, + "requires": { + "@babel/code-frame": "^7.12.13", + "@babel/parser": "^7.12.13", + "@babel/types": "^7.12.13" + } + }, + "@babel/traverse": { + "version": "7.13.13", + "resolved": "https://registry.npmjs.org/@babel/traverse/-/traverse-7.13.13.tgz", + "integrity": "sha512-CblEcwmXKR6eP43oQGG++0QMTtCjAsa3frUuzHoiIJWpaIIi8dwMyEFUJoXRLxagGqCK+jALRwIO+o3R9p/uUg==", + "dev": true, + "requires": { + "@babel/code-frame": "^7.12.13", + "@babel/generator": "^7.13.9", + "@babel/helper-function-name": "^7.12.13", + "@babel/helper-split-export-declaration": "^7.12.13", + "@babel/parser": "^7.13.13", + "@babel/types": "^7.13.13", + "debug": "^4.1.0", + "globals": "^11.1.0" + }, + "dependencies": { + "@babel/parser": { + "version": "7.13.13", + "resolved": "https://registry.npmjs.org/@babel/parser/-/parser-7.13.13.tgz", + "integrity": "sha512-OhsyMrqygfk5v8HmWwOzlYjJrtLaFhF34MrfG/Z73DgYCI6ojNUTUp2TYbtnjo8PegeJp12eamsNettCQjKjVw==", + "dev": true + } + } + }, + "@babel/types": { + "version": "7.13.14", + "resolved": "https://registry.npmjs.org/@babel/types/-/types-7.13.14.tgz", + "integrity": "sha512-A2aa3QTkWoyqsZZFl56MLUsfmh7O0gN41IPvXAE/++8ojpbz12SszD7JEGYVdn4f9Kt4amIei07swF1h4AqmmQ==", + "dev": true, + "requires": { + "@babel/helper-validator-identifier": "^7.12.11", + "lodash": "^4.17.19", + "to-fast-properties": "^2.0.0" + } + } } }, "@babel/helpers": { - "version": "7.12.5", - "resolved": "https://registry.npmjs.org/@babel/helpers/-/helpers-7.12.5.tgz", - "integrity": "sha512-lgKGMQlKqA8meJqKsW6rUnc4MdUk35Ln0ATDqdM1a/UpARODdI4j5Y5lVfUScnSNkJcdCRAaWkspykNoFg9sJA==", + "version": "7.13.10", + "resolved": "https://registry.npmjs.org/@babel/helpers/-/helpers-7.13.10.tgz", + "integrity": "sha512-4VO883+MWPDUVRF3PhiLBUFHoX/bsLTGFpFK/HqvvfBZz2D57u9XzPVNFVBTc0PW/CWR9BXTOKt8NF4DInUHcQ==", "requires": { - "@babel/template": "^7.10.4", - "@babel/traverse": "^7.12.5", - "@babel/types": "^7.12.5" + "@babel/template": "^7.12.13", + "@babel/traverse": "^7.13.0", + "@babel/types": "^7.13.0" + }, + "dependencies": { + "@babel/template": { + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/template/-/template-7.12.13.tgz", + "integrity": "sha512-/7xxiGA57xMo/P2GVvdEumr8ONhFOhfgq2ihK3h1e6THqzTAkHbkXgB0xI9yeTfIUoH3+oAeHhqm/I43OTbbjA==", + "requires": { + "@babel/code-frame": "^7.12.13", + "@babel/parser": "^7.12.13", + "@babel/types": "^7.12.13" + } + }, + "@babel/traverse": { + "version": "7.13.13", + "resolved": "https://registry.npmjs.org/@babel/traverse/-/traverse-7.13.13.tgz", + "integrity": "sha512-CblEcwmXKR6eP43oQGG++0QMTtCjAsa3frUuzHoiIJWpaIIi8dwMyEFUJoXRLxagGqCK+jALRwIO+o3R9p/uUg==", + "requires": { + "@babel/code-frame": "^7.12.13", + "@babel/generator": "^7.13.9", + "@babel/helper-function-name": "^7.12.13", + "@babel/helper-split-export-declaration": "^7.12.13", + "@babel/parser": "^7.13.13", + "@babel/types": "^7.13.13", + "debug": "^4.1.0", + "globals": "^11.1.0" + }, + "dependencies": { + "@babel/parser": { + "version": "7.13.13", + "resolved": "https://registry.npmjs.org/@babel/parser/-/parser-7.13.13.tgz", + "integrity": "sha512-OhsyMrqygfk5v8HmWwOzlYjJrtLaFhF34MrfG/Z73DgYCI6ojNUTUp2TYbtnjo8PegeJp12eamsNettCQjKjVw==" + } + } + }, + "@babel/types": { + "version": "7.13.14", + "resolved": "https://registry.npmjs.org/@babel/types/-/types-7.13.14.tgz", + "integrity": "sha512-A2aa3QTkWoyqsZZFl56MLUsfmh7O0gN41IPvXAE/++8ojpbz12SszD7JEGYVdn4f9Kt4amIei07swF1h4AqmmQ==", + "requires": { + "@babel/helper-validator-identifier": "^7.12.11", + "lodash": "^4.17.19", + "to-fast-properties": "^2.0.0" + } + } } }, "@babel/highlight": { - "version": "7.10.4", - "resolved": "https://registry.npmjs.org/@babel/highlight/-/highlight-7.10.4.tgz", - "integrity": "sha512-i6rgnR/YgPEQzZZnbTHHuZdlE8qyoBNalD6F+q4vAFlcMEcqmkoG+mPqJYJCo63qPf74+Y1UZsl3l6f7/RIkmA==", + "version": "7.13.10", + "resolved": "https://registry.npmjs.org/@babel/highlight/-/highlight-7.13.10.tgz", + "integrity": "sha512-5aPpe5XQPzflQrFwL1/QoeHkP2MsA4JCntcXHRhEsdsfPVkvPi2w7Qix4iV7t5S/oC9OodGrggd8aco1g3SZFg==", "requires": { - "@babel/helper-validator-identifier": "^7.10.4", + "@babel/helper-validator-identifier": "^7.12.11", "chalk": "^2.0.0", "js-tokens": "^4.0.0" } }, "@babel/parser": { - "version": "7.12.11", - "resolved": "https://registry.npmjs.org/@babel/parser/-/parser-7.12.11.tgz", - "integrity": "sha512-N3UxG+uuF4CMYoNj8AhnbAcJF0PiuJ9KHuy1lQmkYsxTer/MAH9UBNHsBoAX/4s6NvlDD047No8mYVGGzLL4hg==" + "version": "7.13.10", + "resolved": "https://registry.npmjs.org/@babel/parser/-/parser-7.13.10.tgz", + "integrity": "sha512-0s7Mlrw9uTWkYua7xWr99Wpk2bnGa0ANleKfksYAES8LpWH4gW1OUr42vqKNf0us5UQNfru2wPqMqRITzq/SIQ==" }, "@babel/plugin-proposal-async-generator-functions": { - "version": "7.12.12", - "resolved": "https://registry.npmjs.org/@babel/plugin-proposal-async-generator-functions/-/plugin-proposal-async-generator-functions-7.12.12.tgz", - "integrity": "sha512-nrz9y0a4xmUrRq51bYkWJIO5SBZyG2ys2qinHsN0zHDHVsUaModrkpyWWWXfGqYQmOL3x9sQIcTNN/pBGpo09A==", + "version": "7.13.8", + "resolved": "https://registry.npmjs.org/@babel/plugin-proposal-async-generator-functions/-/plugin-proposal-async-generator-functions-7.13.8.tgz", + "integrity": "sha512-rPBnhj+WgoSmgq+4gQUtXx/vOcU+UYtjy1AA/aeD61Hwj410fwYyqfUcRP3lR8ucgliVJL/G7sXcNUecC75IXA==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4", - "@babel/helper-remap-async-to-generator": "^7.12.1", - "@babel/plugin-syntax-async-generators": "^7.8.0" + "@babel/helper-plugin-utils": "^7.13.0", + "@babel/helper-remap-async-to-generator": "^7.13.0", + "@babel/plugin-syntax-async-generators": "^7.8.4" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-proposal-class-properties": { @@ -598,43 +1011,75 @@ } }, "@babel/plugin-proposal-dynamic-import": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-proposal-dynamic-import/-/plugin-proposal-dynamic-import-7.12.1.tgz", - "integrity": "sha512-a4rhUSZFuq5W8/OO8H7BL5zspjnc1FLd9hlOxIK/f7qG4a0qsqk8uvF/ywgBA8/OmjsapjpvaEOYItfGG1qIvQ==", + "version": "7.13.8", + "resolved": "https://registry.npmjs.org/@babel/plugin-proposal-dynamic-import/-/plugin-proposal-dynamic-import-7.13.8.tgz", + "integrity": "sha512-ONWKj0H6+wIRCkZi9zSbZtE/r73uOhMVHh256ys0UzfM7I3d4n+spZNWjOnJv2gzopumP2Wxi186vI8N0Y2JyQ==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4", - "@babel/plugin-syntax-dynamic-import": "^7.8.0" + "@babel/helper-plugin-utils": "^7.13.0", + "@babel/plugin-syntax-dynamic-import": "^7.8.3" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-proposal-json-strings": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-proposal-json-strings/-/plugin-proposal-json-strings-7.12.1.tgz", - "integrity": "sha512-GoLDUi6U9ZLzlSda2Df++VSqDJg3CG+dR0+iWsv6XRw1rEq+zwt4DirM9yrxW6XWaTpmai1cWJLMfM8qQJf+yw==", + "version": "7.13.8", + "resolved": "https://registry.npmjs.org/@babel/plugin-proposal-json-strings/-/plugin-proposal-json-strings-7.13.8.tgz", + "integrity": "sha512-w4zOPKUFPX1mgvTmL/fcEqy34hrQ1CRcGxdphBc6snDnnqJ47EZDIyop6IwXzAC8G916hsIuXB2ZMBCExC5k7Q==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4", - "@babel/plugin-syntax-json-strings": "^7.8.0" + "@babel/helper-plugin-utils": "^7.13.0", + "@babel/plugin-syntax-json-strings": "^7.8.3" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-proposal-nullish-coalescing-operator": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-proposal-nullish-coalescing-operator/-/plugin-proposal-nullish-coalescing-operator-7.12.1.tgz", - "integrity": "sha512-nZY0ESiaQDI1y96+jk6VxMOaL4LPo/QDHBqL+SF3/vl6dHkTwHlOI8L4ZwuRBHgakRBw5zsVylel7QPbbGuYgg==", + "version": "7.13.8", + "resolved": "https://registry.npmjs.org/@babel/plugin-proposal-nullish-coalescing-operator/-/plugin-proposal-nullish-coalescing-operator-7.13.8.tgz", + "integrity": "sha512-iePlDPBn//UhxExyS9KyeYU7RM9WScAG+D3Hhno0PLJebAEpDZMocbDe64eqynhNAnwz/vZoL/q/QB2T1OH39A==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4", - "@babel/plugin-syntax-nullish-coalescing-operator": "^7.8.0" + "@babel/helper-plugin-utils": "^7.13.0", + "@babel/plugin-syntax-nullish-coalescing-operator": "^7.8.3" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-proposal-numeric-separator": { - "version": "7.12.7", - "resolved": "https://registry.npmjs.org/@babel/plugin-proposal-numeric-separator/-/plugin-proposal-numeric-separator-7.12.7.tgz", - "integrity": "sha512-8c+uy0qmnRTeukiGsjLGy6uVs/TFjJchGXUeBqlG4VWYOdJWkhhVPdQ3uHwbmalfJwv2JsV0qffXP4asRfL2SQ==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/plugin-proposal-numeric-separator/-/plugin-proposal-numeric-separator-7.12.13.tgz", + "integrity": "sha512-O1jFia9R8BUCl3ZGB7eitaAPu62TXJRHn7rh+ojNERCFyqRwJMTmhz+tJ+k0CwI6CLjX/ee4qW74FSqlq9I35w==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4", + "@babel/helper-plugin-utils": "^7.12.13", "@babel/plugin-syntax-numeric-separator": "^7.10.4" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-proposal-object-rest-spread": { @@ -649,34 +1094,58 @@ } }, "@babel/plugin-proposal-optional-catch-binding": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-proposal-optional-catch-binding/-/plugin-proposal-optional-catch-binding-7.12.1.tgz", - "integrity": "sha512-hFvIjgprh9mMw5v42sJWLI1lzU5L2sznP805zeT6rySVRA0Y18StRhDqhSxlap0oVgItRsB6WSROp4YnJTJz0g==", + "version": "7.13.8", + "resolved": "https://registry.npmjs.org/@babel/plugin-proposal-optional-catch-binding/-/plugin-proposal-optional-catch-binding-7.13.8.tgz", + "integrity": "sha512-0wS/4DUF1CuTmGo+NiaHfHcVSeSLj5S3e6RivPTg/2k3wOv3jO35tZ6/ZWsQhQMvdgI7CwphjQa/ccarLymHVA==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4", - "@babel/plugin-syntax-optional-catch-binding": "^7.8.0" + "@babel/helper-plugin-utils": "^7.13.0", + "@babel/plugin-syntax-optional-catch-binding": "^7.8.3" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-proposal-optional-chaining": { - "version": "7.12.7", - "resolved": "https://registry.npmjs.org/@babel/plugin-proposal-optional-chaining/-/plugin-proposal-optional-chaining-7.12.7.tgz", - "integrity": "sha512-4ovylXZ0PWmwoOvhU2vhnzVNnm88/Sm9nx7V8BPgMvAzn5zDou3/Awy0EjglyubVHasJj+XCEkr/r1X3P5elCA==", + "version": "7.13.8", + "resolved": "https://registry.npmjs.org/@babel/plugin-proposal-optional-chaining/-/plugin-proposal-optional-chaining-7.13.8.tgz", + "integrity": "sha512-hpbBwbTgd7Cz1QryvwJZRo1U0k1q8uyBmeXOSQUjdg/A2TASkhR/rz7AyqZ/kS8kbpsNA80rOYbxySBJAqmhhQ==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4", + "@babel/helper-plugin-utils": "^7.13.0", "@babel/helper-skip-transparent-expression-wrappers": "^7.12.1", - "@babel/plugin-syntax-optional-chaining": "^7.8.0" + "@babel/plugin-syntax-optional-chaining": "^7.8.3" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-proposal-unicode-property-regex": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-proposal-unicode-property-regex/-/plugin-proposal-unicode-property-regex-7.12.1.tgz", - "integrity": "sha512-MYq+l+PvHuw/rKUz1at/vb6nCnQ2gmJBNaM62z0OgH7B2W1D9pvkpYtlti9bGtizNIU1K3zm4bZF9F91efVY0w==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/plugin-proposal-unicode-property-regex/-/plugin-proposal-unicode-property-regex-7.12.13.tgz", + "integrity": "sha512-XyJmZidNfofEkqFV5VC/bLabGmO5QzenPO/YOfGuEbgU+2sSwMmio3YLb4WtBgcmmdwZHyVyv8on77IUjQ5Gvg==", "dev": true, "requires": { - "@babel/helper-create-regexp-features-plugin": "^7.12.1", - "@babel/helper-plugin-utils": "^7.10.4" + "@babel/helper-create-regexp-features-plugin": "^7.12.13", + "@babel/helper-plugin-utils": "^7.12.13" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-syntax-async-generators": { @@ -698,12 +1167,20 @@ } }, "@babel/plugin-syntax-class-properties": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-syntax-class-properties/-/plugin-syntax-class-properties-7.12.1.tgz", - "integrity": "sha512-U40A76x5gTwmESz+qiqssqmeEsKvcSyvtgktrm0uzcARAmM9I1jR221f6Oq+GmHrcD+LvZDag1UTOTe2fL3TeA==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/plugin-syntax-class-properties/-/plugin-syntax-class-properties-7.12.13.tgz", + "integrity": "sha512-fm4idjKla0YahUNgFNLCB0qySdsoPiZP3iQE3rky0mBUtMZ23yDJ9SJdg6dXTSDnulOVqiF3Hgr9nbXvXTQZYA==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4" + "@babel/helper-plugin-utils": "^7.12.13" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-syntax-decorators": { @@ -742,12 +1219,20 @@ } }, "@babel/plugin-syntax-jsx": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-syntax-jsx/-/plugin-syntax-jsx-7.12.1.tgz", - "integrity": "sha512-1yRi7yAtB0ETgxdY9ti/p2TivUxJkTdhu/ZbF9MshVGqOx1TdB3b7xCXs49Fupgg50N45KcAsRP/ZqWjs9SRjg==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/plugin-syntax-jsx/-/plugin-syntax-jsx-7.12.13.tgz", + "integrity": "sha512-d4HM23Q1K7oq/SLNmG6mRt85l2csmQ0cHRaxRXjKW0YFdEXqlZ5kzFQKH5Uc3rDJECgu+yCRgPkG04Mm98R/1g==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4" + "@babel/helper-plugin-utils": "^7.12.13" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-syntax-logical-assignment-operators": { @@ -804,223 +1289,390 @@ } }, "@babel/plugin-syntax-top-level-await": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-syntax-top-level-await/-/plugin-syntax-top-level-await-7.12.1.tgz", - "integrity": "sha512-i7ooMZFS+a/Om0crxZodrTzNEPJHZrlMVGMTEpFAj6rYY/bKCddB0Dk/YxfPuYXOopuhKk/e1jV6h+WUU9XN3A==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/plugin-syntax-top-level-await/-/plugin-syntax-top-level-await-7.12.13.tgz", + "integrity": "sha512-A81F9pDwyS7yM//KwbCSDqy3Uj4NMIurtplxphWxoYtNPov7cJsDkAFNNyVlIZ3jwGycVsurZ+LtOA8gZ376iQ==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4" + "@babel/helper-plugin-utils": "^7.12.13" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-syntax-typescript": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-syntax-typescript/-/plugin-syntax-typescript-7.12.1.tgz", - "integrity": "sha512-UZNEcCY+4Dp9yYRCAHrHDU+9ZXLYaY9MgBXSRLkB9WjYFRR6quJBumfVrEkUxrePPBwFcpWfNKXqVRQQtm7mMA==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/plugin-syntax-typescript/-/plugin-syntax-typescript-7.12.13.tgz", + "integrity": "sha512-cHP3u1JiUiG2LFDKbXnwVad81GvfyIOmCD6HIEId6ojrY0Drfy2q1jw7BwN7dE84+kTnBjLkXoL3IEy/3JPu2w==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4" + "@babel/helper-plugin-utils": "^7.12.13" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-arrow-functions": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-arrow-functions/-/plugin-transform-arrow-functions-7.12.1.tgz", - "integrity": "sha512-5QB50qyN44fzzz4/qxDPQMBCTHgxg3n0xRBLJUmBlLoU/sFvxVWGZF/ZUfMVDQuJUKXaBhbupxIzIfZ6Fwk/0A==", + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-arrow-functions/-/plugin-transform-arrow-functions-7.13.0.tgz", + "integrity": "sha512-96lgJagobeVmazXFaDrbmCLQxBysKu7U6Do3mLsx27gf5Dk85ezysrs2BZUpXD703U/Su1xTBDxxar2oa4jAGg==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4" + "@babel/helper-plugin-utils": "^7.13.0" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-async-to-generator": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-async-to-generator/-/plugin-transform-async-to-generator-7.12.1.tgz", - "integrity": "sha512-SDtqoEcarK1DFlRJ1hHRY5HvJUj5kX4qmtpMAm2QnhOlyuMC4TMdCRgW6WXpv93rZeYNeLP22y8Aq2dbcDRM1A==", + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-async-to-generator/-/plugin-transform-async-to-generator-7.13.0.tgz", + "integrity": "sha512-3j6E004Dx0K3eGmhxVJxwwI89CTJrce7lg3UrtFuDAVQ/2+SJ/h/aSFOeE6/n0WB1GsOffsJp6MnPQNQ8nmwhg==", "dev": true, "requires": { - "@babel/helper-module-imports": "^7.12.1", - "@babel/helper-plugin-utils": "^7.10.4", - "@babel/helper-remap-async-to-generator": "^7.12.1" + "@babel/helper-module-imports": "^7.12.13", + "@babel/helper-plugin-utils": "^7.13.0", + "@babel/helper-remap-async-to-generator": "^7.13.0" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-block-scoped-functions": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-block-scoped-functions/-/plugin-transform-block-scoped-functions-7.12.1.tgz", - "integrity": "sha512-5OpxfuYnSgPalRpo8EWGPzIYf0lHBWORCkj5M0oLBwHdlux9Ri36QqGW3/LR13RSVOAoUUMzoPI/jpE4ABcHoA==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-block-scoped-functions/-/plugin-transform-block-scoped-functions-7.12.13.tgz", + "integrity": "sha512-zNyFqbc3kI/fVpqwfqkg6RvBgFpC4J18aKKMmv7KdQ/1GgREapSJAykLMVNwfRGO3BtHj3YQZl8kxCXPcVMVeg==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4" + "@babel/helper-plugin-utils": "^7.12.13" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-block-scoping": { - "version": "7.12.12", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-block-scoping/-/plugin-transform-block-scoping-7.12.12.tgz", - "integrity": "sha512-VOEPQ/ExOVqbukuP7BYJtI5ZxxsmegTwzZ04j1aF0dkSypGo9XpDHuOrABsJu+ie+penpSJheDJ11x1BEZNiyQ==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-block-scoping/-/plugin-transform-block-scoping-7.12.13.tgz", + "integrity": "sha512-Pxwe0iqWJX4fOOM2kEZeUuAxHMWb9nK+9oh5d11bsLoB0xMg+mkDpt0eYuDZB7ETrY9bbcVlKUGTOGWy7BHsMQ==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4" + "@babel/helper-plugin-utils": "^7.12.13" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-classes": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-classes/-/plugin-transform-classes-7.12.1.tgz", - "integrity": "sha512-/74xkA7bVdzQTBeSUhLLJgYIcxw/dpEpCdRDiHgPJ3Mv6uC11UhjpOhl72CgqbBCmt1qtssCyB2xnJm1+PFjog==", + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-classes/-/plugin-transform-classes-7.13.0.tgz", + "integrity": "sha512-9BtHCPUARyVH1oXGcSJD3YpsqRLROJx5ZNP6tN5vnk17N0SVf9WCtf8Nuh1CFmgByKKAIMstitKduoCmsaDK5g==", "dev": true, "requires": { - "@babel/helper-annotate-as-pure": "^7.10.4", - "@babel/helper-define-map": "^7.10.4", - "@babel/helper-function-name": "^7.10.4", - "@babel/helper-optimise-call-expression": "^7.10.4", - "@babel/helper-plugin-utils": "^7.10.4", - "@babel/helper-replace-supers": "^7.12.1", - "@babel/helper-split-export-declaration": "^7.10.4", + "@babel/helper-annotate-as-pure": "^7.12.13", + "@babel/helper-function-name": "^7.12.13", + "@babel/helper-optimise-call-expression": "^7.12.13", + "@babel/helper-plugin-utils": "^7.13.0", + "@babel/helper-replace-supers": "^7.13.0", + "@babel/helper-split-export-declaration": "^7.12.13", "globals": "^11.1.0" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-computed-properties": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-computed-properties/-/plugin-transform-computed-properties-7.12.1.tgz", - "integrity": "sha512-vVUOYpPWB7BkgUWPo4C44mUQHpTZXakEqFjbv8rQMg7TC6S6ZhGZ3otQcRH6u7+adSlE5i0sp63eMC/XGffrzg==", + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-computed-properties/-/plugin-transform-computed-properties-7.13.0.tgz", + "integrity": "sha512-RRqTYTeZkZAz8WbieLTvKUEUxZlUTdmL5KGMyZj7FnMfLNKV4+r5549aORG/mgojRmFlQMJDUupwAMiF2Q7OUg==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4" + "@babel/helper-plugin-utils": "^7.13.0" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-destructuring": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-destructuring/-/plugin-transform-destructuring-7.12.1.tgz", - "integrity": "sha512-fRMYFKuzi/rSiYb2uRLiUENJOKq4Gnl+6qOv5f8z0TZXg3llUwUhsNNwrwaT/6dUhJTzNpBr+CUvEWBtfNY1cw==", + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-destructuring/-/plugin-transform-destructuring-7.13.0.tgz", + "integrity": "sha512-zym5em7tePoNT9s964c0/KU3JPPnuq7VhIxPRefJ4/s82cD+q1mgKfuGRDMCPL0HTyKz4dISuQlCusfgCJ86HA==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4" + "@babel/helper-plugin-utils": "^7.13.0" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-dotall-regex": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-dotall-regex/-/plugin-transform-dotall-regex-7.12.1.tgz", - "integrity": "sha512-B2pXeRKoLszfEW7J4Hg9LoFaWEbr/kzo3teWHmtFCszjRNa/b40f9mfeqZsIDLLt/FjwQ6pz/Gdlwy85xNckBA==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-dotall-regex/-/plugin-transform-dotall-regex-7.12.13.tgz", + "integrity": "sha512-foDrozE65ZFdUC2OfgeOCrEPTxdB3yjqxpXh8CH+ipd9CHd4s/iq81kcUpyH8ACGNEPdFqbtzfgzbT/ZGlbDeQ==", "dev": true, "requires": { - "@babel/helper-create-regexp-features-plugin": "^7.12.1", - "@babel/helper-plugin-utils": "^7.10.4" + "@babel/helper-create-regexp-features-plugin": "^7.12.13", + "@babel/helper-plugin-utils": "^7.12.13" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-duplicate-keys": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-duplicate-keys/-/plugin-transform-duplicate-keys-7.12.1.tgz", - "integrity": "sha512-iRght0T0HztAb/CazveUpUQrZY+aGKKaWXMJ4uf9YJtqxSUe09j3wteztCUDRHs+SRAL7yMuFqUsLoAKKzgXjw==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-duplicate-keys/-/plugin-transform-duplicate-keys-7.12.13.tgz", + "integrity": "sha512-NfADJiiHdhLBW3pulJlJI2NB0t4cci4WTZ8FtdIuNc2+8pslXdPtRRAEWqUY+m9kNOk2eRYbTAOipAxlrOcwwQ==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4" + "@babel/helper-plugin-utils": "^7.12.13" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-exponentiation-operator": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-exponentiation-operator/-/plugin-transform-exponentiation-operator-7.12.1.tgz", - "integrity": "sha512-7tqwy2bv48q+c1EHbXK0Zx3KXd2RVQp6OC7PbwFNt/dPTAV3Lu5sWtWuAj8owr5wqtWnqHfl2/mJlUmqkChKug==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-exponentiation-operator/-/plugin-transform-exponentiation-operator-7.12.13.tgz", + "integrity": "sha512-fbUelkM1apvqez/yYx1/oICVnGo2KM5s63mhGylrmXUxK/IAXSIf87QIxVfZldWf4QsOafY6vV3bX8aMHSvNrA==", "dev": true, "requires": { - "@babel/helper-builder-binary-assignment-operator-visitor": "^7.10.4", - "@babel/helper-plugin-utils": "^7.10.4" + "@babel/helper-builder-binary-assignment-operator-visitor": "^7.12.13", + "@babel/helper-plugin-utils": "^7.12.13" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-for-of": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-for-of/-/plugin-transform-for-of-7.12.1.tgz", - "integrity": "sha512-Zaeq10naAsuHo7heQvyV0ptj4dlZJwZgNAtBYBnu5nNKJoW62m0zKcIEyVECrUKErkUkg6ajMy4ZfnVZciSBhg==", + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-for-of/-/plugin-transform-for-of-7.13.0.tgz", + "integrity": "sha512-IHKT00mwUVYE0zzbkDgNRP6SRzvfGCYsOxIRz8KsiaaHCcT9BWIkO+H9QRJseHBLOGBZkHUdHiqj6r0POsdytg==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4" + "@babel/helper-plugin-utils": "^7.13.0" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-function-name": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-function-name/-/plugin-transform-function-name-7.12.1.tgz", - "integrity": "sha512-JF3UgJUILoFrFMEnOJLJkRHSk6LUSXLmEFsA23aR2O5CSLUxbeUX1IZ1YQ7Sn0aXb601Ncwjx73a+FVqgcljVw==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-function-name/-/plugin-transform-function-name-7.12.13.tgz", + "integrity": "sha512-6K7gZycG0cmIwwF7uMK/ZqeCikCGVBdyP2J5SKNCXO5EOHcqi+z7Jwf8AmyDNcBgxET8DrEtCt/mPKPyAzXyqQ==", "dev": true, "requires": { - "@babel/helper-function-name": "^7.10.4", - "@babel/helper-plugin-utils": "^7.10.4" + "@babel/helper-function-name": "^7.12.13", + "@babel/helper-plugin-utils": "^7.12.13" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-literals": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-literals/-/plugin-transform-literals-7.12.1.tgz", - "integrity": "sha512-+PxVGA+2Ag6uGgL0A5f+9rklOnnMccwEBzwYFL3EUaKuiyVnUipyXncFcfjSkbimLrODoqki1U9XxZzTvfN7IQ==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-literals/-/plugin-transform-literals-7.12.13.tgz", + "integrity": "sha512-FW+WPjSR7hiUxMcKqyNjP05tQ2kmBCdpEpZHY1ARm96tGQCCBvXKnpjILtDplUnJ/eHZ0lALLM+d2lMFSpYJrQ==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4" + "@babel/helper-plugin-utils": "^7.12.13" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-member-expression-literals": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-member-expression-literals/-/plugin-transform-member-expression-literals-7.12.1.tgz", - "integrity": "sha512-1sxePl6z9ad0gFMB9KqmYofk34flq62aqMt9NqliS/7hPEpURUCMbyHXrMPlo282iY7nAvUB1aQd5mg79UD9Jg==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-member-expression-literals/-/plugin-transform-member-expression-literals-7.12.13.tgz", + "integrity": "sha512-kxLkOsg8yir4YeEPHLuO2tXP9R/gTjpuTOjshqSpELUN3ZAg2jfDnKUvzzJxObun38sw3wm4Uu69sX/zA7iRvg==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4" + "@babel/helper-plugin-utils": "^7.12.13" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-modules-amd": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-modules-amd/-/plugin-transform-modules-amd-7.12.1.tgz", - "integrity": "sha512-tDW8hMkzad5oDtzsB70HIQQRBiTKrhfgwC/KkJeGsaNFTdWhKNt/BiE8c5yj19XiGyrxpbkOfH87qkNg1YGlOQ==", + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-modules-amd/-/plugin-transform-modules-amd-7.13.0.tgz", + "integrity": "sha512-EKy/E2NHhY/6Vw5d1k3rgoobftcNUmp9fGjb9XZwQLtTctsRBOTRO7RHHxfIky1ogMN5BxN7p9uMA3SzPfotMQ==", "dev": true, "requires": { - "@babel/helper-module-transforms": "^7.12.1", - "@babel/helper-plugin-utils": "^7.10.4", + "@babel/helper-module-transforms": "^7.13.0", + "@babel/helper-plugin-utils": "^7.13.0", "babel-plugin-dynamic-import-node": "^2.3.3" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-modules-commonjs": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-modules-commonjs/-/plugin-transform-modules-commonjs-7.12.1.tgz", - "integrity": "sha512-dY789wq6l0uLY8py9c1B48V8mVL5gZh/+PQ5ZPrylPYsnAvnEMjqsUXkuoDVPeVK+0VyGar+D08107LzDQ6pag==", + "version": "7.13.8", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-modules-commonjs/-/plugin-transform-modules-commonjs-7.13.8.tgz", + "integrity": "sha512-9QiOx4MEGglfYZ4XOnU79OHr6vIWUakIj9b4mioN8eQIoEh+pf5p/zEB36JpDFWA12nNMiRf7bfoRvl9Rn79Bw==", "dev": true, "requires": { - "@babel/helper-module-transforms": "^7.12.1", - "@babel/helper-plugin-utils": "^7.10.4", - "@babel/helper-simple-access": "^7.12.1", + "@babel/helper-module-transforms": "^7.13.0", + "@babel/helper-plugin-utils": "^7.13.0", + "@babel/helper-simple-access": "^7.12.13", "babel-plugin-dynamic-import-node": "^2.3.3" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-modules-systemjs": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-modules-systemjs/-/plugin-transform-modules-systemjs-7.12.1.tgz", - "integrity": "sha512-Hn7cVvOavVh8yvW6fLwveFqSnd7rbQN3zJvoPNyNaQSvgfKmDBO9U1YL9+PCXGRlZD9tNdWTy5ACKqMuzyn32Q==", + "version": "7.13.8", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-modules-systemjs/-/plugin-transform-modules-systemjs-7.13.8.tgz", + "integrity": "sha512-hwqctPYjhM6cWvVIlOIe27jCIBgHCsdH2xCJVAYQm7V5yTMoilbVMi9f6wKg0rpQAOn6ZG4AOyvCqFF/hUh6+A==", "dev": true, "requires": { - "@babel/helper-hoist-variables": "^7.10.4", - "@babel/helper-module-transforms": "^7.12.1", - "@babel/helper-plugin-utils": "^7.10.4", - "@babel/helper-validator-identifier": "^7.10.4", + "@babel/helper-hoist-variables": "^7.13.0", + "@babel/helper-module-transforms": "^7.13.0", + "@babel/helper-plugin-utils": "^7.13.0", + "@babel/helper-validator-identifier": "^7.12.11", "babel-plugin-dynamic-import-node": "^2.3.3" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-modules-umd": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-modules-umd/-/plugin-transform-modules-umd-7.12.1.tgz", - "integrity": "sha512-aEIubCS0KHKM0zUos5fIoQm+AZUMt1ZvMpqz0/H5qAQ7vWylr9+PLYurT+Ic7ID/bKLd4q8hDovaG3Zch2uz5Q==", + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-modules-umd/-/plugin-transform-modules-umd-7.13.0.tgz", + "integrity": "sha512-D/ILzAh6uyvkWjKKyFE/W0FzWwasv6vPTSqPcjxFqn6QpX3u8DjRVliq4F2BamO2Wee/om06Vyy+vPkNrd4wxw==", "dev": true, "requires": { - "@babel/helper-module-transforms": "^7.12.1", - "@babel/helper-plugin-utils": "^7.10.4" + "@babel/helper-module-transforms": "^7.13.0", + "@babel/helper-plugin-utils": "^7.13.0" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-named-capturing-groups-regex": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-named-capturing-groups-regex/-/plugin-transform-named-capturing-groups-regex-7.12.1.tgz", - "integrity": "sha512-tB43uQ62RHcoDp9v2Nsf+dSM8sbNodbEicbQNA53zHz8pWUhsgHSJCGpt7daXxRydjb0KnfmB+ChXOv3oADp1Q==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-named-capturing-groups-regex/-/plugin-transform-named-capturing-groups-regex-7.12.13.tgz", + "integrity": "sha512-Xsm8P2hr5hAxyYblrfACXpQKdQbx4m2df9/ZZSQ8MAhsadw06+jW7s9zsSw6he+mJZXRlVMyEnVktJo4zjk1WA==", "dev": true, "requires": { - "@babel/helper-create-regexp-features-plugin": "^7.12.1" + "@babel/helper-create-regexp-features-plugin": "^7.12.13" } }, "@babel/plugin-transform-new-target": { - "version": "7.12.1", - "resolved": "https://registry.npmjs.org/@babel/plugin-transform-new-target/-/plugin-transform-new-target-7.12.1.tgz", - "integrity": "sha512-+eW/VLcUL5L9IvJH7rT1sT0CzkdUTvPrXC2PXTn/7z7tXLBuKvezYbGdxD5WMRoyvyaujOq2fWoKl869heKjhw==", + "version": "7.12.13", + "resolved": "https://registry.npmjs.org/@babel/plugin-transform-new-target/-/plugin-transform-new-target-7.12.13.tgz", + "integrity": "sha512-/KY2hbLxrG5GTQ9zzZSc3xWiOy379pIETEhbtzwZcw9rvuaVV4Fqy7BYGYOWZnaoXIQYbbJ0ziXLa/sKcGCYEQ==", "dev": true, "requires": { - "@babel/helper-plugin-utils": "^7.10.4" + "@babel/helper-plugin-utils": "^7.12.13" + }, + "dependencies": { + "@babel/helper-plugin-utils": { + "version": "7.13.0", + "resolved": "https://registry.npmjs.org/@babel/helper-plugin-utils/-/helper-plugin-utils-7.13.0.tgz", + "integrity": "sha512-ZPafIPSwzUlAoWT8DKs1W2VyF2gOWthGd5NGFMsBcMMol+ZhK+EQY/e6V96poa6PA/Bh+C9plWN0hXO1uB8AfQ==", + "dev": true + } } }, "@babel/plugin-transform-object-super": { @@ -1475,102 +2127,244 @@ } } }, - "@fluentui/date-time-utilities": { - "version": "7.9.0", - "resolved": "https://registry.npmjs.org/@fluentui/date-time-utilities/-/date-time-utilities-7.9.0.tgz", - "integrity": "sha512-D8p5WWeonqRO1EgIvo7WSlX1rcm87r2VQd62zTJPQImx8rpwc77CRI+iAvfxyVHRZMdt4Qk6Jq99dUaudPWaZw==", - "requires": { - "@uifabric/set-version": "^7.0.23", - "tslib": "^1.10.0" - } - }, "@fluentui/dom-utilities": { - "version": "1.1.1", - "resolved": "https://registry.npmjs.org/@fluentui/dom-utilities/-/dom-utilities-1.1.1.tgz", - "integrity": "sha512-w40gi8fzCpwa7U8cONiuu8rszPStkVOL/weDf5pCbYEb1gdaV7MDPSNkgM6IV0Kz+k017noDgK9Fv4ru1Dwz1g==", + "version": "2.1.0", + "resolved": "https://registry.npmjs.org/@fluentui/dom-utilities/-/dom-utilities-2.1.0.tgz", + "integrity": "sha512-DMr0uH4EtyXgdpVLyvWq60YtWN38jx22rtdsEIbbBNYcFgcl3rRa7M8p/rnaw/k/KWX35H40AYga1SM6Zgpyww==", "requires": { - "@uifabric/set-version": "^7.0.23", - "tslib": "^1.10.0" - } - }, - "@fluentui/keyboard-key": { - "version": "0.2.12", - "resolved": "https://registry.npmjs.org/@fluentui/keyboard-key/-/keyboard-key-0.2.12.tgz", - "integrity": "sha512-t3yIbbPKJubb22vQ/FIWwS9vFAzaPYzFxKWPHVWLtxs/P+5yL+LD3B16DRtYreWAdl9CZvEbos58ChLZ0KHwSQ==", - "requires": { - "tslib": "^1.10.0" - } - }, - "@fluentui/react-focus": { - "version": "7.17.1", - "resolved": "https://registry.npmjs.org/@fluentui/react-focus/-/react-focus-7.17.1.tgz", - "integrity": "sha512-Nulq2pE4pX6Pf+tGZl8uLp8VfqUzx3elC5v7QvYSBdjnZK8ykitdsa+Sd3PKYWW2EMlzVRSptlzbuJ6JyEDQKQ==", - "requires": { - "@fluentui/keyboard-key": "^0.2.12", - "@uifabric/merge-styles": "^7.19.1", - "@uifabric/set-version": "^7.0.23", - "@uifabric/styling": "^7.16.19", - "@uifabric/utilities": "^7.33.2", - "tslib": "^1.10.0" + "@fluentui/set-version": "^8.1.0", + "tslib": "^2.1.0" }, "dependencies": { - "@uifabric/styling": { - "version": "7.16.19", - "resolved": "https://registry.npmjs.org/@uifabric/styling/-/styling-7.16.19.tgz", - "integrity": "sha512-T5fjUCx0LbzUC8Myw15YCaBjdGbSrihWSiPHtLVW77k59yWAW947XnH73QngE8xU7kyKPH3AhQrUEBMB2NjHag==", - "requires": { - "@fluentui/theme": "^1.7.1", - "@microsoft/load-themed-styles": "^1.10.26", - "@uifabric/merge-styles": "^7.19.1", - "@uifabric/set-version": "^7.0.23", - "@uifabric/utilities": "^7.33.2", - "tslib": "^1.10.0" - } + "tslib": { + "version": "2.2.0", + "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.2.0.tgz", + "integrity": "sha512-gS9GVHRU+RGn5KQM2rllAlR3dU6m7AcpJKdtH8gFvQiC4Otgk98XnmMU+nZenHt/+VhnBPWwgrJsyrdcw6i23w==" } } }, - "@fluentui/react-icons": { - "version": "0.3.9", - "resolved": "https://registry.npmjs.org/@fluentui/react-icons/-/react-icons-0.3.9.tgz", - "integrity": "sha512-xGisio0Ds8/TWkbERtg6akoegp68/Vop3n6eD7X+0HqVL0rOl44iW+cmQrnOh1xIWiz7EqLVQU0w70bL2oLCGw==", + "@fluentui/font-icons-mdl2": { + "version": "8.1.0", + "resolved": "https://registry.npmjs.org/@fluentui/font-icons-mdl2/-/font-icons-mdl2-8.1.0.tgz", + "integrity": "sha512-U0nAsv/vULZ4ezHDw0umk4mijSot9BNDXl0dZ4ZatxLBr8JZkNgTDowBZ9aEyWuFukZ6Lf0V/eEPIeJULrUDfw==", "requires": { - "@microsoft/load-themed-styles": "^1.10.26", - "@uifabric/set-version": "^7.0.23", - "@uifabric/utilities": "^7.33.2", - "tslib": "^1.10.0" + "@fluentui/set-version": "^8.1.0", + "@fluentui/style-utilities": "^8.1.0", + "tslib": "^2.1.0" + }, + "dependencies": { + "tslib": { + "version": "2.2.0", + "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.2.0.tgz", + "integrity": "sha512-gS9GVHRU+RGn5KQM2rllAlR3dU6m7AcpJKdtH8gFvQiC4Otgk98XnmMU+nZenHt/+VhnBPWwgrJsyrdcw6i23w==" + } } }, - "@fluentui/react-window-provider": { - "version": "1.0.1", - "resolved": "https://registry.npmjs.org/@fluentui/react-window-provider/-/react-window-provider-1.0.1.tgz", - "integrity": "sha512-5hvruDyF0uE8+6YN6Y+d2sEzexBadxUNxUjDcDreTPsmtHPwF5FPBYLhoD7T84L5U4YNvKxKh25tYJm6E0GE2w==", + "@fluentui/foundation-legacy": { + "version": "8.1.0", + "resolved": "https://registry.npmjs.org/@fluentui/foundation-legacy/-/foundation-legacy-8.1.0.tgz", + "integrity": "sha512-GC6MkfcBbfqltgKe0hi4Wq0DTj8UxSFUdoOG9QQDLjIjI1r+L935ba0x91phqB9nptJCp+5TjkTtz7Q1lJ97Tw==", "requires": { - "@uifabric/set-version": "^7.0.23", - "tslib": "^1.10.0" + "@fluentui/merge-styles": "^8.1.0", + "@fluentui/set-version": "^8.1.0", + "@fluentui/style-utilities": "^8.1.0", + "@fluentui/utilities": "^8.1.0", + "tslib": "^2.1.0" + }, + "dependencies": { + "tslib": { + "version": "2.2.0", + "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.2.0.tgz", + "integrity": "sha512-gS9GVHRU+RGn5KQM2rllAlR3dU6m7AcpJKdtH8gFvQiC4Otgk98XnmMU+nZenHt/+VhnBPWwgrJsyrdcw6i23w==" + } + } + }, + "@fluentui/merge-styles": { + "version": "8.1.0", + "resolved": "https://registry.npmjs.org/@fluentui/merge-styles/-/merge-styles-8.1.0.tgz", + "integrity": "sha512-afJ8rw1V3sfgzfufP7ockcP5AxiQN7VlqKo6JoCSZbWC2ypQ0DZre7d3k+Zj2LvjCrM8HM57YEfwXWT/WxGfqw==", + "requires": { + "@fluentui/set-version": "^8.1.0", + "tslib": "^2.1.0" + }, + "dependencies": { + "tslib": { + "version": "2.2.0", + "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.2.0.tgz", + "integrity": "sha512-gS9GVHRU+RGn5KQM2rllAlR3dU6m7AcpJKdtH8gFvQiC4Otgk98XnmMU+nZenHt/+VhnBPWwgrJsyrdcw6i23w==" + } + } + }, + "@fluentui/react": { + "version": "8.14.3", + "resolved": "https://registry.npmjs.org/@fluentui/react/-/react-8.14.3.tgz", + "integrity": "sha512-Gp4VBtZk5h5kXpu1vU+KvTvcRaMleD5Yl7c5XLmRVyEfofgw1Sd+M7h+1aQkwHPxvl9h7ebaJce3PbJ+xuE7Ag==", + "requires": { + "@fluentui/date-time-utilities": "^8.1.0", + "@fluentui/font-icons-mdl2": "^8.1.0", + "@fluentui/foundation-legacy": "^8.1.0", + "@fluentui/merge-styles": "^8.1.0", + "@fluentui/react-focus": "^8.1.0", + "@fluentui/react-hooks": "^8.2.0", + "@fluentui/react-window-provider": "^2.1.0", + "@fluentui/set-version": "^8.1.0", + "@fluentui/style-utilities": "^8.1.0", + "@fluentui/theme": "^2.1.0", + "@fluentui/utilities": "^8.1.0", + "@microsoft/load-themed-styles": "^1.10.26", + "tslib": "^2.1.0" + }, + "dependencies": { + "@fluentui/date-time-utilities": { + "version": "8.1.0", + "resolved": "https://registry.npmjs.org/@fluentui/date-time-utilities/-/date-time-utilities-8.1.0.tgz", + "integrity": "sha512-1PSp/ufi5urnvxkbT9Lijsh7Y2PNEsZfpNXDVwOpPDqpRkRrd8Wr8IdRPQk7w6XLZIeDCiWIBXBRYCVp6KGbYg==", + "requires": { + "@fluentui/set-version": "^8.1.0", + "tslib": "^2.1.0" + } + }, + "@fluentui/react-window-provider": { + "version": "2.1.0", + "resolved": "https://registry.npmjs.org/@fluentui/react-window-provider/-/react-window-provider-2.1.0.tgz", + "integrity": "sha512-LcNni1utHiXiCu8EbXL42o118yNRAWKX15qKd0iyMqcUg5RplOdWuaniohXv2gsmdNB0l3F5Tnujgayy0xPlvQ==", + "requires": { + "@fluentui/set-version": "^8.1.0", + "tslib": "^2.1.0" + } + }, + "tslib": { + "version": "2.2.0", + "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.2.0.tgz", + "integrity": "sha512-gS9GVHRU+RGn5KQM2rllAlR3dU6m7AcpJKdtH8gFvQiC4Otgk98XnmMU+nZenHt/+VhnBPWwgrJsyrdcw6i23w==" + } + } + }, + "@fluentui/react-focus": { + "version": "8.1.0", + "resolved": "https://registry.npmjs.org/@fluentui/react-focus/-/react-focus-8.1.0.tgz", + "integrity": "sha512-yzfDnDrnHq5z4Nt1xY7LS+DtjbJmCdpDiTiQm8tnCj98qESzqqqAwjpSc+HFXVexBzlmPNf1hzc8BMCQOUF/7g==", + "requires": { + "@fluentui/keyboard-key": "^0.3.0", + "@fluentui/merge-styles": "^8.1.0", + "@fluentui/set-version": "^8.1.0", + "@fluentui/style-utilities": "^8.1.0", + "@fluentui/utilities": "^8.1.0", + "tslib": "^2.1.0" + }, + "dependencies": { + "@fluentui/keyboard-key": { + "version": "0.3.0", + "resolved": "https://registry.npmjs.org/@fluentui/keyboard-key/-/keyboard-key-0.3.0.tgz", + "integrity": "sha512-5GZ9038lwNK5BcgFkbXJs6zpZUlmyrszWbKPMqcHysMFBbL569VwV7zQt/yF3ivL0L4k46C+uXHbnFbMgZEJ4w==", + "requires": { + "tslib": "^2.1.0" + } + }, + "tslib": { + "version": "2.2.0", + "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.2.0.tgz", + "integrity": "sha512-gS9GVHRU+RGn5KQM2rllAlR3dU6m7AcpJKdtH8gFvQiC4Otgk98XnmMU+nZenHt/+VhnBPWwgrJsyrdcw6i23w==" + } + } + }, + "@fluentui/react-hooks": { + "version": "8.2.0", + "resolved": "https://registry.npmjs.org/@fluentui/react-hooks/-/react-hooks-8.2.0.tgz", + "integrity": "sha512-FnmtkDurjnLXN/VssBnQQ19RGY3mUh+rLiYa4VRBWRIh1JTs7o6DGCu+IijvvFNzTHvsMgL/O3v/2UjXShO6uQ==", + "requires": { + "@fluentui/react-window-provider": "^2.1.0", + "@fluentui/set-version": "^8.1.0", + "@fluentui/utilities": "^8.1.0", + "tslib": "^2.1.0" + }, + "dependencies": { + "@fluentui/react-window-provider": { + "version": "2.1.0", + "resolved": "https://registry.npmjs.org/@fluentui/react-window-provider/-/react-window-provider-2.1.0.tgz", + "integrity": "sha512-LcNni1utHiXiCu8EbXL42o118yNRAWKX15qKd0iyMqcUg5RplOdWuaniohXv2gsmdNB0l3F5Tnujgayy0xPlvQ==", + "requires": { + "@fluentui/set-version": "^8.1.0", + "tslib": "^2.1.0" + } + }, + "tslib": { + "version": "2.2.0", + "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.2.0.tgz", + "integrity": "sha512-gS9GVHRU+RGn5KQM2rllAlR3dU6m7AcpJKdtH8gFvQiC4Otgk98XnmMU+nZenHt/+VhnBPWwgrJsyrdcw6i23w==" + } + } + }, + "@fluentui/set-version": { + "version": "8.1.0", + "resolved": "https://registry.npmjs.org/@fluentui/set-version/-/set-version-8.1.0.tgz", + "integrity": "sha512-FhruPyh+VoAVmqAadRxawMNB13syBLoT6PePdZ+sKW7rZVc2CWT3qw7w9O9x6MJeRNl6/6ZnjCo6sWyOyVEdNg==", + "requires": { + "tslib": "^2.1.0" + }, + "dependencies": { + "tslib": { + "version": "2.2.0", + "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.2.0.tgz", + "integrity": "sha512-gS9GVHRU+RGn5KQM2rllAlR3dU6m7AcpJKdtH8gFvQiC4Otgk98XnmMU+nZenHt/+VhnBPWwgrJsyrdcw6i23w==" + } + } + }, + "@fluentui/style-utilities": { + "version": "8.1.0", + "resolved": "https://registry.npmjs.org/@fluentui/style-utilities/-/style-utilities-8.1.0.tgz", + "integrity": "sha512-XUH+8T7/2HAMYzTLr20odD5lfKy56fJooFlkSmW0SSC6sOilHmrdPZCBSTV+WJzH/YY2ed/GnySIjCQOx5UsYg==", + "requires": { + "@fluentui/merge-styles": "^8.1.0", + "@fluentui/set-version": "^8.1.0", + "@fluentui/theme": "^2.1.0", + "@fluentui/utilities": "^8.1.0", + "@microsoft/load-themed-styles": "^1.10.26", + "tslib": "^2.1.0" + }, + "dependencies": { + "tslib": { + "version": "2.2.0", + "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.2.0.tgz", + "integrity": "sha512-gS9GVHRU+RGn5KQM2rllAlR3dU6m7AcpJKdtH8gFvQiC4Otgk98XnmMU+nZenHt/+VhnBPWwgrJsyrdcw6i23w==" + } } }, "@fluentui/theme": { - "version": "1.7.1", - "resolved": "https://registry.npmjs.org/@fluentui/theme/-/theme-1.7.1.tgz", - "integrity": "sha512-cwx8gJ0O9d+Z8g6Lq7BgDgH8XPfSloUSy0GN3fWHJGrDCBPcnmz6/GKbbvxw9PZ2t1iNcAzJEJNT6NyuOOobPA==", + "version": "2.1.0", + "resolved": "https://registry.npmjs.org/@fluentui/theme/-/theme-2.1.0.tgz", + "integrity": "sha512-2jFun5LqUZJb+AiWeLOnNQTxrKWMCNHFTs4+QIUyL7ZPMAiNZyWMsQJfeGOujzdlReivZ7kONNQEi0LTJ0Tmzw==", "requires": { - "@uifabric/merge-styles": "^7.19.1", - "@uifabric/set-version": "^7.0.23", - "@uifabric/utilities": "^7.33.2", - "tslib": "^1.10.0" + "@fluentui/merge-styles": "^8.1.0", + "@fluentui/set-version": "^8.1.0", + "@fluentui/utilities": "^8.1.0", + "tslib": "^2.1.0" + }, + "dependencies": { + "tslib": { + "version": "2.2.0", + "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.2.0.tgz", + "integrity": "sha512-gS9GVHRU+RGn5KQM2rllAlR3dU6m7AcpJKdtH8gFvQiC4Otgk98XnmMU+nZenHt/+VhnBPWwgrJsyrdcw6i23w==" + } } }, - "@hapi/address": { - "version": "2.1.4", - "resolved": "https://registry.npmjs.org/@hapi/address/-/address-2.1.4.tgz", - "integrity": "sha512-QD1PhQk+s31P1ixsX0H0Suoupp3VMXzIVMSwobR3F3MSUO2YCV0B7xqLcUw/Bh8yuvd3LhpyqLQWTNcRmp6IdQ==", - "dev": true - }, - "@hapi/bourne": { - "version": "1.3.2", - "resolved": "https://registry.npmjs.org/@hapi/bourne/-/bourne-1.3.2.tgz", - "integrity": "sha512-1dVNHT76Uu5N3eJNTYcvxee+jzX4Z9lfciqRRHCU27ihbUcYi+iSc2iml5Ke1LXe1SyJCLA0+14Jh4tXJgOppA==", - "dev": true + "@fluentui/utilities": { + "version": "8.1.0", + "resolved": "https://registry.npmjs.org/@fluentui/utilities/-/utilities-8.1.0.tgz", + "integrity": "sha512-/yHnDkrIlyn/Jy3XWccNRyuujQDgUxz44OQDEiMSko50S/L7cVeWdIzG/CiIsCnKAgU4/QyzRo40Wdy3rdM8ag==", + "requires": { + "@fluentui/dom-utilities": "^2.1.0", + "@fluentui/merge-styles": "^8.1.0", + "@fluentui/set-version": "^8.1.0", + "tslib": "^2.1.0" + }, + "dependencies": { + "tslib": { + "version": "2.2.0", + "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.2.0.tgz", + "integrity": "sha512-gS9GVHRU+RGn5KQM2rllAlR3dU6m7AcpJKdtH8gFvQiC4Otgk98XnmMU+nZenHt/+VhnBPWwgrJsyrdcw6i23w==" + } + } }, "@hapi/formula": { "version": "2.0.0", @@ -1578,39 +2372,12 @@ "integrity": "sha512-V87P8fv7PI0LH7LiVi8Lkf3x+KCO7pQozXRssAHNXXL9L1K+uyu4XypLXwxqVDKgyQai6qj3/KteNlrqDx4W5A==", "dev": true }, - "@hapi/hoek": { - "version": "8.5.1", - "resolved": "https://registry.npmjs.org/@hapi/hoek/-/hoek-8.5.1.tgz", - "integrity": "sha512-yN7kbciD87WzLGc5539Tn0sApjyiGHAJgKvG9W8C7O+6c7qmoQMfVs0W4bX17eqz6C78QJqqFrtgdK5EWf6Qow==", - "dev": true - }, - "@hapi/joi": { - "version": "15.1.1", - "resolved": "https://registry.npmjs.org/@hapi/joi/-/joi-15.1.1.tgz", - "integrity": "sha512-entf8ZMOK8sc+8YfeOlM8pCfg3b5+WZIKBfUaaJT8UsjAAPjartzxIYm3TIbjvA4u+u++KbcXD38k682nVHDAQ==", - "dev": true, - "requires": { - "@hapi/address": "2.x.x", - "@hapi/bourne": "1.x.x", - "@hapi/hoek": "8.x.x", - "@hapi/topo": "3.x.x" - } - }, "@hapi/pinpoint": { "version": "2.0.0", "resolved": "https://registry.npmjs.org/@hapi/pinpoint/-/pinpoint-2.0.0.tgz", "integrity": "sha512-vzXR5MY7n4XeIvLpfl3HtE3coZYO4raKXW766R6DZw/6aLqR26iuZ109K7a0NtF2Db0jxqh7xz2AxkUwpUFybw==", "dev": true }, - "@hapi/topo": { - "version": "3.1.6", - "resolved": "https://registry.npmjs.org/@hapi/topo/-/topo-3.1.6.tgz", - "integrity": "sha512-tAag0jEcjwH+P2quUfipd7liWCNX2F8NvYjQp2wtInsZxnMlypdw0FtAOLxtvvkO+GSRRbmNi8m/5y42PQJYCQ==", - "dev": true, - "requires": { - "@hapi/hoek": "^8.3.0" - } - }, "@icons/material": { "version": "0.2.4", "resolved": "https://registry.npmjs.org/@icons/material/-/material-0.2.4.tgz", @@ -1655,6 +2422,17 @@ "dev": true, "requires": { "p-limit": "^2.2.0" + }, + "dependencies": { + "p-limit": { + "version": "2.3.0", + "resolved": "https://registry.npmjs.org/p-limit/-/p-limit-2.3.0.tgz", + "integrity": "sha512-//88mFWSJx8lxCzwdAABTJL2MyWB12+eIY7MDL2SqLmAkeKU9qxRvWuSyTjm3FUmpBEMuFfckAIqEaVGUDxb6w==", + "dev": true, + "requires": { + "p-try": "^2.0.0" + } + } } }, "path-exists": { @@ -1672,9 +2450,9 @@ } }, "@istanbuljs/schema": { - "version": "0.1.2", - "resolved": "https://registry.npmjs.org/@istanbuljs/schema/-/schema-0.1.2.tgz", - "integrity": "sha512-tsAQNx32a8CoFhjhijUIhI4kccIAgmGhy8LZMZgGfmXcpMbPRUqn5LWmgRttILi6yeGmBJd2xsPkFMs0PzgPCw==", + "version": "0.1.3", + "resolved": "https://registry.npmjs.org/@istanbuljs/schema/-/schema-0.1.3.tgz", + "integrity": "sha512-ZXRY4jNvVgSVQ8DL3LTcakaAtXwTVUxE81hslsyD2AtoXW/wVob10HkOJ1X/pAlcI7D+2YoZKg5do8G/w6RYgA==", "dev": true }, "@jest/console": { @@ -1814,9 +2592,9 @@ } }, "@types/yargs": { - "version": "15.0.12", - "resolved": "https://registry.npmjs.org/@types/yargs/-/yargs-15.0.12.tgz", - "integrity": "sha512-f+fD/fQAo3BCbCDlrUpznF1A5Zp9rB0noS5vnoormHSIPFKL0Z2DcUJ3Gxp5ytH4uLRNxy7AwYUC9exZzqGMAw==", + "version": "15.0.13", + "resolved": "https://registry.npmjs.org/@types/yargs/-/yargs-15.0.13.tgz", + "integrity": "sha512-kQ5JNTrbDv3Rp5X2n/iUu37IJBDU2gsZ5R/g1/KHOOEc5IKfUFjXT6DENPGduh08I/pamwtEq4oul7gUqKTQDQ==", "dev": true, "requires": { "@types/yargs-parser": "*" @@ -2191,12 +2969,6 @@ "@types/yargs": "^13.0.0" } }, - "@jonkemp/package-utils": { - "version": "1.0.7", - "resolved": "https://registry.npmjs.org/@jonkemp/package-utils/-/package-utils-1.0.7.tgz", - "integrity": "sha512-OoK+K1RmhtS8SlORrlH7sW0CNdrnm0BxKNcv4pQIk6y6VORsHiX91gV3dh6XD2eS7J+iCXROcu5sGuH0tjmNEQ==", - "dev": true - }, "@jupyterlab/apputils": { "version": "3.0.2", "resolved": "https://registry.npmjs.org/@jupyterlab/apputils/-/apputils-3.0.2.tgz", @@ -2226,6 +2998,16 @@ "url": "^0.11.0" }, "dependencies": { + "@types/react": { + "version": "17.0.3", + "resolved": "https://registry.npmjs.org/@types/react/-/react-17.0.3.tgz", + "integrity": "sha512-wYOUxIgs2HZZ0ACNiIayItyluADNbONl7kt8lkLjVK8IitMH5QMyAh75Fwhmo37r1m7L2JaFj03sIfxBVDvRAg==", + "requires": { + "@types/prop-types": "*", + "@types/scheduler": "*", + "csstype": "^3.0.2" + } + }, "buffer": { "version": "5.7.1", "resolved": "https://registry.npmjs.org/buffer/-/buffer-5.7.1.tgz", @@ -2235,10 +3017,36 @@ "ieee754": "^1.1.13" } }, + "csstype": { + "version": "3.0.7", + "resolved": "https://registry.npmjs.org/csstype/-/csstype-3.0.7.tgz", + "integrity": "sha512-KxnUB0ZMlnUWCsx2Z8MUsr6qV6ja1w9ArPErJaJaF8a5SOWoHLIszeCTKGRGRgtLgYrs1E8CHkNSP1VZTTPc9g==" + }, + "htmlparser2": { + "version": "4.1.0", + "resolved": "https://registry.npmjs.org/htmlparser2/-/htmlparser2-4.1.0.tgz", + "integrity": "sha512-4zDq1a1zhE4gQso/c5LP1OtrhYTncXNSpvJYtWJBtXAETPlMfi3IFNjGuQbYLuVY4ZR0QMqRVvo4Pdy9KLyP8Q==", + "requires": { + "domelementtype": "^2.0.1", + "domhandler": "^3.0.0", + "domutils": "^2.0.0", + "entities": "^2.0.0" + } + }, + "postcss": { + "version": "7.0.35", + "resolved": "https://registry.npmjs.org/postcss/-/postcss-7.0.35.tgz", + "integrity": "sha512-3QT8bBJeX/S5zKTTjTCIjRF3If4avAT6kqxcASlTWEtAFCb9NH0OUxNDfgZSWdP5fJnBYCMEWkIFfWeugjzYMg==", + "requires": { + "chalk": "^2.4.2", + "source-map": "^0.6.1", + "supports-color": "^6.1.0" + } + }, "react": { - "version": "17.0.1", - "resolved": "https://registry.npmjs.org/react/-/react-17.0.1.tgz", - "integrity": "sha512-lG9c9UuMHdcAexXtigOZLX8exLWkW0Ku29qPRU8uhF2R9BN96dLCt0psvzPLlHc5OWkgymP3qwTRgbnw5BKx3w==", + "version": "17.0.2", + "resolved": "https://registry.npmjs.org/react/-/react-17.0.2.tgz", + "integrity": "sha512-gnhPt75i/dq/z3/6q/0asP78D0u592D5L1pd7M8P+dck6Fu/jJeL6iVVK23fptSUZj8Vjf++7wXA8UNclGQcbA==", "requires": { "loose-envify": "^1.1.0", "object-assign": "^4.1.1" @@ -2253,6 +3061,30 @@ "object-assign": "^4.1.1", "scheduler": "^0.20.1" } + }, + "sanitize-html": { + "version": "1.27.5", + "resolved": "https://registry.npmjs.org/sanitize-html/-/sanitize-html-1.27.5.tgz", + "integrity": "sha512-M4M5iXDAUEcZKLXkmk90zSYWEtk5NH3JmojQxKxV371fnMh+x9t1rqdmXaGoyEHw3z/X/8vnFhKjGL5xFGOJ3A==", + "requires": { + "htmlparser2": "^4.1.0", + "lodash": "^4.17.15", + "parse-srcset": "^1.0.2", + "postcss": "^7.0.27" + } + }, + "source-map": { + "version": "0.6.1", + "resolved": "https://registry.npmjs.org/source-map/-/source-map-0.6.1.tgz", + "integrity": "sha512-UjgapumWlbMhkBgzT7Ykc5YXUT46F0iKu8SGXq0bcwP5dz/h0Plj6enJqjz1Zbq2l5WaqYnrVbwWOWMyF3F47g==" + }, + "supports-color": { + "version": "6.1.0", + "resolved": "https://registry.npmjs.org/supports-color/-/supports-color-6.1.0.tgz", + "integrity": "sha512-qe1jfm1Mg7Nq/NSh6XE24gPXROEVsWHxC1LIx//XNlD9iw7YZQGjZNjYN7xGaEG6iKdA8EtNFW6R0gjnVXp+wQ==", + "requires": { + "has-flag": "^3.0.0" + } } } }, @@ -2380,9 +3212,9 @@ }, "dependencies": { "react": { - "version": "17.0.1", - "resolved": "https://registry.npmjs.org/react/-/react-17.0.1.tgz", - "integrity": "sha512-lG9c9UuMHdcAexXtigOZLX8exLWkW0Ku29qPRU8uhF2R9BN96dLCt0psvzPLlHc5OWkgymP3qwTRgbnw5BKx3w==", + "version": "17.0.2", + "resolved": "https://registry.npmjs.org/react/-/react-17.0.2.tgz", + "integrity": "sha512-gnhPt75i/dq/z3/6q/0asP78D0u592D5L1pd7M8P+dck6Fu/jJeL6iVVK23fptSUZj8Vjf++7wXA8UNclGQcbA==", "requires": { "loose-envify": "^1.1.0", "object-assign": "^4.1.1" @@ -2519,64 +3351,66 @@ } }, "@microsoft/applicationinsights-analytics-js": { - "version": "2.5.9", - "resolved": "https://registry.npmjs.org/@microsoft/applicationinsights-analytics-js/-/applicationinsights-analytics-js-2.5.9.tgz", - "integrity": "sha512-9L3fb1H1as+J3J2j2EDx1HEMdrucjgR4INqahy+ZAxDPFvR3HCOedYzx645zObBIPu7QkH2LAjPk4fuNGHR1rg==", + "version": "2.6.1", + "resolved": "https://registry.npmjs.org/@microsoft/applicationinsights-analytics-js/-/applicationinsights-analytics-js-2.6.1.tgz", + "integrity": "sha512-wRH67jZTPy6SP54ygAQsFXu5ZnfzGOoMkA6ll1pkhSC4hij7Cvzumr4PYkr2gIPBPxD354sLOjBL/lmOgBTc5g==", "requires": { - "@microsoft/applicationinsights-common": "2.5.9", - "@microsoft/applicationinsights-core-js": "2.5.9", + "@microsoft/applicationinsights-common": "2.6.1", + "@microsoft/applicationinsights-core-js": "2.6.1", "@microsoft/applicationinsights-shims": "1.0.3", - "@microsoft/dynamicproto-js": "^1.0.0" + "@microsoft/dynamicproto-js": "^1.1.1" } }, "@microsoft/applicationinsights-channel-js": { - "version": "2.5.9", - "resolved": "https://registry.npmjs.org/@microsoft/applicationinsights-channel-js/-/applicationinsights-channel-js-2.5.9.tgz", - "integrity": "sha512-NAQ/2wWmD+gaIZDCMzzwxm8RcbswDvUO5BYeuW9UHJaFuEZ9o9xpztKVz32u4CMv7OI/mLOqnmR4rb0d+kUMwQ==", + "version": "2.6.1", + "resolved": "https://registry.npmjs.org/@microsoft/applicationinsights-channel-js/-/applicationinsights-channel-js-2.6.1.tgz", + "integrity": "sha512-oatERKW3eAjVNm5ej2NpRvBCCtPtiINIKxLiWVHv2SC2rzGrUnxNWFlUJojRT+u5ZXXsB51Ktw9gx8iHexnDVw==", "requires": { - "@microsoft/applicationinsights-common": "2.5.9", - "@microsoft/applicationinsights-core-js": "2.5.9", + "@microsoft/applicationinsights-common": "2.6.1", + "@microsoft/applicationinsights-core-js": "2.6.1", "@microsoft/applicationinsights-shims": "1.0.3", - "@microsoft/dynamicproto-js": "^1.0.0" + "@microsoft/dynamicproto-js": "^1.1.1" } }, "@microsoft/applicationinsights-common": { - "version": "2.5.9", - "resolved": "https://registry.npmjs.org/@microsoft/applicationinsights-common/-/applicationinsights-common-2.5.9.tgz", - "integrity": "sha512-dKmXO9m55uRDhpoa0P7l+BApf+lsrqjgoLeKv+ABM8ygIyd9JH6CDcdaT3af+kUFtt9Oj3ChyfueKr1EVOdGkQ==", + "version": "2.6.1", + "resolved": "https://registry.npmjs.org/@microsoft/applicationinsights-common/-/applicationinsights-common-2.6.1.tgz", + "integrity": "sha512-kV/dI9UwTew3mq+3F3Tkl2dBn2C4+FOOG3S5cS7/SssVsUlvLrWXBrOOxfIJ7+EjQQ6ijcqlDus4Nz7Ms2Kk2Q==", "requires": { - "@microsoft/applicationinsights-core-js": "2.5.9", - "@microsoft/applicationinsights-shims": "1.0.3" + "@microsoft/applicationinsights-core-js": "2.6.1", + "@microsoft/applicationinsights-shims": "1.0.3", + "@microsoft/dynamicproto-js": "^1.1.1" } }, "@microsoft/applicationinsights-core-js": { - "version": "2.5.9", - "resolved": "https://registry.npmjs.org/@microsoft/applicationinsights-core-js/-/applicationinsights-core-js-2.5.9.tgz", - "integrity": "sha512-KE9h1wmC/Ckm7jYjsMF1SEWQnk0v0CRzZq1upSARgPH7BgmyClXz1kdnLtuTWz8Aha8IIH9dW2hUOfPCdR+BpQ==", + "version": "2.6.1", + "resolved": "https://registry.npmjs.org/@microsoft/applicationinsights-core-js/-/applicationinsights-core-js-2.6.1.tgz", + "integrity": "sha512-SFnTx48BGkmz6P9GvXFeIZ641vnfrKo0hB74Hp9GR7UE3hqIDuomIBQS17unnh05T5w3PWKlDCGNpiCbJV6kzQ==", "requires": { "@microsoft/applicationinsights-shims": "1.0.3", - "@microsoft/dynamicproto-js": "^1.0.0" + "@microsoft/dynamicproto-js": "^1.1.1" } }, "@microsoft/applicationinsights-dependencies-js": { - "version": "2.5.9", - "resolved": "https://registry.npmjs.org/@microsoft/applicationinsights-dependencies-js/-/applicationinsights-dependencies-js-2.5.9.tgz", - "integrity": "sha512-pNM/dkUOscV0ul/YJe928+77EBtRkRXO/le/VWzlunoUFaEEo4pirc7NycvPx9w/KxA62JMEogbQsWE6nAmqPg==", + "version": "2.6.1", + "resolved": "https://registry.npmjs.org/@microsoft/applicationinsights-dependencies-js/-/applicationinsights-dependencies-js-2.6.1.tgz", + "integrity": "sha512-Y7R6BjzyB6NrkIBTT6FJrr2jKr8MiLxy264b1xUQHjry3Bwu+fsPJ7EETV61dkOEHs6IlWxAtikNCv8f3zQydw==", "requires": { - "@microsoft/applicationinsights-common": "2.5.9", - "@microsoft/applicationinsights-core-js": "2.5.9", + "@microsoft/applicationinsights-common": "2.6.1", + "@microsoft/applicationinsights-core-js": "2.6.1", "@microsoft/applicationinsights-shims": "1.0.3", - "@microsoft/dynamicproto-js": "^1.0.0" + "@microsoft/dynamicproto-js": "^1.1.1" } }, "@microsoft/applicationinsights-properties-js": { - "version": "2.5.9", - "resolved": "https://registry.npmjs.org/@microsoft/applicationinsights-properties-js/-/applicationinsights-properties-js-2.5.9.tgz", - "integrity": "sha512-mZxaC8CZsURn38IwsPaUx+o9QXQU2vm81THZL+1Lc+7scPo55ATDTFgZ2awIj7CdTp69oGzUkpB7maOn6+OVOw==", + "version": "2.6.1", + "resolved": "https://registry.npmjs.org/@microsoft/applicationinsights-properties-js/-/applicationinsights-properties-js-2.6.1.tgz", + "integrity": "sha512-TQmKp9/j0yMGjUHBatRQ41E4S/1yTkJImh8csZxc4waMQmV9ITkNrDaC3bIPcrw+ASepI3QfP7sry+n7nvYLFw==", "requires": { - "@microsoft/applicationinsights-common": "2.5.9", - "@microsoft/applicationinsights-core-js": "2.5.9", - "@microsoft/applicationinsights-shims": "1.0.3" + "@microsoft/applicationinsights-common": "2.6.1", + "@microsoft/applicationinsights-core-js": "2.6.1", + "@microsoft/applicationinsights-shims": "1.0.3", + "@microsoft/dynamicproto-js": "^1.1.1" } }, "@microsoft/applicationinsights-shims": { @@ -2585,29 +3419,90 @@ "integrity": "sha512-+S17aqEkOYpyBpmclhgwcEplwnxSo5AxYBdRg38GBobI1GKPSpZfnLssLzcjJ6XZCS5tqB5xjyTZs6gHj7ZJWQ==" }, "@microsoft/applicationinsights-web": { - "version": "2.5.9", - "resolved": "https://registry.npmjs.org/@microsoft/applicationinsights-web/-/applicationinsights-web-2.5.9.tgz", - "integrity": "sha512-dxg5XXbQqjWw9QmGdgbd7knb1qFA58FFYj9ObqRmlqiihk25kper7H15HH8LaV0lV6goClmBWc9KsNGA2veyeA==", + "version": "2.6.1", + "resolved": "https://registry.npmjs.org/@microsoft/applicationinsights-web/-/applicationinsights-web-2.6.1.tgz", + "integrity": "sha512-jKF6hpPq3pzLqLSVxTMh7HU9tr/SPOFJN12pFYpNMU/rAMs/fgZsmFG/oBAzYTZxNilDTFljoblB66J9X+K6RQ==", "requires": { - "@microsoft/applicationinsights-analytics-js": "2.5.9", - "@microsoft/applicationinsights-channel-js": "2.5.9", - "@microsoft/applicationinsights-common": "2.5.9", - "@microsoft/applicationinsights-core-js": "2.5.9", - "@microsoft/applicationinsights-dependencies-js": "2.5.9", - "@microsoft/applicationinsights-properties-js": "2.5.9", + "@microsoft/applicationinsights-analytics-js": "2.6.1", + "@microsoft/applicationinsights-channel-js": "2.6.1", + "@microsoft/applicationinsights-common": "2.6.1", + "@microsoft/applicationinsights-core-js": "2.6.1", + "@microsoft/applicationinsights-dependencies-js": "2.6.1", + "@microsoft/applicationinsights-properties-js": "2.6.1", "@microsoft/applicationinsights-shims": "1.0.3", - "@microsoft/dynamicproto-js": "^1.0.0" + "@microsoft/dynamicproto-js": "^1.1.1" } }, "@microsoft/dynamicproto-js": { - "version": "1.1.0", - "resolved": "https://registry.npmjs.org/@microsoft/dynamicproto-js/-/dynamicproto-js-1.1.0.tgz", - "integrity": "sha512-pjcr+A6wTQHl/S4b5zQzeDMC6+9ekojCFHQAEYI4a8u9ZjWwbg4jmtO22CWEuRWWN/lBMjay9FKanlODWk5wqQ==" + "version": "1.1.1", + "resolved": "https://registry.npmjs.org/@microsoft/dynamicproto-js/-/dynamicproto-js-1.1.1.tgz", + "integrity": "sha512-SPY1PlXmg4FbJVItVdhDV+zigajPtSI8oZPrsKBEIzAF4FROuwWIq5C+RAF8VJshBqphcvU8Eoh4DrUEZOB31g==", + "requires": { + "findup-sync": "^4.0.0", + "nopt": "^5.0.0", + "pify": "^2.3.0" + }, + "dependencies": { + "braces": { + "version": "3.0.2", + "resolved": "https://registry.npmjs.org/braces/-/braces-3.0.2.tgz", + "integrity": "sha512-b8um+L1RzM3WDSzvhm6gIz1yfTbBt6YTlcEKAvsmqCZZFw46z626lVj9j1yEPW33H5H+lBQpZMP1k8l+78Ha0A==", + "requires": { + "fill-range": "^7.0.1" + } + }, + "fill-range": { + "version": "7.0.1", + "resolved": "https://registry.npmjs.org/fill-range/-/fill-range-7.0.1.tgz", + "integrity": "sha512-qOo9F+dMUmC2Lcb4BbVvnKJxTPjCm+RRpe4gDuGrzkL7mEVl/djYSu2OdQ2Pa302N4oqkSg9ir6jaLWJ2USVpQ==", + "requires": { + "to-regex-range": "^5.0.1" + } + }, + "findup-sync": { + "version": "4.0.0", + "resolved": "https://registry.npmjs.org/findup-sync/-/findup-sync-4.0.0.tgz", + "integrity": "sha512-6jvvn/12IC4quLBL1KNokxC7wWTvYncaVUYSoxWw7YykPLuRrnv4qdHcSOywOI5RpkOVGeQRtWM8/q+G6W6qfQ==", + "requires": { + "detect-file": "^1.0.0", + "is-glob": "^4.0.0", + "micromatch": "^4.0.2", + "resolve-dir": "^1.0.1" + } + }, + "is-number": { + "version": "7.0.0", + "resolved": "https://registry.npmjs.org/is-number/-/is-number-7.0.0.tgz", + "integrity": "sha512-41Cifkg6e8TylSpdtTpeLVMqvSBEVzTttHvERD741+pnZ8ANv0004MRL43QKPDlK9cGvNp6NZWZUBlbGXYxxng==" + }, + "micromatch": { + "version": "4.0.2", + "resolved": "https://registry.npmjs.org/micromatch/-/micromatch-4.0.2.tgz", + "integrity": "sha512-y7FpHSbMUMoyPbYUSzO6PaZ6FyRnQOpHuKwbo1G+Knck95XVU4QAiKdGEnj5wwoS7PlOgthX/09u5iFJ+aYf5Q==", + "requires": { + "braces": "^3.0.1", + "picomatch": "^2.0.5" + } + }, + "pify": { + "version": "2.3.0", + "resolved": "https://registry.npmjs.org/pify/-/pify-2.3.0.tgz", + "integrity": "sha1-7RQaasBDqEnqWISY59yosVMw6Qw=" + }, + "to-regex-range": { + "version": "5.0.1", + "resolved": "https://registry.npmjs.org/to-regex-range/-/to-regex-range-5.0.1.tgz", + "integrity": "sha512-65P7iz6X5yEr1cwcgvQxbbIw7Uk3gOy5dIdtZ4rDveLqhrdJP+Li/Hx6tyK0NEb+2GCyneCMJiGqrADCSNk8sQ==", + "requires": { + "is-number": "^7.0.0" + } + } + } }, "@microsoft/load-themed-styles": { - "version": "1.10.146", - "resolved": "https://registry.npmjs.org/@microsoft/load-themed-styles/-/load-themed-styles-1.10.146.tgz", - "integrity": "sha512-qQZ4J58J2VMe/XRpr2YRDusQB9uRBJ1SjJB76x7uH94t9hqxjVVxn2qL99Bl+ERbfrACZ9peGn2uamt4ponqZQ==" + "version": "1.10.168", + "resolved": "https://registry.npmjs.org/@microsoft/load-themed-styles/-/load-themed-styles-1.10.168.tgz", + "integrity": "sha512-AnIjt1R+6P73ZQ0r/Djzij+dsizfvz0yj7spuCH6exEnpGgbsdPe0cdNrXPHVnaeJriHfefvhVRWGO7D8sMF9A==" }, "@nodelib/fs.scandir": { "version": "2.1.4", @@ -2633,18 +3528,18 @@ } }, "@npmcli/move-file": { - "version": "1.1.0", - "resolved": "https://registry.npmjs.org/@npmcli/move-file/-/move-file-1.1.0.tgz", - "integrity": "sha512-Iv2iq0JuyYjKeFkSR4LPaCdDZwlGK9X2cP/01nJcp3yMJ1FjNd9vpiEYvLUgzBxKPg2SFmaOhizoQsPc0LWeOQ==", + "version": "1.1.2", + "resolved": "https://registry.npmjs.org/@npmcli/move-file/-/move-file-1.1.2.tgz", + "integrity": "sha512-1SUf/Cg2GzGDyaf15aR9St9TWlb+XvbZXWpDx8YKs7MLzMH/BCeopv+y9vzrzgkfykCGuWOlSu3mZhj2+FQcrg==", "requires": { "mkdirp": "^1.0.4", - "rimraf": "^2.7.1" + "rimraf": "^3.0.2" }, "dependencies": { "rimraf": { - "version": "2.7.1", - "resolved": "https://registry.npmjs.org/rimraf/-/rimraf-2.7.1.tgz", - "integrity": "sha512-uWjbaKIK3T1OSVptzX7Nl6PvQ3qAGtKEtVRjRuazjfL3Bx5eI409VZSqgND+4UNnmzLVdPj9FqFJNPqBZFve4w==", + "version": "3.0.2", + "resolved": "https://registry.npmjs.org/rimraf/-/rimraf-3.0.2.tgz", + "integrity": "sha512-JZkJMZkAGFFPP2YqXZXPbMlMBgsxzE8ILs4lMIX/2o0L9UBw9O/Y3o6wFw/i9YLapcUJWwqbi3kdxIPdC62TIA==", "requires": { "glob": "^7.1.3" } @@ -2814,14 +3709,84 @@ } }, "@nteract/editor": { - "version": "10.1.2", - "resolved": "https://registry.npmjs.org/@nteract/editor/-/editor-10.1.2.tgz", - "integrity": "sha512-Wtj0kJUSoBZsWUh82JGt6miqYS0jt0k+3SD3cnW9socayxp2KB0Qbqhh2NtrF9ysxVHWnQT8iUarJjpGIdNyng==", + "version": "10.1.12", + "resolved": "https://registry.npmjs.org/@nteract/editor/-/editor-10.1.12.tgz", + "integrity": "sha512-bsUrCctukjWdpKNWQOQmhfxMCQ/SBVIO6+RkazI4y4dVeeP3KMP8nxfhzIbzTMNSkyynps/deZFjpDWqRhG+Dg==", "requires": { - "@nteract/messaging": "^7.0.10", - "@nteract/outputs": "^3.0.9", - "codemirror": "5.57.0", + "@nteract/messaging": "^7.0.19", + "@nteract/outputs": "^3.0.11", + "codemirror": "5.61.1", "rxjs": "^6.3.3" + }, + "dependencies": { + "@nteract/commutable": { + "version": "7.4.5", + "resolved": "https://registry.npmjs.org/@nteract/commutable/-/commutable-7.4.5.tgz", + "integrity": "sha512-RYqyMvkFt/04GQ9T+hGYgr9/LEy0dAYJ2QKn930TFX004KjfBT6Tt8VSLFyHWkXqPwyJ0jKMCJwqLcGOI/atqg==", + "requires": { + "immutable": "^4.0.0-rc.12", + "uuid": "^8.0.0" + } + }, + "@nteract/messaging": { + "version": "7.0.19", + "resolved": "https://registry.npmjs.org/@nteract/messaging/-/messaging-7.0.19.tgz", + "integrity": "sha512-gRPMxJr741/BshrfCcPSbm5iVyRU2TKmAv9jeQzk0MZEGy+Y1A0REO+eptkt4Ma0OXlvDxON6JEDauk8+2xt4w==", + "requires": { + "@nteract/types": "^7.1.9", + "@types/uuid": "^8.0.0", + "lodash.clonedeep": "^4.5.0", + "rxjs": "^6.6.0", + "uuid": "^8.0.0" + } + }, + "@nteract/outputs": { + "version": "3.0.11", + "resolved": "https://registry.npmjs.org/@nteract/outputs/-/outputs-3.0.11.tgz", + "integrity": "sha512-LeT9ViBf+fTPSubZ9dMe7128kg0rl1jIG54V0n2GiU5RuYnUz21FU0IOaLMPUfFMO1VyVEOW5jDc3PAQx5/Kwg==", + "requires": { + "@nteract/markdown": "^4.5.2", + "@nteract/mathjax": "^4.0.11", + "ansi-to-react": "^6.0.5", + "react-json-tree": "^0.12.1" + } + }, + "@nteract/types": { + "version": "7.1.9", + "resolved": "https://registry.npmjs.org/@nteract/types/-/types-7.1.9.tgz", + "integrity": "sha512-a7lGMWdjfz2QGlZbAiFHifU9Nhk9ntwg/iKUTMIMRPY1Wfs5UreHSMt+vZ8OY5HGjxicfHozBatGDKXeKXFHMQ==", + "requires": { + "@nteract/commutable": "^7.4.5", + "immutable": "^4.0.0-rc.12", + "rxjs": "^6.6.0", + "uuid": "^8.0.0" + } + }, + "react-base16-styling": { + "version": "0.7.0", + "resolved": "https://registry.npmjs.org/react-base16-styling/-/react-base16-styling-0.7.0.tgz", + "integrity": "sha512-lTa/VSFdU6BOAj+FryOe7OTZ0OBP8GXPOnCS0QnZi7G3zhssWgIgwl0eUL77onXx/WqKPFndB3ZeC77QC/l4Dw==", + "requires": { + "base16": "^1.0.0", + "lodash.curry": "^4.1.1", + "lodash.flow": "^3.5.0", + "pure-color": "^1.3.0" + } + }, + "react-json-tree": { + "version": "0.12.1", + "resolved": "https://registry.npmjs.org/react-json-tree/-/react-json-tree-0.12.1.tgz", + "integrity": "sha512-j6fkRY7ha9XMv1HPVakRCsvyFwHGR5AZuwO8naBBeZXnZbbLor5tpcUxS/8XD01+D1v7ZN5p+7LU+9V1uyASiQ==", + "requires": { + "prop-types": "^15.7.2", + "react-base16-styling": "^0.7.0" + } + }, + "uuid": { + "version": "8.3.2", + "resolved": "https://registry.npmjs.org/uuid/-/uuid-8.3.2.tgz", + "integrity": "sha512-+NYs2QeMWy+GWFOEm9xnn6HCDp0l7QBD7ml8zLUmJ+93Q5NF0NocErnwkTkXVFNiX3/fpC6afS8Dhb/gz7R7eg==" + } } }, "@nteract/epics": { @@ -2938,19 +3903,19 @@ "integrity": "sha512-6f675p3gzs7ZMAovzfOx+QOMNu1TGVT2aV5lPOwnPxJCM/APLpDRFcSoURwLA26CROlTTDEe10XweFzJgQ+VEQ==" }, "@nteract/markdown": { - "version": "4.4.0", - "resolved": "https://registry.npmjs.org/@nteract/markdown/-/markdown-4.4.0.tgz", - "integrity": "sha512-Xd8sxPmW42HW2Nq0pz2XrFBARt4wmgA0IbLQ23pg7FRMzpt2Ed4EjfuJkcm9ylTreAt1NJcljIpN47vzBUIehQ==", + "version": "4.6.0", + "resolved": "https://registry.npmjs.org/@nteract/markdown/-/markdown-4.6.0.tgz", + "integrity": "sha512-DIeUYSRsFlHlIJ+bz/w1ln/KKtwqr9LsYZ+Uj/2t7mlmYxeEW0JRBa/E51QqCVdEepjAlpg2XqfqNgjkZiFfvw==", "requires": { - "@nteract/mathjax": "^4.0.7", + "@nteract/mathjax": "^4.0.11", "@nteract/presentational-components": "^3.3.11", "react-markdown": "^4.0.0" }, "dependencies": { "@nteract/presentational-components": { - "version": "3.4.8", - "resolved": "https://registry.npmjs.org/@nteract/presentational-components/-/presentational-components-3.4.8.tgz", - "integrity": "sha512-gS0Gbxs/Z3mB9TCgz1CU5zBHChhOf3RhkLHsesNf/ljm7rRadzaaYa1NxcgugtxkcnVqt32angl9KfoCYb8R9A==", + "version": "3.4.9", + "resolved": "https://registry.npmjs.org/@nteract/presentational-components/-/presentational-components-3.4.9.tgz", + "integrity": "sha512-fcCYOdBRFyuj9vvXnrr2L2ynqouHnexUxpzt5VGTs4Mf/72r93vksarBStw2BD19utCVci7Fb5z6tNkFgveAZA==", "requires": { "@blueprintjs/core": "^3.7.0", "@blueprintjs/select": "^3.2.0", @@ -3661,30 +4626,6 @@ "resolved": "https://registry.npmjs.org/@opentelemetry/context-base/-/context-base-0.10.2.tgz", "integrity": "sha512-hZNKjKOYsckoOEgBziGMnBcX0M7EtstnCmwz5jZUOUYwlZ+/xxX6z3jPu1XVO2Jivk0eLfuP9GP+vFD49CMetw==" }, - "@peculiar/asn1-schema": { - "version": "1.1.2", - "resolved": "https://registry.npmjs.org/@peculiar/asn1-schema/-/asn1-schema-1.1.2.tgz", - "integrity": "sha512-ntQ4UnUFgdjs0tfWR6YmEQm/x0glV4OFus/RjxLkaJUKfu/R7VilefBntyUO3MoKWdlCgib30KN+JpCY1HqU2A==", - "requires": { - "asn1js": "^2.0.26", - "tslib": "^1.11.1" - } - }, - "@peculiar/json-schema": { - "version": "1.1.12", - "resolved": "https://registry.npmjs.org/@peculiar/json-schema/-/json-schema-1.1.12.tgz", - "integrity": "sha512-coUfuoMeIB7B8/NMekxaDzLhaYmp0HZNPEjYRm9goRou8UZIC3z21s0sL9AWoCw4EG876QyO3kYrc61WNF9B/w==", - "requires": { - "tslib": "^2.0.0" - }, - "dependencies": { - "tslib": { - "version": "2.1.0", - "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.1.0.tgz", - "integrity": "sha512-hcVC3wYEziELGGmEEXue7D75zbwIIVUMWAVbHItGPx0ziyXxrOMQx4rQEVEV45Ut/1IotuEvwqPopzIOkDMf0A==" - } - } - }, "@phosphor/algorithm": { "version": "1.2.0", "resolved": "https://registry.npmjs.org/@phosphor/algorithm/-/algorithm-1.2.0.tgz", @@ -3792,6 +4733,35 @@ "@phosphor/virtualdom": "^1.2.0" } }, + "@sideway/address": { + "version": "4.1.1", + "resolved": "https://registry.npmjs.org/@sideway/address/-/address-4.1.1.tgz", + "integrity": "sha512-+I5aaQr3m0OAmMr7RQ3fR9zx55sejEYR2BFJaxL+zT3VM2611X0SHvPWIbAUBZVTn/YzYKbV8gJ2oT/QELknfQ==", + "dev": true, + "requires": { + "@hapi/hoek": "^9.0.0" + }, + "dependencies": { + "@hapi/hoek": { + "version": "9.2.0", + "resolved": "https://registry.npmjs.org/@hapi/hoek/-/hoek-9.2.0.tgz", + "integrity": "sha512-sqKVVVOe5ivCaXDWivIJYVSaEgdQK9ul7a4Kity5Iw7u9+wBAPbX1RMSnLLmp7O4Vzj0WOWwMAJsTL00xwaNug==", + "dev": true + } + } + }, + "@sideway/formula": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/@sideway/formula/-/formula-3.0.0.tgz", + "integrity": "sha512-vHe7wZ4NOXVfkoRb8T5otiENVlT7a3IAiw7H5M2+GO+9CDgcVUUsX1zalAztCmwyOr2RUTGJdgB+ZvSVqmdHmg==", + "dev": true + }, + "@sideway/pinpoint": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/@sideway/pinpoint/-/pinpoint-2.0.0.tgz", + "integrity": "sha512-RNiOoTPkptFtSVzQevY/yWtZwf/RxyVnPy/OcA9HBM3MlGDnBEYL5B41H0MTn0Uec8Hi+2qUtTfG2WWZBmMejQ==", + "dev": true + }, "@sinonjs/commons": { "version": "1.8.2", "resolved": "https://registry.npmjs.org/@sinonjs/commons/-/commons-1.8.2.tgz", @@ -3801,6 +4771,15 @@ "type-detect": "4.0.8" } }, + "@sinonjs/fake-timers": { + "version": "6.0.1", + "resolved": "https://registry.npmjs.org/@sinonjs/fake-timers/-/fake-timers-6.0.1.tgz", + "integrity": "sha512-MZPUxrmFubI36XS1DI3qmI0YdN1gks62JtFZvxR67ljjSNCeK6U08Zx4msEWOXuofgqUt6zPHSi1H9fbjR/NRA==", + "dev": true, + "requires": { + "@sinonjs/commons": "^1.7.0" + } + }, "@sinonjs/formatio": { "version": "3.2.2", "resolved": "https://registry.npmjs.org/@sinonjs/formatio/-/formatio-3.2.2.tgz", @@ -4020,12 +4999,6 @@ "@testing-library/dom": "^7.28.1" } }, - "@tootallnate/once": { - "version": "1.1.2", - "resolved": "https://registry.npmjs.org/@tootallnate/once/-/once-1.1.2.tgz", - "integrity": "sha512-RbzJvlNzmRq5c3O09UipeuXno4tA1FE6ikOjxZK0tuxVv3412l64l5t1W5pj4+rJq9vpkm/kwiR07aZXnsKPxw==", - "dev": true - }, "@types/anymatch": { "version": "1.3.1", "resolved": "https://registry.npmjs.org/@types/anymatch/-/anymatch-1.3.1.tgz", @@ -4049,11 +5022,6 @@ "resolved": "https://registry.npmjs.org/@types/asap/-/asap-2.0.0.tgz", "integrity": "sha512-upIS0Gt9Mc8eEpCbYMZ1K8rhNosfKUtimNcINce+zLwJF5UpM3Vv7yz3S5l/1IX+DxTa8lTkUjqynvjRXyJzsg==" }, - "@types/asn1js": { - "version": "2.0.0", - "resolved": "https://registry.npmjs.org/@types/asn1js/-/asn1js-2.0.0.tgz", - "integrity": "sha512-Jjzp5EqU0hNpADctc/UqhiFbY1y2MqIxBVa2S4dBlbnZHTLPMuggoL5q43X63LpsOIINRDirBjP56DUUKIUWIA==" - }, "@types/babel__core": { "version": "7.1.12", "resolved": "https://registry.npmjs.org/@types/babel__core/-/babel__core-7.1.12.tgz", @@ -4375,10 +5343,11 @@ "@types/d3-selection": "*" } }, - "@types/debug": { - "version": "4.1.5", - "resolved": "https://registry.npmjs.org/@types/debug/-/debug-4.1.5.tgz", - "integrity": "sha512-Q1y515GcOdTHgagaVFhHnIFQ38ygs/kmxdNpvpou+raI9UO3YZcHDngBSYKQklcKlvA7iuQlmIKbzvmxcOE9CQ==" + "@types/dom-to-image": { + "version": "2.6.2", + "resolved": "https://registry.npmjs.org/@types/dom-to-image/-/dom-to-image-2.6.2.tgz", + "integrity": "sha512-Yxbwmz/glNwRIXfBI8efG2bgIxrFAKV1MdfpqbUDq25ULMot7U7FYXPiso5G8DlBExSP+AakuG0mNus9yw4RZQ==", + "dev": true }, "@types/dom4": { "version": "2.0.1", @@ -4404,16 +5373,6 @@ "@types/enzyme": "*" } }, - "@types/expect-puppeteer": { - "version": "4.4.3", - "resolved": "https://registry.npmjs.org/@types/expect-puppeteer/-/expect-puppeteer-4.4.3.tgz", - "integrity": "sha512-jWZOO9d8ST2vutV5yxZ1OYxxtYD0lOufIgOUlDjyTNBGo8um67shJs2NQDLVDG06wWrabpPPOUQlI8GSvsdKVQ==", - "dev": true, - "requires": { - "@types/jest": "*", - "@types/puppeteer": "*" - } - }, "@types/geojson": { "version": "7946.0.7", "resolved": "https://registry.npmjs.org/@types/geojson/-/geojson-7946.0.7.tgz", @@ -4431,9 +5390,9 @@ } }, "@types/graceful-fs": { - "version": "4.1.4", - "resolved": "https://registry.npmjs.org/@types/graceful-fs/-/graceful-fs-4.1.4.tgz", - "integrity": "sha512-mWA/4zFQhfvOA8zWkXobwJvBD7vzcxgrOQ0J5CH1votGqdq9m7+FwtGaqyCZqC3NyyBkc9z4m+iry4LlqcMWJg==", + "version": "4.1.5", + "resolved": "https://registry.npmjs.org/@types/graceful-fs/-/graceful-fs-4.1.5.tgz", + "integrity": "sha512-anKkLmZZ+xm4p8JWBf4hElkM4XR+EZeA2M9BAkkTldmcyDY4mbdIJnRghDJH3Ov5ooY7/UAoENtmdMSkaAd7Cw==", "dev": true, "requires": { "@types/node": "*" @@ -4457,6 +5416,12 @@ "hoist-non-react-statics": "^3.3.0" } }, + "@types/html-minifier-terser": { + "version": "5.1.1", + "resolved": "https://registry.npmjs.org/@types/html-minifier-terser/-/html-minifier-terser-5.1.1.tgz", + "integrity": "sha512-giAlZwstKbmvMk1OO7WXSj4OZ0keXAcl2TQq4LWHiiPH2ByaH7WeUzng+Qej8UPxxv+8lRTuouo0iaNDBuzIBA==", + "dev": true + }, "@types/invariant": { "version": "2.2.34", "resolved": "https://registry.npmjs.org/@types/invariant/-/invariant-2.2.34.tgz", @@ -4613,29 +5578,15 @@ } } }, - "@types/jest-environment-puppeteer": { - "version": "4.3.2", - "resolved": "https://registry.npmjs.org/@types/jest-environment-puppeteer/-/jest-environment-puppeteer-4.3.2.tgz", - "integrity": "sha512-QVR49cGaQMOrWRN7CXlvtPMuVAxa3Z+W3APxhWoSQLG/lvz1y03ECPvS7Y9eK+hgfndK+39400rO6IifDJV9YA==", - "dev": true, - "requires": { - "@jest/environment": "^24", - "@jest/fake-timers": "^24", - "@jest/types": "^24", - "@types/puppeteer": "*", - "jest-mock": "^24" - } - }, "@types/json-schema": { "version": "7.0.7", "resolved": "https://registry.npmjs.org/@types/json-schema/-/json-schema-7.0.7.tgz", "integrity": "sha512-cxWFQVseBm6O9Gbw1IWb8r6OS4OhSt3hPZLkFApLjM8TEXROBuQGLAH2i2gZpcXdLBIrpXuTDhH7Vbm1iXmNGA==" }, - "@types/memoize-one": { - "version": "4.1.1", - "resolved": "https://registry.npmjs.org/@types/memoize-one/-/memoize-one-4.1.1.tgz", - "integrity": "sha512-+9djKUUn8hOyktLCfCy4hLaIPgDNovaU36fsnZe9trFHr6ddlbIn2q0SEsnkCkNR+pBWEU440Molz/+Mpyf+gQ==", - "dev": true + "@types/lodash": { + "version": "4.14.171", + "resolved": "https://registry.npmjs.org/@types/lodash/-/lodash-4.14.171.tgz", + "integrity": "sha512-7eQ2xYLLI/LsicL2nejW9Wyko3lcpN6O/z0ZLHrEQsg280zIdCv1t/0m6UtBjUHokCGBQ3gYTbHzDkZ1xOBwwg==" }, "@types/minimatch": { "version": "3.0.3", @@ -4661,8 +5612,7 @@ "@types/node": { "version": "12.11.1", "resolved": "https://registry.npmjs.org/@types/node/-/node-12.11.1.tgz", - "integrity": "sha512-TJtwsqZ39pqcljJpajeoofYRfeZ7/I/OMUQ5pR4q5wOKf2ocrUvBAZUMhWsOvKx3dVc/aaV5GluBivt0sWqA5A==", - "dev": true + "integrity": "sha512-TJtwsqZ39pqcljJpajeoofYRfeZ7/I/OMUQ5pR4q5wOKf2ocrUvBAZUMhWsOvKx3dVc/aaV5GluBivt0sWqA5A==" }, "@types/node-fetch": { "version": "2.5.7", @@ -4696,32 +5646,22 @@ "integrity": "sha512-f5j5b/Gf71L+dbqxIpQ4Z2WlmI/mPJ0fOkGGmFgtb6sAu97EPczzbS3/tJKxmcYDj55OX6ssqwDAWOHIYDRDGA==", "dev": true }, + "@types/post-robot": { + "version": "10.0.1", + "resolved": "https://registry.npmjs.org/@types/post-robot/-/post-robot-10.0.1.tgz", + "integrity": "sha512-1k27bJ7MfTScedBeK8m4hYFLaiBkB6PbMHiux0gW1gJDGaqU89YICxl5kHX3KT/Dz6k04RfncfR1XDfD3Kou2Q==", + "dev": true + }, "@types/prettier": { "version": "1.19.1", "resolved": "https://registry.npmjs.org/@types/prettier/-/prettier-1.19.1.tgz", "integrity": "sha512-5qOlnZscTn4xxM5MeGXAMOsIOIKIbh9e85zJWfBRVPlRMEVawzoPhINYbRGkBZCI8LxvBe7tJCdWiarA99OZfQ==", "dev": true }, - "@types/promise.prototype.finally": { - "version": "2.0.3", - "resolved": "https://registry.npmjs.org/@types/promise.prototype.finally/-/promise.prototype.finally-2.0.3.tgz", - "integrity": "sha512-hQfmCK9Hw8diRIa3KoIDY4aimdxckamHUcmaZeB9tBMyb/Shi1yCBIPfry+nqN4jILNVThY1tnTwdMhQeMjqrw==", - "dev": true - }, "@types/prop-types": { "version": "15.5.8", "resolved": "https://registry.npmjs.org/@types/prop-types/-/prop-types-15.5.8.tgz", - "integrity": "sha512-3AQoUxQcQtLHsK25wtTWIoIpgYjH3vSDroZOUr7PpCHw/jLY1RB9z9E8dBT/OSmwStVgkRNvdh+ZHNiomRieaw==", - "dev": true - }, - "@types/puppeteer": { - "version": "3.0.1", - "resolved": "https://registry.npmjs.org/@types/puppeteer/-/puppeteer-3.0.1.tgz", - "integrity": "sha512-t03eNKCvWJXhQ8wkc5C6GYuSqMEdKLOX0GLMGtks25YZr38wKZlKTwGM/BoAPVtdysX7Bb9tdwrDS1+NrW3RRA==", - "dev": true, - "requires": { - "@types/node": "*" - } + "integrity": "sha512-3AQoUxQcQtLHsK25wtTWIoIpgYjH3vSDroZOUr7PpCHw/jLY1RB9z9E8dBT/OSmwStVgkRNvdh+ZHNiomRieaw==" }, "@types/q": { "version": "1.5.1", @@ -4730,30 +5670,26 @@ "dev": true }, "@types/react": { - "version": "17.0.0", - "resolved": "https://registry.npmjs.org/@types/react/-/react-17.0.0.tgz", - "integrity": "sha512-aj/L7RIMsRlWML3YB6KZiXB3fV2t41+5RBGYF8z+tAKU43Px8C3cYUZsDvf1/+Bm4FK21QWBrDutu8ZJ/70qOw==", + "version": "17.0.3", + "resolved": "https://registry.npmjs.org/@types/react/-/react-17.0.3.tgz", + "integrity": "sha512-wYOUxIgs2HZZ0ACNiIayItyluADNbONl7kt8lkLjVK8IitMH5QMyAh75Fwhmo37r1m7L2JaFj03sIfxBVDvRAg==", "requires": { "@types/prop-types": "*", + "@types/scheduler": "*", "csstype": "^3.0.2" }, "dependencies": { - "@types/prop-types": { - "version": "15.7.3", - "resolved": "https://registry.npmjs.org/@types/prop-types/-/prop-types-15.7.3.tgz", - "integrity": "sha512-KfRL3PuHmqQLOG+2tGpRO26Ctg+Cq1E01D2DMriKEATHgWLfeNDmq9e29Q9WIky0dQ3NPkd1mzYH8Lm936Z9qw==" - }, "csstype": { - "version": "3.0.6", - "resolved": "https://registry.npmjs.org/csstype/-/csstype-3.0.6.tgz", - "integrity": "sha512-+ZAmfyWMT7TiIlzdqJgjMb7S4f1beorDbWbsocyK4RaiqA5RTX3K14bnBWmmA9QEM0gRdsjyyrEmcyga8Zsxmw==" + "version": "3.0.7", + "resolved": "https://registry.npmjs.org/csstype/-/csstype-3.0.7.tgz", + "integrity": "sha512-KxnUB0ZMlnUWCsx2Z8MUsr6qV6ja1w9ArPErJaJaF8a5SOWoHLIszeCTKGRGRgtLgYrs1E8CHkNSP1VZTTPc9g==" } } }, "@types/react-dom": { - "version": "17.0.0", - "resolved": "https://registry.npmjs.org/@types/react-dom/-/react-dom-17.0.0.tgz", - "integrity": "sha512-lUqY7OlkF/RbNtD5nIq7ot8NquXrdFrjSOR6+w9a9RFQevGi1oZO1dcJbXMeONAPKtZ2UrZOEJ5UOCVsxbLk/g==", + "version": "17.0.3", + "resolved": "https://registry.npmjs.org/@types/react-dom/-/react-dom-17.0.3.tgz", + "integrity": "sha512-4NnJbCeWE+8YBzupn/YrJxZ8VnjcJq5iR1laqQ1vkpQgBiA7bwk0Rp24fxsdNinzJY2U+HHS4dJJDPdoMjdJ7w==", "dev": true, "requires": { "@types/react": "*" @@ -4789,6 +5725,15 @@ "redux": "^4.0.0" } }, + "@types/react-splitter-layout": { + "version": "3.0.1", + "resolved": "https://registry.npmjs.org/@types/react-splitter-layout/-/react-splitter-layout-3.0.1.tgz", + "integrity": "sha512-NsKq32LdG11G/Uj+xo2QmC9S8YSe8JRtxkBhsBE7ODFs0zcnzNEqFAQirP0H7rPe2WFGiu+d/44xbHsew7QAJw==", + "dev": true, + "requires": { + "@types/react": "*" + } + }, "@types/react-table": { "version": "6.8.7", "resolved": "https://registry.npmjs.org/@types/react-table/-/react-table-6.8.7.tgz", @@ -4802,6 +5747,34 @@ "resolved": "https://registry.npmjs.org/@types/retry/-/retry-0.12.0.tgz", "integrity": "sha512-wWKOClTTiizcZhXnPY4wikVAwmdYHp8q6DmC+EJUzAMsycb7HB32Kh9RN4+0gExjmPmZSAQjgURXIGATPegAvA==" }, + "@types/sanitize-html": { + "version": "1.27.2", + "resolved": "https://registry.npmjs.org/@types/sanitize-html/-/sanitize-html-1.27.2.tgz", + "integrity": "sha512-DrH26m7CV6PB4YVckjbSIx+xloB7HBolr9Ctm0gZBffSu5dDV4yJKFQGPquJlReVW+xmg59gx+b/8/qYHxZEuw==", + "dev": true, + "requires": { + "htmlparser2": "^4.1.0" + }, + "dependencies": { + "htmlparser2": { + "version": "4.1.0", + "resolved": "https://registry.npmjs.org/htmlparser2/-/htmlparser2-4.1.0.tgz", + "integrity": "sha512-4zDq1a1zhE4gQso/c5LP1OtrhYTncXNSpvJYtWJBtXAETPlMfi3IFNjGuQbYLuVY4ZR0QMqRVvo4Pdy9KLyP8Q==", + "dev": true, + "requires": { + "domelementtype": "^2.0.1", + "domhandler": "^3.0.0", + "domutils": "^2.0.0", + "entities": "^2.0.0" + } + } + } + }, + "@types/scheduler": { + "version": "0.16.1", + "resolved": "https://registry.npmjs.org/@types/scheduler/-/scheduler-0.16.1.tgz", + "integrity": "sha512-EaCxbanVeyxDRTQBkdLb3Bvl/HK7PBK6UJjsSixB0iHKoWxE5uu2Q/DgtpOhPIojN0Zl1whvOd7PoHs2P0s5eA==" + }, "@types/shallowequal": { "version": "1.1.1", "resolved": "https://registry.npmjs.org/@types/shallowequal/-/shallowequal-1.1.1.tgz", @@ -4856,12 +5829,6 @@ "@types/jest": "*" } }, - "@types/text-encoding": { - "version": "0.0.33", - "resolved": "https://registry.npmjs.org/@types/text-encoding/-/text-encoding-0.0.33.tgz", - "integrity": "sha512-kAMOjud0Nw3HPY0Cu8cTFk0LVya8skY+ajb2rgrSahPQ6AreN0cpGBNrs8Kjlu9EhFIeh5cp7phovL7v9HrPdQ==", - "dev": true - }, "@types/tunnel": { "version": "0.0.1", "resolved": "https://registry.npmjs.org/@types/tunnel/-/tunnel-0.0.1.tgz", @@ -4910,10 +5877,10 @@ "resolved": "https://registry.npmjs.org/@types/uuid/-/uuid-8.3.0.tgz", "integrity": "sha512-eQ9qFW/fhfGJF8WKHGEHZEyVWfZxrT+6CLIJGBcZPfxUh/+BnEj+UCGYMlr9qZuX/2AltsvwrGqp0LhEW8D0zQ==" }, - "@types/webfontloader": { - "version": "1.6.29", - "resolved": "https://registry.npmjs.org/@types/webfontloader/-/webfontloader-1.6.29.tgz", - "integrity": "sha512-wobuM+LvpkzU296NsFVRGDAFWw3X2XEhrLHuvV+VGSbok6aOxQcymmopUFwNB69qy5oudHt9lYC0JF+z+DxFLw==", + "@types/wait-on": { + "version": "5.2.0", + "resolved": "https://registry.npmjs.org/@types/wait-on/-/wait-on-5.2.0.tgz", + "integrity": "sha512-3+jsMyPm8aot1mqDUDLOl+dejPvpysUUoUXD6CCRY20MNNhcjEfvdcBnGdnk7DEYs9Hr16ubGJA/9/QW0Df/9g==", "dev": true }, "@types/webpack": { @@ -4981,54 +5948,54 @@ } }, "@typescript-eslint/eslint-plugin": { - "version": "4.0.1", - "resolved": "https://registry.npmjs.org/@typescript-eslint/eslint-plugin/-/eslint-plugin-4.0.1.tgz", - "integrity": "sha512-pQZtXupCn11O4AwpYVUX4PDFfmIJl90ZgrEBg0CEcqlwvPiG0uY81fimr1oMFblZnpKAq6prrT9a59pj1x58rw==", + "version": "4.22.0", + "resolved": "https://registry.npmjs.org/@typescript-eslint/eslint-plugin/-/eslint-plugin-4.22.0.tgz", + "integrity": "sha512-U8SP9VOs275iDXaL08Ln1Fa/wLXfj5aTr/1c0t0j6CdbOnxh+TruXu1p4I0NAvdPBQgoPjHsgKn28mOi0FzfoA==", "dev": true, "requires": { - "@typescript-eslint/experimental-utils": "4.0.1", - "@typescript-eslint/scope-manager": "4.0.1", + "@typescript-eslint/experimental-utils": "4.22.0", + "@typescript-eslint/scope-manager": "4.22.0", "debug": "^4.1.1", "functional-red-black-tree": "^1.0.1", + "lodash": "^4.17.15", "regexpp": "^3.0.0", "semver": "^7.3.2", "tsutils": "^3.17.1" }, "dependencies": { "@typescript-eslint/experimental-utils": { - "version": "4.0.1", - "resolved": "https://registry.npmjs.org/@typescript-eslint/experimental-utils/-/experimental-utils-4.0.1.tgz", - "integrity": "sha512-gAqOjLiHoED79iYTt3F4uSHrYmg/GPz/zGezdB0jAdr6S6gwNiR/j7cTZ8nREKVzMVKLd9G3xbg1sV9GClW3sw==", + "version": "4.22.0", + "resolved": "https://registry.npmjs.org/@typescript-eslint/experimental-utils/-/experimental-utils-4.22.0.tgz", + "integrity": "sha512-xJXHHl6TuAxB5AWiVrGhvbGL8/hbiCQ8FiWwObO3r0fnvBdrbWEDy1hlvGQOAWc6qsCWuWMKdVWlLAEMpxnddg==", "dev": true, "requires": { "@types/json-schema": "^7.0.3", - "@typescript-eslint/scope-manager": "4.0.1", - "@typescript-eslint/types": "4.0.1", - "@typescript-eslint/typescript-estree": "4.0.1", + "@typescript-eslint/scope-manager": "4.22.0", + "@typescript-eslint/types": "4.22.0", + "@typescript-eslint/typescript-estree": "4.22.0", "eslint-scope": "^5.0.0", "eslint-utils": "^2.0.0" } }, "@typescript-eslint/typescript-estree": { - "version": "4.0.1", - "resolved": "https://registry.npmjs.org/@typescript-eslint/typescript-estree/-/typescript-estree-4.0.1.tgz", - "integrity": "sha512-zGzleORFXrRWRJAMLTB2iJD1IZbCPkg4hsI8mGdpYlKaqzvKYSEWVAYh14eauaR+qIoZVWrXgYSXqLtTlxotiw==", + "version": "4.22.0", + "resolved": "https://registry.npmjs.org/@typescript-eslint/typescript-estree/-/typescript-estree-4.22.0.tgz", + "integrity": "sha512-TkIFeu5JEeSs5ze/4NID+PIcVjgoU3cUQUIZnH3Sb1cEn1lBo7StSV5bwPuJQuoxKXlzAObjYTilOEKRuhR5yg==", "dev": true, "requires": { - "@typescript-eslint/types": "4.0.1", - "@typescript-eslint/visitor-keys": "4.0.1", + "@typescript-eslint/types": "4.22.0", + "@typescript-eslint/visitor-keys": "4.22.0", "debug": "^4.1.1", "globby": "^11.0.1", "is-glob": "^4.0.1", - "lodash": "^4.17.15", "semver": "^7.3.2", "tsutils": "^3.17.1" } }, "semver": { - "version": "7.3.4", - "resolved": "https://registry.npmjs.org/semver/-/semver-7.3.4.tgz", - "integrity": "sha512-tCfb2WLjqFAtXn4KEdxIhalnRtoKFN7nAwj0B3ZXCbQloV2tq5eDbcTmT68JJD3nRJq24/XgxtQKFIpQdtvmVw==", + "version": "7.3.5", + "resolved": "https://registry.npmjs.org/semver/-/semver-7.3.5.tgz", + "integrity": "sha512-PoeGJYh8HK4BTO/a9Tf6ZG3veo/A7ZVsYrSA6J8ny9nb3B1VrpkuN+z9OE5wfE5p6H4LchYZsegiQgbJD94ZFQ==", "dev": true, "requires": { "lru-cache": "^6.0.0" @@ -5048,37 +6015,36 @@ } }, "@typescript-eslint/parser": { - "version": "4.0.1", - "resolved": "https://registry.npmjs.org/@typescript-eslint/parser/-/parser-4.0.1.tgz", - "integrity": "sha512-1+qLmXHNAWSQ7RB6fdSQszAiA7JTwzakj5cNYjBTUmpH2cqilxMZEIV+DRKjVZs8NzP3ALmKexB0w/ExjcK9Iw==", + "version": "4.22.0", + "resolved": "https://registry.npmjs.org/@typescript-eslint/parser/-/parser-4.22.0.tgz", + "integrity": "sha512-z/bGdBJJZJN76nvAY9DkJANYgK3nlRstRRi74WHm3jjgf2I8AglrSY+6l7ogxOmn55YJ6oKZCLLy+6PW70z15Q==", "dev": true, "requires": { - "@typescript-eslint/scope-manager": "4.0.1", - "@typescript-eslint/types": "4.0.1", - "@typescript-eslint/typescript-estree": "4.0.1", + "@typescript-eslint/scope-manager": "4.22.0", + "@typescript-eslint/types": "4.22.0", + "@typescript-eslint/typescript-estree": "4.22.0", "debug": "^4.1.1" }, "dependencies": { "@typescript-eslint/typescript-estree": { - "version": "4.0.1", - "resolved": "https://registry.npmjs.org/@typescript-eslint/typescript-estree/-/typescript-estree-4.0.1.tgz", - "integrity": "sha512-zGzleORFXrRWRJAMLTB2iJD1IZbCPkg4hsI8mGdpYlKaqzvKYSEWVAYh14eauaR+qIoZVWrXgYSXqLtTlxotiw==", + "version": "4.22.0", + "resolved": "https://registry.npmjs.org/@typescript-eslint/typescript-estree/-/typescript-estree-4.22.0.tgz", + "integrity": "sha512-TkIFeu5JEeSs5ze/4NID+PIcVjgoU3cUQUIZnH3Sb1cEn1lBo7StSV5bwPuJQuoxKXlzAObjYTilOEKRuhR5yg==", "dev": true, "requires": { - "@typescript-eslint/types": "4.0.1", - "@typescript-eslint/visitor-keys": "4.0.1", + "@typescript-eslint/types": "4.22.0", + "@typescript-eslint/visitor-keys": "4.22.0", "debug": "^4.1.1", "globby": "^11.0.1", "is-glob": "^4.0.1", - "lodash": "^4.17.15", "semver": "^7.3.2", "tsutils": "^3.17.1" } }, "semver": { - "version": "7.3.4", - "resolved": "https://registry.npmjs.org/semver/-/semver-7.3.4.tgz", - "integrity": "sha512-tCfb2WLjqFAtXn4KEdxIhalnRtoKFN7nAwj0B3ZXCbQloV2tq5eDbcTmT68JJD3nRJq24/XgxtQKFIpQdtvmVw==", + "version": "7.3.5", + "resolved": "https://registry.npmjs.org/semver/-/semver-7.3.5.tgz", + "integrity": "sha512-PoeGJYh8HK4BTO/a9Tf6ZG3veo/A7ZVsYrSA6J8ny9nb3B1VrpkuN+z9OE5wfE5p6H4LchYZsegiQgbJD94ZFQ==", "dev": true, "requires": { "lru-cache": "^6.0.0" @@ -5087,19 +6053,19 @@ } }, "@typescript-eslint/scope-manager": { - "version": "4.0.1", - "resolved": "https://registry.npmjs.org/@typescript-eslint/scope-manager/-/scope-manager-4.0.1.tgz", - "integrity": "sha512-u3YEXVJ8jsj7QCJk3om0Y457fy2euEOkkzxIB/LKU3MdyI+FJ2gI0M4aKEaXzwCSfNDiZ13a3lDo5DVozc+XLQ==", + "version": "4.22.0", + "resolved": "https://registry.npmjs.org/@typescript-eslint/scope-manager/-/scope-manager-4.22.0.tgz", + "integrity": "sha512-OcCO7LTdk6ukawUM40wo61WdeoA7NM/zaoq1/2cs13M7GyiF+T4rxuA4xM+6LeHWjWbss7hkGXjFDRcKD4O04Q==", "dev": true, "requires": { - "@typescript-eslint/types": "4.0.1", - "@typescript-eslint/visitor-keys": "4.0.1" + "@typescript-eslint/types": "4.22.0", + "@typescript-eslint/visitor-keys": "4.22.0" } }, "@typescript-eslint/types": { - "version": "4.0.1", - "resolved": "https://registry.npmjs.org/@typescript-eslint/types/-/types-4.0.1.tgz", - "integrity": "sha512-S+gD3fgbkZYW2rnbjugNMqibm9HpEjqZBZkTiI3PwbbNGWmAcxolWIUwZ0SKeG4Dy2ktpKKaI/6+HGYVH8Qrlg==", + "version": "4.22.0", + "resolved": "https://registry.npmjs.org/@typescript-eslint/types/-/types-4.22.0.tgz", + "integrity": "sha512-sW/BiXmmyMqDPO2kpOhSy2Py5w6KvRRsKZnV0c4+0nr4GIcedJwXAq+RHNK4lLVEZAJYFltnnk1tJSlbeS9lYA==", "dev": true }, "@typescript-eslint/typescript-estree": { @@ -5127,12 +6093,12 @@ } }, "@typescript-eslint/visitor-keys": { - "version": "4.0.1", - "resolved": "https://registry.npmjs.org/@typescript-eslint/visitor-keys/-/visitor-keys-4.0.1.tgz", - "integrity": "sha512-yBSqd6FjnTzbg5RUy9J+9kJEyQjTI34JdGMJz+9ttlJzLCnGkBikxw+N5n2VDcc3CesbIEJ0MnZc5uRYnrEnCw==", + "version": "4.22.0", + "resolved": "https://registry.npmjs.org/@typescript-eslint/visitor-keys/-/visitor-keys-4.22.0.tgz", + "integrity": "sha512-nnMu4F+s4o0sll6cBSsTeVsT4cwxB7zECK3dFxzEjPBii9xLpq4yqqsy/FU5zMfan6G60DKZSCXAa3sHJZrcYw==", "dev": true, "requires": { - "@typescript-eslint/types": "4.0.1", + "@typescript-eslint/types": "4.22.0", "eslint-visitor-keys": "^2.0.0" }, "dependencies": { @@ -5144,256 +6110,6 @@ } } }, - "@uifabric/azure-themes": { - "version": "7.6.7", - "resolved": "https://registry.npmjs.org/@uifabric/azure-themes/-/azure-themes-7.6.7.tgz", - "integrity": "sha512-KlfcjxoVn66wamYjWxZY1b7ezMIcX08ZbDZNKMvh/C9zchTqQ8P/cFAcfiBrxhKL3HJtb0CBFkhd3lYcQD76jg==", - "requires": { - "@fluentui/theme": "^1.7.1", - "@uifabric/merge-styles": "^7.19.1", - "@uifabric/set-version": "^7.0.23", - "office-ui-fabric-react": "^7.157.0", - "tslib": "^1.10.0" - }, - "dependencies": { - "@uifabric/styling": { - "version": "7.16.19", - "resolved": "https://registry.npmjs.org/@uifabric/styling/-/styling-7.16.19.tgz", - "integrity": "sha512-T5fjUCx0LbzUC8Myw15YCaBjdGbSrihWSiPHtLVW77k59yWAW947XnH73QngE8xU7kyKPH3AhQrUEBMB2NjHag==", - "requires": { - "@fluentui/theme": "^1.7.1", - "@microsoft/load-themed-styles": "^1.10.26", - "@uifabric/merge-styles": "^7.19.1", - "@uifabric/set-version": "^7.0.23", - "@uifabric/utilities": "^7.33.2", - "tslib": "^1.10.0" - } - }, - "office-ui-fabric-react": { - "version": "7.157.0", - "resolved": "https://registry.npmjs.org/office-ui-fabric-react/-/office-ui-fabric-react-7.157.0.tgz", - "integrity": "sha512-nS0RfhQKho2S2hiUxHcgM47AZUK1EzbjkdWkofNHQk8q0PwJkQPTUjTbSuxhQNLzXHiaQJz930ZYUvRCZvlL1w==", - "requires": { - "@fluentui/date-time-utilities": "^7.9.0", - "@fluentui/react-focus": "^7.17.1", - "@fluentui/react-window-provider": "^1.0.1", - "@microsoft/load-themed-styles": "^1.10.26", - "@uifabric/foundation": "^7.9.21", - "@uifabric/icons": "^7.5.18", - "@uifabric/merge-styles": "^7.19.1", - "@uifabric/react-hooks": "^7.13.9", - "@uifabric/set-version": "^7.0.23", - "@uifabric/styling": "^7.16.19", - "@uifabric/utilities": "^7.33.2", - "prop-types": "^15.7.2", - "tslib": "^1.10.0" - } - } - } - }, - "@uifabric/file-type-icons": { - "version": "7.6.24", - "resolved": "https://registry.npmjs.org/@uifabric/file-type-icons/-/file-type-icons-7.6.24.tgz", - "integrity": "sha512-dmBpfWrWovw/TtwUtamfY4UqwsSqzTGm0Npvo/9b0mkIANrO6MGuz8M4MqvAWbzi/vq0dlGP5FF+ShkhtmrMnw==", - "requires": { - "@uifabric/set-version": "^7.0.23", - "@uifabric/styling": "^7.16.19", - "tslib": "^1.10.0" - }, - "dependencies": { - "@uifabric/styling": { - "version": "7.16.19", - "resolved": "https://registry.npmjs.org/@uifabric/styling/-/styling-7.16.19.tgz", - "integrity": "sha512-T5fjUCx0LbzUC8Myw15YCaBjdGbSrihWSiPHtLVW77k59yWAW947XnH73QngE8xU7kyKPH3AhQrUEBMB2NjHag==", - "requires": { - "@fluentui/theme": "^1.7.1", - "@microsoft/load-themed-styles": "^1.10.26", - "@uifabric/merge-styles": "^7.19.1", - "@uifabric/set-version": "^7.0.23", - "@uifabric/utilities": "^7.33.2", - "tslib": "^1.10.0" - } - } - } - }, - "@uifabric/foundation": { - "version": "7.9.21", - "resolved": "https://registry.npmjs.org/@uifabric/foundation/-/foundation-7.9.21.tgz", - "integrity": "sha512-z58pcC0hJr6S0iYLxNFoqfrfLIMxbSxFHRirk5LDT2HXbiVIYbJwbK4O0InS+sz3chdx8GGSdIUz7muXeT/D+A==", - "requires": { - "@uifabric/merge-styles": "^7.19.1", - "@uifabric/set-version": "^7.0.23", - "@uifabric/styling": "^7.16.19", - "@uifabric/utilities": "^7.33.2", - "tslib": "^1.10.0" - }, - "dependencies": { - "@uifabric/styling": { - "version": "7.16.19", - "resolved": "https://registry.npmjs.org/@uifabric/styling/-/styling-7.16.19.tgz", - "integrity": "sha512-T5fjUCx0LbzUC8Myw15YCaBjdGbSrihWSiPHtLVW77k59yWAW947XnH73QngE8xU7kyKPH3AhQrUEBMB2NjHag==", - "requires": { - "@fluentui/theme": "^1.7.1", - "@microsoft/load-themed-styles": "^1.10.26", - "@uifabric/merge-styles": "^7.19.1", - "@uifabric/set-version": "^7.0.23", - "@uifabric/utilities": "^7.33.2", - "tslib": "^1.10.0" - } - } - } - }, - "@uifabric/icons": { - "version": "7.5.18", - "resolved": "https://registry.npmjs.org/@uifabric/icons/-/icons-7.5.18.tgz", - "integrity": "sha512-gLPEccWlTER9NiXcOHZ+dSJ3tgLAQ4mTf3hTlKV7e7dKBTl95jzcemG5S2NJQ7xWPTH3+5K1Bpd+nqZo9EJw3w==", - "requires": { - "@uifabric/set-version": "^7.0.23", - "@uifabric/styling": "^7.16.19", - "tslib": "^1.10.0" - }, - "dependencies": { - "@uifabric/styling": { - "version": "7.16.19", - "resolved": "https://registry.npmjs.org/@uifabric/styling/-/styling-7.16.19.tgz", - "integrity": "sha512-T5fjUCx0LbzUC8Myw15YCaBjdGbSrihWSiPHtLVW77k59yWAW947XnH73QngE8xU7kyKPH3AhQrUEBMB2NjHag==", - "requires": { - "@fluentui/theme": "^1.7.1", - "@microsoft/load-themed-styles": "^1.10.26", - "@uifabric/merge-styles": "^7.19.1", - "@uifabric/set-version": "^7.0.23", - "@uifabric/utilities": "^7.33.2", - "tslib": "^1.10.0" - } - } - } - }, - "@uifabric/merge-styles": { - "version": "7.19.1", - "resolved": "https://registry.npmjs.org/@uifabric/merge-styles/-/merge-styles-7.19.1.tgz", - "integrity": "sha512-yqUwmk62Kgu216QNPE9vOfS3h0kiSbTvoqM5QcZi+IzpqsBOlzZx3A9Er9UiDaqHRd5lsYF5pO/jeUULmBWF/A==", - "requires": { - "@uifabric/set-version": "^7.0.23", - "tslib": "^1.10.0" - } - }, - "@uifabric/react-cards": { - "version": "0.109.110", - "resolved": "https://registry.npmjs.org/@uifabric/react-cards/-/react-cards-0.109.110.tgz", - "integrity": "sha512-x/X0+u7uWr/fv98HxLzI9K0eC0LXnzGV4PjspnMqj48r7Bkbzm6qNorXxWQDeq9LPuhHCuf0DyHrIn+umvGG4Q==", - "requires": { - "@microsoft/load-themed-styles": "^1.10.26", - "@uifabric/azure-themes": "^7.1.37", - "@uifabric/file-type-icons": "^7.3.13", - "@uifabric/foundation": "^7.7.33", - "@uifabric/set-version": "^7.0.15", - "@uifabric/styling": "^7.13.7", - "@uifabric/theme-samples": "^7.0.102", - "@uifabric/utilities": "^7.23.0", - "office-ui-fabric-react": "^7.121.10", - "tslib": "^1.10.0" - } - }, - "@uifabric/react-hooks": { - "version": "7.13.9", - "resolved": "https://registry.npmjs.org/@uifabric/react-hooks/-/react-hooks-7.13.9.tgz", - "integrity": "sha512-VtDg2b3ypYXX7MLp1STk1Fj6ZIeZktXnm0hu1Os/pGvq6xkuLRly5XP6ZSHitm8K7ZcMo48CcNL8smmiXprBQg==", - "requires": { - "@fluentui/react-window-provider": "^1.0.1", - "@uifabric/set-version": "^7.0.23", - "@uifabric/utilities": "^7.33.2", - "tslib": "^1.10.0" - } - }, - "@uifabric/set-version": { - "version": "7.0.23", - "resolved": "https://registry.npmjs.org/@uifabric/set-version/-/set-version-7.0.23.tgz", - "integrity": "sha512-9E+YKtnH2kyMKnK9XZZsqyM8OCxEJIIfxtaThTlQpYOzrWAGJxQADFbZ7+Usi0U2xHnWNPFROjq+B9ocEzhqMA==", - "requires": { - "tslib": "^1.10.0" - } - }, - "@uifabric/styling": { - "version": "7.13.7", - "resolved": "https://registry.npmjs.org/@uifabric/styling/-/styling-7.13.7.tgz", - "integrity": "sha512-XFaDkvQqhhHwlW9+Yd9LQogPq0a5TC4on2csRnJUwmlTJ4IQtgvbPdAxmxz+18HZMJezUXYn7/ubcQvNRMFSJQ==", - "requires": { - "@microsoft/load-themed-styles": "^1.10.26", - "@uifabric/merge-styles": "^7.16.0", - "@uifabric/set-version": "^7.0.15", - "@uifabric/utilities": "^7.23.0", - "tslib": "^1.10.0" - } - }, - "@uifabric/theme-samples": { - "version": "7.2.6", - "resolved": "https://registry.npmjs.org/@uifabric/theme-samples/-/theme-samples-7.2.6.tgz", - "integrity": "sha512-oDBKF1I9E9kd75Jmi/WYkd7oMNMMpmkdcrasjnLGjAr8uQUCHIZAWL6Kf0R7EHdvqOupX7LrDZtj4BBBAICfmw==", - "requires": { - "@fluentui/theme": "^1.7.1", - "@uifabric/set-version": "^7.0.23", - "@uifabric/variants": "^7.2.32", - "office-ui-fabric-react": "^7.157.0", - "tslib": "^1.10.0" - }, - "dependencies": { - "@uifabric/styling": { - "version": "7.16.19", - "resolved": "https://registry.npmjs.org/@uifabric/styling/-/styling-7.16.19.tgz", - "integrity": "sha512-T5fjUCx0LbzUC8Myw15YCaBjdGbSrihWSiPHtLVW77k59yWAW947XnH73QngE8xU7kyKPH3AhQrUEBMB2NjHag==", - "requires": { - "@fluentui/theme": "^1.7.1", - "@microsoft/load-themed-styles": "^1.10.26", - "@uifabric/merge-styles": "^7.19.1", - "@uifabric/set-version": "^7.0.23", - "@uifabric/utilities": "^7.33.2", - "tslib": "^1.10.0" - } - }, - "office-ui-fabric-react": { - "version": "7.157.0", - "resolved": "https://registry.npmjs.org/office-ui-fabric-react/-/office-ui-fabric-react-7.157.0.tgz", - "integrity": "sha512-nS0RfhQKho2S2hiUxHcgM47AZUK1EzbjkdWkofNHQk8q0PwJkQPTUjTbSuxhQNLzXHiaQJz930ZYUvRCZvlL1w==", - "requires": { - "@fluentui/date-time-utilities": "^7.9.0", - "@fluentui/react-focus": "^7.17.1", - "@fluentui/react-window-provider": "^1.0.1", - "@microsoft/load-themed-styles": "^1.10.26", - "@uifabric/foundation": "^7.9.21", - "@uifabric/icons": "^7.5.18", - "@uifabric/merge-styles": "^7.19.1", - "@uifabric/react-hooks": "^7.13.9", - "@uifabric/set-version": "^7.0.23", - "@uifabric/styling": "^7.16.19", - "@uifabric/utilities": "^7.33.2", - "prop-types": "^15.7.2", - "tslib": "^1.10.0" - } - } - } - }, - "@uifabric/utilities": { - "version": "7.33.2", - "resolved": "https://registry.npmjs.org/@uifabric/utilities/-/utilities-7.33.2.tgz", - "integrity": "sha512-v2c3IUJdpru/hoGNOwIW549O5D4XBAc5sLpB7RREGI5ywoWuIJlNyYtBEGOwhAY62J2blj11qi86Ep+oZDM/Kw==", - "requires": { - "@fluentui/dom-utilities": "^1.1.1", - "@uifabric/merge-styles": "^7.19.1", - "@uifabric/set-version": "^7.0.23", - "prop-types": "^15.7.2", - "tslib": "^1.10.0" - } - }, - "@uifabric/variants": { - "version": "7.2.32", - "resolved": "https://registry.npmjs.org/@uifabric/variants/-/variants-7.2.32.tgz", - "integrity": "sha512-ffyizuMGyF/8SnPqBvdQ5IceiN5nVQkrUI0+GhCuKmZC7IDlW+srjfzzjHZ9QLmnb3N5e/qlCrjbhfgFvTfZ6w==", - "requires": { - "@fluentui/theme": "^1.7.1", - "@uifabric/set-version": "^7.0.23", - "tslib": "^1.10.0" - } - }, "@ungap/url-search-params": { "version": "0.2.2", "resolved": "https://registry.npmjs.org/@ungap/url-search-params/-/url-search-params-0.2.2.tgz", @@ -5591,6 +6307,11 @@ "resolved": "https://registry.npmjs.org/abab/-/abab-2.0.5.tgz", "integrity": "sha512-9IK9EadsbHo6jLWIpxpR6pL0sazTXV6+SQv25ZB+F7Bj9mJNaOc4nCRabwd5M/JwmUa8idz6Eci6eKfJryPs6Q==" }, + "abbrev": { + "version": "1.1.1", + "resolved": "https://registry.npmjs.org/abbrev/-/abbrev-1.1.1.tgz", + "integrity": "sha512-nne9/IiQ/hzIhY6pdDnbBtz7DjPTKrY00P/zvPSm5pOFkl6xuGrGnXn/VtTNNfNtAfZ9/1RtehkszU9qcTii0Q==" + }, "abort-controller": { "version": "3.0.0", "resolved": "https://registry.npmjs.org/abort-controller/-/abort-controller-3.0.0.tgz", @@ -5641,6 +6362,44 @@ "resolved": "https://registry.npmjs.org/acorn-walk/-/acorn-walk-6.2.0.tgz", "integrity": "sha512-7evsyfH1cLOCdAzZAd43Cic04yKydNx0cF+7tiA19p1XnLLPU4dpCQOqpjqwokFe//vS0QqfqqjCS2JkiIs0cA==" }, + "adal-node": { + "version": "0.1.28", + "resolved": "https://registry.npmjs.org/adal-node/-/adal-node-0.1.28.tgz", + "integrity": "sha1-RoxLs+u9lrEnBmn0ucuk4AZepIU=", + "requires": { + "@types/node": "^8.0.47", + "async": ">=0.6.0", + "date-utils": "*", + "jws": "3.x.x", + "request": ">= 2.52.0", + "underscore": ">= 1.3.1", + "uuid": "^3.1.0", + "xmldom": ">= 0.1.x", + "xpath.js": "~1.1.0" + }, + "dependencies": { + "@types/node": { + "version": "8.10.66", + "resolved": "https://registry.npmjs.org/@types/node/-/node-8.10.66.tgz", + "integrity": "sha512-tktOkFUA4kXx2hhhrB8bIFb5TbwzS4uOhKEmwiD+NoiL0qtP2OQ9mFldbgD4dV1djrlBYP6eBuQZiWjuHUpqFw==" + }, + "jws": { + "version": "3.2.2", + "resolved": "https://registry.npmjs.org/jws/-/jws-3.2.2.tgz", + "integrity": "sha512-YHlZCB6lMTllWDtSPHz/ZXTsi8S00usEV6v1tjq8tOUZzw7DpSDWVXjXDre6ed1w/pd495ODpHZYSdkRTsa0HA==", + "requires": { + "jwa": "^1.4.1", + "safe-buffer": "^5.0.1" + } + } + } + }, + "address": { + "version": "1.1.2", + "resolved": "https://registry.npmjs.org/address/-/address-1.1.2.tgz", + "integrity": "sha512-aT6camzM4xEA54YVJYSqxz1kv4IHnQZRtThJJHhUMRExaU5spC7jX5ugSwTaTgJliIgs4VhZOk7htClvQ/LmRA==", + "dev": true + }, "agent-base": { "version": "6.0.2", "resolved": "https://registry.npmjs.org/agent-base/-/agent-base-6.0.2.tgz", @@ -5785,6 +6544,15 @@ "normalize-path": "^2.1.1" } }, + "append-transform": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/append-transform/-/append-transform-2.0.0.tgz", + "integrity": "sha512-7yeyCEurROLQJFv5Xj4lEGTy0borxepjFv1g22oAdqFu//SrAlDl1O1Nxx15SH1RoliUml6p8dwJW9jvZughhg==", + "dev": true, + "requires": { + "default-require-extensions": "^3.0.0" + } + }, "applicationinsights": { "version": "1.8.0", "resolved": "https://registry.npmjs.org/applicationinsights/-/applicationinsights-1.8.0.tgz", @@ -5974,11 +6742,6 @@ "resolved": "https://registry.npmjs.org/asap/-/asap-2.0.6.tgz", "integrity": "sha1-5QNHYR1+aQlDIIu9r+vLwvuGbUY=" }, - "asmcrypto.js": { - "version": "2.3.2", - "resolved": "https://registry.npmjs.org/asmcrypto.js/-/asmcrypto.js-2.3.2.tgz", - "integrity": "sha512-3FgFARf7RupsZETQ1nHnhLUUvpcttcCq1iZCaVAbJZbCZ5VNRrNyvpDyHTOb0KC3llFcsyOT/a99NZcCbeiEsA==" - }, "asn1": { "version": "0.2.4", "resolved": "https://registry.npmjs.org/asn1/-/asn1-0.2.4.tgz", @@ -5997,14 +6760,14 @@ "inherits": "^2.0.1", "minimalistic-assert": "^1.0.0", "safer-buffer": "^2.1.0" - } - }, - "asn1js": { - "version": "2.0.26", - "resolved": "https://registry.npmjs.org/asn1js/-/asn1js-2.0.26.tgz", - "integrity": "sha512-yG89F0j9B4B0MKIcFyWWxnpZPLaNTjCj4tkE3fjbAoo0qmpGw0PYYqSbX/4ebnd9Icn8ZgK4K1fvDyEtW1JYtQ==", - "requires": { - "pvutils": "^1.0.17" + }, + "dependencies": { + "bn.js": { + "version": "4.12.0", + "resolved": "https://registry.npmjs.org/bn.js/-/bn.js-4.12.0.tgz", + "integrity": "sha512-c98Bf3tPniI+scsdk237ku1Dc3ujXQTSgyiPUDEOe7tRkhrqridvh8klBv0HCEso1OLOYcHuCv/cS6DNxKH+ZA==", + "dev": true + } } }, "assert": { @@ -6059,7 +6822,6 @@ "version": "2.6.3", "resolved": "https://registry.npmjs.org/async/-/async-2.6.3.tgz", "integrity": "sha512-zflvls11DCy+dQWzTW2dzuilv8Z5X/pjfmZOWba6TNIVDm+2UDaJmXSOXlasHKfNBs8oo3M0aT50fDEWfKZjXg==", - "dev": true, "requires": { "lodash": "^4.17.14" } @@ -6097,6 +6859,12 @@ "resolved": "https://registry.npmjs.org/asynckit/-/asynckit-0.4.0.tgz", "integrity": "sha1-x57Zf380y48robyXkLzDZkdLS3k=" }, + "at-least-node": { + "version": "1.0.0", + "resolved": "https://registry.npmjs.org/at-least-node/-/at-least-node-1.0.0.tgz", + "integrity": "sha512-+q/t7Ekv1EDY2l6Gda6LLiX14rU9TV20Wa3ofeQmwPFZbOMo9DXrLbOjFaaclkXKWidIaopwAObQDqwWtGUjqg==", + "dev": true + }, "atob": { "version": "2.1.2", "resolved": "https://registry.npmjs.org/atob/-/atob-2.1.2.tgz", @@ -6112,21 +6880,6 @@ "resolved": "https://registry.npmjs.org/aws4/-/aws4-1.11.0.tgz", "integrity": "sha512-xh1Rl34h6Fi1DC2WWKfxUTVqRsNnr6LsKz2+hfwDxQJWmrx8+c7ylaqBMcHfl1U1r2dsifOvKX3LQuLNZ+XSvA==" }, - "axe-core": { - "version": "3.5.5", - "resolved": "https://registry.npmjs.org/axe-core/-/axe-core-3.5.5.tgz", - "integrity": "sha512-5P0QZ6J5xGikH780pghEdbEKijCTrruK9KxtPZCFWUpef0f6GipO+xEZ5GKCb020mmqgbiNO6TcA55CriL784Q==", - "dev": true - }, - "axe-puppeteer": { - "version": "1.1.0", - "resolved": "https://registry.npmjs.org/axe-puppeteer/-/axe-puppeteer-1.1.0.tgz", - "integrity": "sha512-VS17Y1rDQe6A0PdeTPxwOSBfmOdj6efgxyre9cN1du1snnVilczSDtQsgifBKBlzoL/3DKfGpgIi+N+zrzODOg==", - "dev": true, - "requires": { - "axe-core": "^3.5.3" - } - }, "axios": { "version": "0.21.1", "resolved": "https://registry.npmjs.org/axios/-/axios-0.21.1.tgz", @@ -6285,23 +7038,6 @@ "resolved": "https://registry.npmjs.org/babel-plugin-syntax-jsx/-/babel-plugin-syntax-jsx-6.18.0.tgz", "integrity": "sha1-CvMqmm4Tyno/1QaeYtew9Y0NiUY=" }, - "babel-polyfill": { - "version": "6.26.0", - "resolved": "https://registry.npmjs.org/babel-polyfill/-/babel-polyfill-6.26.0.tgz", - "integrity": "sha1-N5k3q8Z9eJWXCtxiHyhM2WbPIVM=", - "requires": { - "babel-runtime": "^6.26.0", - "core-js": "^2.5.0", - "regenerator-runtime": "^0.10.5" - }, - "dependencies": { - "regenerator-runtime": { - "version": "0.10.5", - "resolved": "https://registry.npmjs.org/regenerator-runtime/-/regenerator-runtime-0.10.5.tgz", - "integrity": "sha1-M2w+/BIgrc7dosn6tntaeVWjNlg=" - } - } - }, "babel-preset-current-node-syntax": { "version": "0.1.4", "resolved": "https://registry.npmjs.org/babel-preset-current-node-syntax/-/babel-preset-current-node-syntax-0.1.4.tgz", @@ -6339,6 +7075,11 @@ "regenerator-runtime": "^0.11.0" }, "dependencies": { + "core-js": { + "version": "2.6.12", + "resolved": "https://registry.npmjs.org/core-js/-/core-js-2.6.12.tgz", + "integrity": "sha512-Kb2wC0fvsWfQrgk8HU5lW6U/Lcs8+9aaYcy4ZFc6DDlo4nZ7n70dEgE5rtR0oG6ufKDUnrwfWL1mXR5ljDatrQ==" + }, "regenerator-runtime": { "version": "0.11.1", "resolved": "https://registry.npmjs.org/regenerator-runtime/-/regenerator-runtime-0.11.1.tgz", @@ -6440,6 +7181,16 @@ "resolved": "https://registry.npmjs.org/before-after-hook/-/before-after-hook-2.1.0.tgz", "integrity": "sha512-IWIbu7pMqyw3EAJHzzHbWa85b6oud/yfKYg5rqB5hNE8CeMi3nX+2C2sj0HswfblST86hpVEOAb9x34NZd6P7A==" }, + "belter": { + "version": "1.0.164", + "resolved": "https://registry.npmjs.org/belter/-/belter-1.0.164.tgz", + "integrity": "sha512-aDRwk/yvRmesbEXixhbJ0kGeFmJth2kXZtqB8Dpk5xpfU79VPu+AX5DkE3b4Q6wCINNIetYhSZdSE255IKao2g==", + "requires": { + "cross-domain-safe-weakmap": "^1", + "cross-domain-utils": "^2", + "zalgo-promise": "^1" + } + }, "bfj": { "version": "6.1.2", "resolved": "https://registry.npmjs.org/bfj/-/bfj-6.1.2.tgz", @@ -6471,14 +7222,6 @@ "optional": true, "requires": { "file-uri-to-path": "1.0.0" - }, - "dependencies": { - "file-uri-to-path": { - "version": "1.0.0", - "resolved": "https://registry.npmjs.org/file-uri-to-path/-/file-uri-to-path-1.0.0.tgz", - "integrity": "sha512-0Zt+s3L7Vf1biwWZ29aARiVYLx7iMGnEUl9x33fbB/j3jR81u/O2LbqK+Bm1CDSNDKVtJ/YjwY7TUd5SkeLQLw==", - "optional": true - } } }, "bintrees": { @@ -6487,9 +7230,10 @@ "integrity": "sha1-SfiW1uhYpKSZ34XDj7OZua/4QPg=" }, "bl": { - "version": "4.0.3", - "resolved": "https://registry.npmjs.org/bl/-/bl-4.0.3.tgz", - "integrity": "sha512-fs4G6/Hu4/EE+F75J8DuN/0IpQqNjAdC7aEQv7Qt8MHGUH7Ckv2MwTEEeN9QehD0pfIDkMI1bkHYkKy7xHyKIg==", + "version": "4.1.0", + "resolved": "https://registry.npmjs.org/bl/-/bl-4.1.0.tgz", + "integrity": "sha512-1W07cM9gS6DcLperZfFSj+bWLtaPGSOHWhPiGzXmvVJbRLdG82sH/Kn8EtW1VqWVA54AKf2h5k5BbnIbwF3h6w==", + "optional": true, "requires": { "buffer": "^5.5.0", "inherits": "^2.0.4", @@ -6500,6 +7244,7 @@ "version": "5.7.1", "resolved": "https://registry.npmjs.org/buffer/-/buffer-5.7.1.tgz", "integrity": "sha512-EHcyIPBQ4BSGlvjB16k5KgAJ27CIsHY/2JBmCRReo48y9rQ3MaUzWX3KVlBa4U7MyX02HdVj0K7C3WaB3ju7FQ==", + "optional": true, "requires": { "base64-js": "^1.3.1", "ieee754": "^1.1.13" @@ -6509,6 +7254,7 @@ "version": "3.6.0", "resolved": "https://registry.npmjs.org/readable-stream/-/readable-stream-3.6.0.tgz", "integrity": "sha512-BViHy7LKeTz4oNnkcLJ+lVSL6vpiFeX6/d3oSH8zCW7UxP2onchk+vTGB143xuFjHS3deTgkKoXXymXqymiIdA==", + "optional": true, "requires": { "inherits": "^2.0.3", "string_decoder": "^1.1.1", @@ -6524,9 +7270,10 @@ "dev": true }, "bn.js": { - "version": "4.11.9", - "resolved": "https://registry.npmjs.org/bn.js/-/bn.js-4.11.9.tgz", - "integrity": "sha512-E6QoYqCKZfgatHTdHzs1RRKP7ip4vvm+EyRUeE2RF0NblwVvb0p6jSVeNTOFxPn26QXN2o6SMfNxKp6kU8zQaw==" + "version": "5.2.0", + "resolved": "https://registry.npmjs.org/bn.js/-/bn.js-5.2.0.tgz", + "integrity": "sha512-D7iWRBvnZE8ecXiLj/9wbxH7Tk79fAh8IHaTNq1RWRixsS02W+5qS+iE9yq6RYl0asXx5tw0bLhmT5pIfbSquw==", + "dev": true }, "body-parser": { "version": "1.19.0", @@ -6672,7 +7419,8 @@ "brorand": { "version": "1.1.0", "resolved": "https://registry.npmjs.org/brorand/-/brorand-1.1.0.tgz", - "integrity": "sha1-EsJe/kCkXjwyPrhnWgoM5XsiNx8=" + "integrity": "sha1-EsJe/kCkXjwyPrhnWgoM5XsiNx8=", + "dev": true }, "browser-process-hrtime": { "version": "1.0.0", @@ -6739,14 +7487,6 @@ "requires": { "bn.js": "^5.0.0", "randombytes": "^2.0.1" - }, - "dependencies": { - "bn.js": { - "version": "5.1.3", - "resolved": "https://registry.npmjs.org/bn.js/-/bn.js-5.1.3.tgz", - "integrity": "sha512-GkTiFpjFtUzU9CbMeJ5iazkCzGL3jrhzerzZIuqLABjbwRaFt33I9tUdSNryIptM+RxDet6OKm2WnLXzW51KsQ==", - "dev": true - } } }, "browserify-sign": { @@ -6766,12 +7506,6 @@ "safe-buffer": "^5.2.0" }, "dependencies": { - "bn.js": { - "version": "5.1.3", - "resolved": "https://registry.npmjs.org/bn.js/-/bn.js-5.1.3.tgz", - "integrity": "sha512-GkTiFpjFtUzU9CbMeJ5iazkCzGL3jrhzerzZIuqLABjbwRaFt33I9tUdSNryIptM+RxDet6OKm2WnLXzW51KsQ==", - "dev": true - }, "readable-stream": { "version": "3.6.0", "resolved": "https://registry.npmjs.org/readable-stream/-/readable-stream-3.6.0.tgz", @@ -6880,9 +7614,9 @@ "dev": true }, "cacache": { - "version": "15.0.5", - "resolved": "https://registry.npmjs.org/cacache/-/cacache-15.0.5.tgz", - "integrity": "sha512-lloiL22n7sOjEEXdL8NAjTgv9a1u43xICE9/203qonkZUCj5X1UEWIdf2/Y0d6QcCtMzbKQyhrcDbdvlZTs/+A==", + "version": "15.0.6", + "resolved": "https://registry.npmjs.org/cacache/-/cacache-15.0.6.tgz", + "integrity": "sha512-g1WYDMct/jzW+JdWEyjaX2zoBkZ6ZT9VpOyp2I/VMtDsNLffNat3kqPFfi1eDRSK9/SuKGyORDHcQMcPF8sQ/w==", "requires": { "@npmcli/move-file": "^1.0.1", "chownr": "^2.0.0", @@ -6898,7 +7632,7 @@ "p-map": "^4.0.0", "promise-inflight": "^1.0.1", "rimraf": "^3.0.2", - "ssri": "^8.0.0", + "ssri": "^8.0.1", "tar": "^6.0.2", "unique-filename": "^1.1.1" }, @@ -6934,6 +7668,47 @@ "unset-value": "^1.0.0" } }, + "caching-transform": { + "version": "4.0.0", + "resolved": "https://registry.npmjs.org/caching-transform/-/caching-transform-4.0.0.tgz", + "integrity": "sha512-kpqOvwXnjjN44D89K5ccQC+RUrsy7jB/XLlRrx0D7/2HNcTPqzsb6XgYoErwko6QsV184CA2YgS1fxDiiDZMWA==", + "dev": true, + "requires": { + "hasha": "^5.0.0", + "make-dir": "^3.0.0", + "package-hash": "^4.0.0", + "write-file-atomic": "^3.0.0" + }, + "dependencies": { + "make-dir": { + "version": "3.1.0", + "resolved": "https://registry.npmjs.org/make-dir/-/make-dir-3.1.0.tgz", + "integrity": "sha512-g3FeP20LNwhALb/6Cz6Dd4F2ngze0jz7tbzrD2wAV+o9FeNHe4rL+yK2md0J/fiSf1sa1ADhXqi5+oVwOM/eGw==", + "dev": true, + "requires": { + "semver": "^6.0.0" + } + }, + "semver": { + "version": "6.3.0", + "resolved": "https://registry.npmjs.org/semver/-/semver-6.3.0.tgz", + "integrity": "sha512-b39TBaTSfV6yBrapU89p5fKekE2m/NwnDocOVruQFS1/veMgdzuPcnOM34M6CwxW8jH/lxEa5rBoDeUwu5HHTw==", + "dev": true + }, + "write-file-atomic": { + "version": "3.0.3", + "resolved": "https://registry.npmjs.org/write-file-atomic/-/write-file-atomic-3.0.3.tgz", + "integrity": "sha512-AvHcyZ5JnSfq3ioSyjrBkH9yW4m7Ayk8/9My/DD9onKeu/94fwrMocemO2QAJFAlnnDN+ZDS+ZjAR5ua1/PV/Q==", + "dev": true, + "requires": { + "imurmurhash": "^0.1.4", + "is-typedarray": "^1.0.0", + "signal-exit": "^3.0.2", + "typedarray-to-buffer": "^3.1.5" + } + } + } + }, "call-bind": { "version": "1.0.2", "resolved": "https://registry.npmjs.org/call-bind/-/call-bind-1.0.2.tgz", @@ -7119,9 +7894,9 @@ }, "dependencies": { "anymatch": { - "version": "3.1.1", - "resolved": "https://registry.npmjs.org/anymatch/-/anymatch-3.1.1.tgz", - "integrity": "sha512-mM8522psRCqzV+6LhomX5wgp25YVibjh8Wj23I5RPkPppSVSjyKD2A2mBJmWGa+KN7f2D6LNh9jkBCeyLktzjg==", + "version": "3.1.2", + "resolved": "https://registry.npmjs.org/anymatch/-/anymatch-3.1.2.tgz", + "integrity": "sha512-P43ePfOAIupkguHUycrc4qJ9kz8ZiuOUijaETwX7THt0Y/GNK7v0aa8rY816xWjZ7rJdA5XdMcpVFTKMq+RvWg==", "dev": true, "optional": true, "requires": { @@ -7150,9 +7925,9 @@ } }, "fsevents": { - "version": "2.3.1", - "resolved": "https://registry.npmjs.org/fsevents/-/fsevents-2.3.1.tgz", - "integrity": "sha512-YR47Eg4hChJGAB1O3yEAOkGO+rlzutoICGqGo9EZ4lKWokzZRSyIW1QmTzqjtw8MJdj9srP869CuWw/hyzSiBw==", + "version": "2.3.2", + "resolved": "https://registry.npmjs.org/fsevents/-/fsevents-2.3.2.tgz", + "integrity": "sha512-xiqMQR4xAeHTuB9uWm+fFRcIOgKBMiOBP+eXiyT7jsgVCq1bkVygt00oASowB7EdtpOHaaPgKt812P9ab+DDKA==", "dev": true, "optional": true }, @@ -7185,7 +7960,8 @@ "chownr": { "version": "1.1.4", "resolved": "https://registry.npmjs.org/chownr/-/chownr-1.1.4.tgz", - "integrity": "sha512-jJ0bqzaylmJtVnNgzTeSOs8DPavpbYgEr/b0YL8/2GO3xJEhInFmhKMUnEJQjZumK7KXGFhUy89PrsJWlakBVg==" + "integrity": "sha512-jJ0bqzaylmJtVnNgzTeSOs8DPavpbYgEr/b0YL8/2GO3xJEhInFmhKMUnEJQjZumK7KXGFhUy89PrsJWlakBVg==", + "optional": true }, "chrome-trace-event": { "version": "1.0.2", @@ -7211,6 +7987,12 @@ "safe-buffer": "^5.0.1" } }, + "cjs-module-lexer": { + "version": "0.6.0", + "resolved": "https://registry.npmjs.org/cjs-module-lexer/-/cjs-module-lexer-0.6.0.tgz", + "integrity": "sha512-uc2Vix1frTfnuzxxu1Hp4ktSvM3QaI4oXl4ZUqL1wjTu/BGki9TrCWoqLTg/drR1KwAEarXuRFCG2Svr1GxPFw==", + "dev": true + }, "class-utils": { "version": "0.3.6", "resolved": "https://registry.npmjs.org/class-utils/-/class-utils-0.3.6.tgz", @@ -7339,39 +8121,6 @@ "integrity": "sha1-G39Ln1kfHo+DZwQBYANFoCiHQ18=", "dev": true }, - "clone-deep": { - "version": "0.2.4", - "resolved": "https://registry.npmjs.org/clone-deep/-/clone-deep-0.2.4.tgz", - "integrity": "sha1-TnPdCen7lxzDhnDF3O2cGJZIHMY=", - "dev": true, - "requires": { - "for-own": "^0.1.3", - "is-plain-object": "^2.0.1", - "kind-of": "^3.0.2", - "lazy-cache": "^1.0.3", - "shallow-clone": "^0.1.2" - }, - "dependencies": { - "for-own": { - "version": "0.1.5", - "resolved": "https://registry.npmjs.org/for-own/-/for-own-0.1.5.tgz", - "integrity": "sha1-UmXGgaTylNq78XyVCbZ2OqhFEM4=", - "dev": true, - "requires": { - "for-in": "^1.0.1" - } - }, - "kind-of": { - "version": "3.2.2", - "resolved": "https://registry.npmjs.org/kind-of/-/kind-of-3.2.2.tgz", - "integrity": "sha1-MeohpzS6ubuw8yRm2JOupR5KPGQ=", - "dev": true, - "requires": { - "is-buffer": "^1.1.5" - } - } - } - }, "cls-hooked": { "version": "4.2.2", "resolved": "https://registry.npmjs.org/cls-hooked/-/cls-hooked-4.2.2.tgz", @@ -7393,9 +8142,9 @@ "integrity": "sha1-DQcLTQQ6W+ozovGkDi7bPZpMz3c=" }, "codemirror": { - "version": "5.57.0", - "resolved": "https://registry.npmjs.org/codemirror/-/codemirror-5.57.0.tgz", - "integrity": "sha512-WGc6UL7Hqt+8a6ZAsj/f1ApQl3NPvHY/UQSzG6fB6l4BjExgVdhFaxd7mRTw1UCiYe/6q86zHP+kfvBQcZGvUg==" + "version": "5.61.1", + "resolved": "https://registry.npmjs.org/codemirror/-/codemirror-5.61.1.tgz", + "integrity": "sha512-+D1NZjAucuzE93vJGbAaXzvoBHwp9nJZWWWF9utjv25+5AZUiah6CIlfb4ikG4MoDsFsCG8niiJH5++OO2LgIQ==" }, "collapse-white-space": { "version": "1.0.6", @@ -7441,6 +8190,12 @@ "integrity": "sha512-puCDz0CzydiSYOrnXpz/PKd69zRrribezjtE9yd4zvytoRc8+RY/KJPvtPFKZS3E3wP6neGyMe0vOTlHO5L3Pw==", "dev": true }, + "colors": { + "version": "1.4.0", + "resolved": "https://registry.npmjs.org/colors/-/colors-1.4.0.tgz", + "integrity": "sha512-a+UqTh4kgZg/SlGvfbzDHpgRu7AAQOmmqRHJnxhRZICKFUT91brVhNNt58CMWU9PsBbv3PDCZUHbVxuDiH2mtA==", + "dev": true + }, "combined-stream": { "version": "1.0.8", "resolved": "https://registry.npmjs.org/combined-stream/-/combined-stream-1.0.8.tgz", @@ -7621,12 +8376,6 @@ "integrity": "sha1-4wOogrNCzD7oylE6eZmXNNqzriw=", "dev": true }, - "cookiejar": { - "version": "2.1.2", - "resolved": "https://registry.npmjs.org/cookiejar/-/cookiejar-2.1.2.tgz", - "integrity": "sha512-Mw+adcfzPxcPeI+0WlvRrr/3lGVO0bD75SxX6811cxSh1Wbxx7xZBGK1eVtDf6si8rg2lhnUjsVLMFMfbRIuwA==", - "dev": true - }, "copy-concurrently": { "version": "1.0.5", "resolved": "https://registry.npmjs.org/copy-concurrently/-/copy-concurrently-1.0.5.tgz", @@ -7710,11 +8459,6 @@ } } }, - "core-js": { - "version": "2.6.12", - "resolved": "https://registry.npmjs.org/core-js/-/core-js-2.6.12.tgz", - "integrity": "sha512-Kb2wC0fvsWfQrgk8HU5lW6U/Lcs8+9aaYcy4ZFc6DDlo4nZ7n70dEgE5rtR0oG6ufKDUnrwfWL1mXR5ljDatrQ==" - }, "core-js-compat": { "version": "3.8.3", "resolved": "https://registry.npmjs.org/core-js-compat/-/core-js-compat-3.8.3.tgz", @@ -7751,6 +8495,14 @@ "requires": { "bn.js": "^4.1.0", "elliptic": "^6.5.3" + }, + "dependencies": { + "bn.js": { + "version": "4.12.0", + "resolved": "https://registry.npmjs.org/bn.js/-/bn.js-4.12.0.tgz", + "integrity": "sha512-c98Bf3tPniI+scsdk237ku1Dc3ujXQTSgyiPUDEOe7tRkhrqridvh8klBv0HCEso1OLOYcHuCv/cS6DNxKH+ZA==", + "dev": true + } } }, "create-file-webpack": { @@ -7808,6 +8560,22 @@ "warning": "^4.0.3" } }, + "cross-domain-safe-weakmap": { + "version": "1.0.28", + "resolved": "https://registry.npmjs.org/cross-domain-safe-weakmap/-/cross-domain-safe-weakmap-1.0.28.tgz", + "integrity": "sha512-gfQiQYSdWr9cYFVpmzp+b6MyTnefefDHr+fvm+JVv20hQxetV5J6chZOAusrpM/kFpTTbVDnHCziBFaREvgc0Q==", + "requires": { + "cross-domain-utils": "^2.0.0" + } + }, + "cross-domain-utils": { + "version": "2.0.34", + "resolved": "https://registry.npmjs.org/cross-domain-utils/-/cross-domain-utils-2.0.34.tgz", + "integrity": "sha512-ke4PirGRXwEElEmE/7k5aCvCW+EqbgseT7AOObzFfaVnOLuEVN9SjVWoOfS/qAT0rDPn3ggmNDW6mguMBy4HgA==", + "requires": { + "zalgo-promise": "^1.0.11" + } + }, "cross-spawn": { "version": "6.0.5", "resolved": "https://registry.npmjs.org/cross-spawn/-/cross-spawn-6.0.5.tgz", @@ -7930,23 +8698,6 @@ } } }, - "css-rules": { - "version": "1.0.9", - "resolved": "https://registry.npmjs.org/css-rules/-/css-rules-1.0.9.tgz", - "integrity": "sha512-HU0mZu0RFIjRRWn4QIAO8MaE1W7q+JSCIiiKE9g2s3b0xgDEAYXG/F9n35xAkaU9NpvUbxBTMJWx1quRRPXbjg==", - "dev": true, - "requires": { - "cssom": "^0.4.4" - }, - "dependencies": { - "cssom": { - "version": "0.4.4", - "resolved": "https://registry.npmjs.org/cssom/-/cssom-0.4.4.tgz", - "integrity": "sha512-p3pvU7r1MyyqbTk+WbNJIgJjG2VmTIaB10rI93LzVPrmDJKkzKYMtxxyAvQXR/NS6otuzveI7+7BBq3SjBS2mw==", - "dev": true - } - } - }, "css-select": { "version": "3.1.2", "resolved": "https://registry.npmjs.org/css-select/-/css-select-3.1.2.tgz", @@ -8446,12 +9197,6 @@ "assert-plus": "^1.0.0" } }, - "data-uri-to-buffer": { - "version": "3.0.1", - "resolved": "https://registry.npmjs.org/data-uri-to-buffer/-/data-uri-to-buffer-3.0.1.tgz", - "integrity": "sha512-WboRycPNsVw3B3TL559F7kuBUM4d8CgMEvk6xEJlOp7OBPjt6G7z8WMWlD2rOFZLk6OYfFIUGsCOWzcQH9K2og==", - "dev": true - }, "data-urls": { "version": "1.1.0", "resolved": "https://registry.npmjs.org/data-urls/-/data-urls-1.1.0.tgz", @@ -8525,6 +9270,11 @@ "resolved": "https://registry.npmjs.org/date-fns/-/date-fns-1.29.0.tgz", "integrity": "sha512-lbTXWZ6M20cWH8N9S6afb0SBm6tMk+uUg6z3MqHPKE9atmsY3kJkTm8vKe93izJ2B2+q5MV990sM2CHgtAZaOw==" }, + "date-utils": { + "version": "1.2.21", + "resolved": "https://registry.npmjs.org/date-utils/-/date-utils-1.2.21.tgz", + "integrity": "sha1-YfsWzcEnSzyayq/+n8ad+HIKK2Q=" + }, "dayjs": { "version": "1.8.19", "resolved": "https://registry.npmjs.org/dayjs/-/dayjs-1.8.19.tgz", @@ -8541,6 +9291,13 @@ "integrity": "sha512-doEwdvm4PCeK4K3RQN2ZC2BYUBaxwLARCqZmMjtF8a51J2Rb0xpVloFRnCODwqjpwnAoao4pelN8l3RJdv3gRQ==", "requires": { "ms": "2.1.2" + }, + "dependencies": { + "ms": { + "version": "2.1.2", + "resolved": "https://registry.npmjs.org/ms/-/ms-2.1.2.tgz", + "integrity": "sha512-sGkPx+VjMtmA6MX27oA4FBFELFCZZ4S4XqeGOXCv68tT+jb3vk/RyaKWP0PTKyWtmLSM0b+adUTEvbs1PEaH2w==" + } } }, "decamelize": { @@ -8548,6 +9305,12 @@ "resolved": "https://registry.npmjs.org/decamelize/-/decamelize-1.2.0.tgz", "integrity": "sha1-9lNNFRSCabIDUue+4m9QH5oZEpA=" }, + "decimal.js": { + "version": "10.2.1", + "resolved": "https://registry.npmjs.org/decimal.js/-/decimal.js-10.2.1.tgz", + "integrity": "sha512-KaL7+6Fw6i5A2XSnsbhm/6B+NuEA7TZ4vqxnd5tXz9sbKtrN9Srj8ab4vKVdK8YAqZO9P1kg45Y6YLoduPf+kw==", + "dev": true + }, "decode-uri-component": { "version": "0.2.0", "resolved": "https://registry.npmjs.org/decode-uri-component/-/decode-uri-component-0.2.0.tgz", @@ -8562,6 +9325,12 @@ "mimic-response": "^2.0.0" } }, + "dedent": { + "version": "0.7.0", + "resolved": "https://registry.npmjs.org/dedent/-/dedent-0.7.0.tgz", + "integrity": "sha1-JJXduvbrh0q7Dhvp3yLS5aVEMmw=", + "dev": true + }, "deep-diff": { "version": "0.3.8", "resolved": "https://registry.npmjs.org/deep-diff/-/deep-diff-0.3.8.tgz", @@ -8594,8 +9363,7 @@ "deepmerge": { "version": "4.2.2", "resolved": "https://registry.npmjs.org/deepmerge/-/deepmerge-4.2.2.tgz", - "integrity": "sha512-FJ3UgI4gIl+PHZm53knsuSFpE+nESMr7M4v9QcgB7S63Kj/6WqMiFQJpBBYz1Pt+66bZpP3Q7Lye0Oo9MPKEdg==", - "dev": true + "integrity": "sha512-FJ3UgI4gIl+PHZm53knsuSFpE+nESMr7M4v9QcgB7S63Kj/6WqMiFQJpBBYz1Pt+66bZpP3Q7Lye0Oo9MPKEdg==" }, "default-compare": { "version": "1.0.0", @@ -8622,6 +9390,23 @@ "ip-regex": "^2.1.0" } }, + "default-require-extensions": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/default-require-extensions/-/default-require-extensions-3.0.0.tgz", + "integrity": "sha512-ek6DpXq/SCpvjhpFsLFRVtIxJCRw6fUR42lYMVZuUMK7n8eMz4Uh5clckdBjEpLhn/gEBZo7hDJnJcwdKLKQjg==", + "dev": true, + "requires": { + "strip-bom": "^4.0.0" + }, + "dependencies": { + "strip-bom": { + "version": "4.0.0", + "resolved": "https://registry.npmjs.org/strip-bom/-/strip-bom-4.0.0.tgz", + "integrity": "sha512-3xurFv5tEgii33Zi8Jtp55wEIILR9eh34FAW00PZf+JnSsTmV/ioewSgQl97JHvgjoRGwPShsWm+IdrxB35d0w==", + "dev": true + } + } + }, "define-properties": { "version": "1.1.3", "resolved": "https://registry.npmjs.org/define-properties/-/define-properties-1.1.3.tgz", @@ -8667,34 +9452,6 @@ } } }, - "degenerator": { - "version": "2.2.0", - "resolved": "https://registry.npmjs.org/degenerator/-/degenerator-2.2.0.tgz", - "integrity": "sha512-aiQcQowF01RxFI4ZLFMpzyotbQonhNpBao6dkI8JPk5a+hmSjR5ErHp2CQySmQe8os3VBqLCIh87nDBgZXvsmg==", - "dev": true, - "requires": { - "ast-types": "^0.13.2", - "escodegen": "^1.8.1", - "esprima": "^4.0.0" - }, - "dependencies": { - "ast-types": { - "version": "0.13.4", - "resolved": "https://registry.npmjs.org/ast-types/-/ast-types-0.13.4.tgz", - "integrity": "sha512-x1FCFnFifvYDDzTaLII71vG5uvDwgtmDTEVWAxrgeiR8VjMONcCXJx7E+USjDtHlwFmt9MysbqgF9b9Vjr6w+w==", - "dev": true, - "requires": { - "tslib": "^2.0.1" - } - }, - "tslib": { - "version": "2.1.0", - "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.1.0.tgz", - "integrity": "sha512-hcVC3wYEziELGGmEEXue7D75zbwIIVUMWAVbHItGPx0ziyXxrOMQx4rQEVEV45Ut/1IotuEvwqPopzIOkDMf0A==", - "dev": true - } - } - }, "del": { "version": "4.1.1", "resolved": "https://registry.npmjs.org/del/-/del-4.1.1.tgz", @@ -8805,6 +9562,7 @@ "version": "1.0.1", "resolved": "https://registry.npmjs.org/des.js/-/des.js-1.0.1.tgz", "integrity": "sha512-Q0I4pfFrv2VPd34/vfLrFOoRmlYj3OV50i7fskps1jZWK1kApMWWT9G6RRUeYedLcBDIhnSDaUvJMb3AhUlaEA==", + "dev": true, "requires": { "inherits": "^2.0.1", "minimalistic-assert": "^1.0.0" @@ -8838,6 +9596,33 @@ "integrity": "sha512-ZIzRpLJrOj7jjP2miAtgqIfmzbxa4ZOr5jJc601zklsfEx9oTzmmj2nVpIPRpNlRTIh8lc1kyViIY7BWSGNmKw==", "dev": true }, + "detect-port-alt": { + "version": "1.1.6", + "resolved": "https://registry.npmjs.org/detect-port-alt/-/detect-port-alt-1.1.6.tgz", + "integrity": "sha512-5tQykt+LqfJFBEYaDITx7S7cR7mJ/zQmLXZ2qt5w04ainYZw6tBf9dBunMjVeVOdYVRUzUOE4HkY5J7+uttb5Q==", + "dev": true, + "requires": { + "address": "^1.0.1", + "debug": "^2.6.0" + }, + "dependencies": { + "debug": { + "version": "2.6.9", + "resolved": "https://registry.npmjs.org/debug/-/debug-2.6.9.tgz", + "integrity": "sha512-bC7ElrdJaJnPbAP+1EotYvqZsb3ecl5wi6Bfi6BJTUcNowp6cvspg0jXznRTKDjm/E7AdgFBVeAPVMNcKGsHMA==", + "dev": true, + "requires": { + "ms": "2.0.0" + } + }, + "ms": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/ms/-/ms-2.0.0.tgz", + "integrity": "sha1-VgiurfwAvmwpAd9fmGF4jeDVl8g=", + "dev": true + } + } + }, "diagnostic-channel": { "version": "0.3.1", "resolved": "https://registry.npmjs.org/diagnostic-channel/-/diagnostic-channel-0.3.1.tgz", @@ -8871,6 +9656,14 @@ "bn.js": "^4.1.0", "miller-rabin": "^4.0.0", "randombytes": "^2.0.0" + }, + "dependencies": { + "bn.js": { + "version": "4.12.0", + "resolved": "https://registry.npmjs.org/bn.js/-/bn.js-4.12.0.tgz", + "integrity": "sha512-c98Bf3tPniI+scsdk237ku1Dc3ujXQTSgyiPUDEOe7tRkhrqridvh8klBv0HCEso1OLOYcHuCv/cS6DNxKH+ZA==", + "dev": true + } } }, "dir-glob": { @@ -8982,6 +9775,11 @@ } } }, + "dom-to-image": { + "version": "2.6.0", + "resolved": "https://registry.npmjs.org/dom-to-image/-/dom-to-image-2.6.0.tgz", + "integrity": "sha1-ilA2CAiMh7HCL5A0rgMuGJiVWGc=" + }, "dom-walk": { "version": "0.1.2", "resolved": "https://registry.npmjs.org/dom-walk/-/dom-walk-0.1.2.tgz", @@ -9039,6 +9837,43 @@ } } }, + "dot-case": { + "version": "3.0.4", + "resolved": "https://registry.npmjs.org/dot-case/-/dot-case-3.0.4.tgz", + "integrity": "sha512-Kv5nKlh6yRrdrGvxeJ2e5y2eRUpkUosIW4A2AS38zwSz27zu7ufDwQPi5Jhs3XAlGNetl3bmnGhQsMtkKJnj3w==", + "dev": true, + "requires": { + "no-case": "^3.0.4", + "tslib": "^2.0.3" + }, + "dependencies": { + "lower-case": { + "version": "2.0.2", + "resolved": "https://registry.npmjs.org/lower-case/-/lower-case-2.0.2.tgz", + "integrity": "sha512-7fm3l3NAF9WfN6W3JOmf5drwpVqX78JtoGJ3A6W0a6ZnldM41w2fV5D490psKFTpMds8TJse/eHLFFsNHHjHgg==", + "dev": true, + "requires": { + "tslib": "^2.0.3" + } + }, + "no-case": { + "version": "3.0.4", + "resolved": "https://registry.npmjs.org/no-case/-/no-case-3.0.4.tgz", + "integrity": "sha512-fgAN3jGAh+RoxUGZHTSOLJIqUc2wmoBwGR4tbpNAKmmovFoWq0OdRkb0VkldReO2a2iBT/OEulG9XSUc10r3zg==", + "dev": true, + "requires": { + "lower-case": "^2.0.2", + "tslib": "^2.0.3" + } + }, + "tslib": { + "version": "2.2.0", + "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.2.0.tgz", + "integrity": "sha512-gS9GVHRU+RGn5KQM2rllAlR3dU6m7AcpJKdtH8gFvQiC4Otgk98XnmMU+nZenHt/+VhnBPWwgrJsyrdcw6i23w==", + "dev": true + } + } + }, "dotenv": { "version": "8.2.0", "resolved": "https://registry.npmjs.org/dotenv/-/dotenv-8.2.0.tgz", @@ -9112,17 +9947,26 @@ "integrity": "sha512-vhGNxT87PdZA6Ak4E0QhArwGzNcSPUwSN7n9wCFLeBlY2NNuuiwguQuQIp7P5oB65PLJ892yKcHiqz1xLWeiug==" }, "elliptic": { - "version": "6.5.3", - "resolved": "https://registry.npmjs.org/elliptic/-/elliptic-6.5.3.tgz", - "integrity": "sha512-IMqzv5wNQf+E6aHeIqATs0tOLeOTwj1QKbRcS3jBbYkl5oLAserA8yJTT7/VyHUYG91PRmPyeQDObKLPpeS4dw==", + "version": "6.5.4", + "resolved": "https://registry.npmjs.org/elliptic/-/elliptic-6.5.4.tgz", + "integrity": "sha512-iLhC6ULemrljPZb+QutR5TQGB+pdW6KGD5RSegS+8sorOZT+rdQFbsQFJgvN3eRqNALqJer4oQ16YvJHlU8hzQ==", + "dev": true, "requires": { - "bn.js": "^4.4.0", - "brorand": "^1.0.1", + "bn.js": "^4.11.9", + "brorand": "^1.1.0", "hash.js": "^1.0.0", - "hmac-drbg": "^1.0.0", - "inherits": "^2.0.1", - "minimalistic-assert": "^1.0.0", - "minimalistic-crypto-utils": "^1.0.0" + "hmac-drbg": "^1.0.1", + "inherits": "^2.0.4", + "minimalistic-assert": "^1.0.1", + "minimalistic-crypto-utils": "^1.0.1" + }, + "dependencies": { + "bn.js": { + "version": "4.12.0", + "resolved": "https://registry.npmjs.org/bn.js/-/bn.js-4.12.0.tgz", + "integrity": "sha512-c98Bf3tPniI+scsdk237ku1Dc3ujXQTSgyiPUDEOe7tRkhrqridvh8klBv0HCEso1OLOYcHuCv/cS6DNxKH+ZA==", + "dev": true + } } }, "emitter-listener": { @@ -9133,6 +9977,12 @@ "shimmer": "^1.2.0" } }, + "emittery": { + "version": "0.7.2", + "resolved": "https://registry.npmjs.org/emittery/-/emittery-0.7.2.tgz", + "integrity": "sha512-A8OG5SR/ij3SsJdWDJdkkSYUjQdCUx6APQXem0SaEePBSRg4eymGYwBkKo1Y6DU+af/Jn2dBQqDBvjnr9Vi8nQ==", + "dev": true + }, "emoji-regex": { "version": "7.0.3", "resolved": "https://registry.npmjs.org/emoji-regex/-/emoji-regex-7.0.3.tgz", @@ -9345,6 +10195,12 @@ "next-tick": "~1.0.0" } }, + "es6-error": { + "version": "4.1.1", + "resolved": "https://registry.npmjs.org/es6-error/-/es6-error-4.1.1.tgz", + "integrity": "sha512-Um/+FxMr9CISWh0bi5Zv0iOD+4cFh5qLeks1qhAopKVAJw3drgKbKySikp7wGhDL0HPeaja0P5ULZrxLkniUVg==", + "dev": true + }, "es6-iterator": { "version": "2.0.3", "resolved": "https://registry.npmjs.org/es6-iterator/-/es6-iterator-2.0.3.tgz", @@ -9355,11 +10211,6 @@ "es6-symbol": "^3.1.1" } }, - "es6-object-assign": { - "version": "1.1.0", - "resolved": "https://registry.npmjs.org/es6-object-assign/-/es6-object-assign-1.1.0.tgz", - "integrity": "sha1-wsNYJlYkfDnqEHyx5mUrb58kUjw=" - }, "es6-symbol": { "version": "3.1.3", "resolved": "https://registry.npmjs.org/es6-symbol/-/es6-symbol-3.1.3.tgz", @@ -9847,9 +10698,9 @@ "integrity": "sha512-/46HWwbfCX2xTawVfkKLGxMifJYQBWMwY1mjywRtb4c9x8l5NP3KoJtnIOiL1hfdRkIuYhETxQlo62IF8tcnlg==" }, "eventsource": { - "version": "1.0.7", - "resolved": "https://registry.npmjs.org/eventsource/-/eventsource-1.0.7.tgz", - "integrity": "sha512-4Ln17+vVT0k8aWq+t/bF5arcS3EpT9gYtW66EPacdj/mAFevznsnyoHLPy2BA8gbIQeIHoPsvwmfBftfcG//BQ==", + "version": "1.1.0", + "resolved": "https://registry.npmjs.org/eventsource/-/eventsource-1.1.0.tgz", + "integrity": "sha512-VSJjT5oCNrFvCS6igjzPAt5hBzQ2qPBFIbJ03zLI9SE0mxwZpMw6BfJrbFHm1a141AavMEB8JHmBhWAd66PfCg==", "dev": true, "requires": { "original": "^1.0.0" @@ -9961,16 +10812,10 @@ "jest-regex-util": "^24.9.0" } }, - "expect-puppeteer": { - "version": "4.4.0", - "resolved": "https://registry.npmjs.org/expect-puppeteer/-/expect-puppeteer-4.4.0.tgz", - "integrity": "sha512-6Ey4Xy2xvmuQu7z7YQtMsaMV0EHJRpVxIDOd5GRrm04/I3nkTKIutELfECsLp6le+b3SSa3cXhPiw6PgqzxYWA==", - "dev": true - }, - "expose-loader": { - "version": "0.7.5", - "resolved": "https://registry.npmjs.org/expose-loader/-/expose-loader-0.7.5.tgz", - "integrity": "sha512-iPowgKUZkTPX5PznYsmifVj9Bob0w2wTHVkt/eYNPSzyebkUgIedmskf/kcfEIWpiWjg3JRjnW+a17XypySMuw==", + "expect-playwright": { + "version": "0.3.3", + "resolved": "https://registry.npmjs.org/expect-playwright/-/expect-playwright-0.3.3.tgz", + "integrity": "sha512-uoeyx2D5LawJdziMdweOp6cnZzFOOPT9VvPG6gOh6YC7N9pU0k2KpVlRiz/Vc/fFBiGUNNeJq2Aq+9GJ65Nfrw==", "dev": true }, "express": { @@ -10144,18 +10989,6 @@ } } }, - "extract-css": { - "version": "1.5.5", - "resolved": "https://registry.npmjs.org/extract-css/-/extract-css-1.5.5.tgz", - "integrity": "sha512-fvNKsWJxK8WaSyl9CsSw2lSn8qEKe0rBOaZXZ/fkCeux4tInHoFjTA1YBDi55iNwWTfe9VfLFsoBPCIIn5eArw==", - "dev": true, - "requires": { - "batch": "^0.6.1", - "href-content": "^1.2.3", - "list-stylesheets": "^1.2.8", - "style-data": "^1.4.6" - } - }, "extract-zip": { "version": "2.0.1", "resolved": "https://registry.npmjs.org/extract-zip/-/extract-zip-2.0.1.tgz", @@ -10268,12 +11101,6 @@ "resolved": "https://registry.npmjs.org/fast-memoize/-/fast-memoize-2.5.2.tgz", "integrity": "sha512-Ue0LwpDYErFbmNnZSF0UH6eImUwDmogUO1jyE+JbN2gsQz/jICm1Ve7t9QT0rNSsfJt+Hs4/S3GnsDVjL4HVrw==" }, - "fast-safe-stringify": { - "version": "2.0.7", - "resolved": "https://registry.npmjs.org/fast-safe-stringify/-/fast-safe-stringify-2.0.7.tgz", - "integrity": "sha512-Utm6CdzT+6xsDk2m8S6uL8VHxNwI6Jub+e9NYTcAms28T84pTa25GJQV9j0CY0N1rM8hK4x6grpF2BQf+2qwVA==", - "dev": true - }, "fastparse": { "version": "1.1.2", "resolved": "https://registry.npmjs.org/fastparse/-/fastparse-1.1.2.tgz", @@ -10366,10 +11193,10 @@ "integrity": "sha512-P9bmyZ3h/PRG+Nzga+rbdI4OEpNDzAVyy74uVO9ATgzLK6VtAsYybF/+TOCvrc0MO793d6+42lLyZTw7/ArVzA==" }, "file-uri-to-path": { - "version": "2.0.0", - "resolved": "https://registry.npmjs.org/file-uri-to-path/-/file-uri-to-path-2.0.0.tgz", - "integrity": "sha512-hjPFI8oE/2iQPVe4gbrJ73Pp+Xfub2+WI2LlXDbsaJBwT5wuMh35WNWVYYTpnz895shtwfyutMFLFywpQAFdLg==", - "dev": true + "version": "1.0.0", + "resolved": "https://registry.npmjs.org/file-uri-to-path/-/file-uri-to-path-1.0.0.tgz", + "integrity": "sha512-0Zt+s3L7Vf1biwWZ29aARiVYLx7iMGnEUl9x33fbB/j3jR81u/O2LbqK+Bm1CDSNDKVtJ/YjwY7TUd5SkeLQLw==", + "optional": true }, "filesize": { "version": "3.6.1", @@ -10479,6 +11306,16 @@ "integrity": "sha512-R79ZZ/0wAxKGu3oYMlz8jy/kbhsNrS7SKZ7PxEHBgJ5+F2mtFW2fK2cOtBh1cHYkQsbzFV7I+EoRKe6Yt0oK7A==", "requires": { "p-limit": "^2.2.0" + }, + "dependencies": { + "p-limit": { + "version": "2.3.0", + "resolved": "https://registry.npmjs.org/p-limit/-/p-limit-2.3.0.tgz", + "integrity": "sha512-//88mFWSJx8lxCzwdAABTJL2MyWB12+eIY7MDL2SqLmAkeKU9qxRvWuSyTjm3FUmpBEMuFfckAIqEaVGUDxb6w==", + "requires": { + "p-try": "^2.0.0" + } + } } }, "path-exists": { @@ -10701,12 +11538,6 @@ "integrity": "sha512-r5wGx7YeOwNWNlCA0wQ86zKyDLMQr+/RB8xy74M4hTphfmjlijTSSXGuH8rnvKZnfT9i+75zmd8jcKdMR4O6jA==", "dev": true }, - "flatten": { - "version": "1.0.3", - "resolved": "https://registry.npmjs.org/flatten/-/flatten-1.0.3.tgz", - "integrity": "sha512-dVsPA/UwQ8+2uoFe5GHtiBMu48dWLTdsuEd7CKGlZlD78r1TTWBvDuFaFGKCo/ZfEr95Uk56vZoX86OsHkUeIg==", - "dev": true - }, "flush-write-stream": { "version": "1.1.1", "resolved": "https://registry.npmjs.org/flush-write-stream/-/flush-write-stream-1.1.1.tgz", @@ -10761,11 +11592,79 @@ "for-in": "^1.0.1" } }, + "foreground-child": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/foreground-child/-/foreground-child-2.0.0.tgz", + "integrity": "sha512-dCIq9FpEcyQyXKCkyzmlPTFNgrCzPudOe+mhvJU5zAtlBnGVy2yKxtfsxK2tQBThwq225jcvBjpw1Gr40uzZCA==", + "dev": true, + "requires": { + "cross-spawn": "^7.0.0", + "signal-exit": "^3.0.2" + }, + "dependencies": { + "cross-spawn": { + "version": "7.0.3", + "resolved": "https://registry.npmjs.org/cross-spawn/-/cross-spawn-7.0.3.tgz", + "integrity": "sha512-iRDPJKUPVEND7dHPO8rkbOnPpyDygcDFtWjpeWNCgy8WP2rXcxXL8TskReQl6OrB2G7+UJrags1q15Fudc7G6w==", + "dev": true, + "requires": { + "path-key": "^3.1.0", + "shebang-command": "^2.0.0", + "which": "^2.0.1" + } + }, + "path-key": { + "version": "3.1.1", + "resolved": "https://registry.npmjs.org/path-key/-/path-key-3.1.1.tgz", + "integrity": "sha512-ojmeN0qd+y0jszEtoY48r0Peq5dwMEkIlCOu6Q5f41lfkswXuKtYrhgoTpLnyIcHm24Uhqx+5Tqm2InSwLhE6Q==", + "dev": true + }, + "shebang-command": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/shebang-command/-/shebang-command-2.0.0.tgz", + "integrity": "sha512-kHxr2zZpYtdmrN1qDjrrX/Z1rR1kG8Dx+gkpK1G4eXmvXswmcE1hTWBWYUzlraYw1/yZp6YuDY77YtvbN0dmDA==", + "dev": true, + "requires": { + "shebang-regex": "^3.0.0" + } + }, + "shebang-regex": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/shebang-regex/-/shebang-regex-3.0.0.tgz", + "integrity": "sha512-7++dFhtcx3353uBaq8DDR4NuxBetBzC7ZQOhmTQInHEd6bSrXdiEyzCvG07Z44UYdLShWUyXt5M/yhz8ekcb1A==", + "dev": true + }, + "which": { + "version": "2.0.2", + "resolved": "https://registry.npmjs.org/which/-/which-2.0.2.tgz", + "integrity": "sha512-BLI3Tl1TW3Pvl70l3yq3Y64i+awpwXqsGBYWkkqMtnbXgrMD+yj7rhW0kuEDxzJaYXGjEW5ogapKNMEKNMjibA==", + "dev": true, + "requires": { + "isexe": "^2.0.0" + } + } + } + }, "forever-agent": { "version": "0.6.1", "resolved": "https://registry.npmjs.org/forever-agent/-/forever-agent-0.6.1.tgz", "integrity": "sha1-+8cfDEGt6zf5bFd60e1C2P2sypE=" }, + "fork-ts-checker-webpack-plugin": { + "version": "4.1.6", + "resolved": "https://registry.npmjs.org/fork-ts-checker-webpack-plugin/-/fork-ts-checker-webpack-plugin-4.1.6.tgz", + "integrity": "sha512-DUxuQaKoqfNne8iikd14SAkh5uw4+8vNifp6gmA73yYNS6ywLIWSLD/n/mBzHQRpW3J7rbATEakmiA8JvkTyZw==", + "dev": true, + "requires": { + "@babel/code-frame": "^7.5.5", + "chalk": "^2.4.1", + "micromatch": "^3.1.10", + "minimatch": "^3.0.4", + "semver": "^5.6.0", + "tapable": "^1.0.0", + "worker-rpc": "^0.1.0" + } + }, "form-data": { "version": "2.5.1", "resolved": "https://registry.npmjs.org/form-data/-/form-data-2.5.1.tgz", @@ -10790,12 +11689,6 @@ "samsam": "1.x" } }, - "formidable": { - "version": "1.2.2", - "resolved": "https://registry.npmjs.org/formidable/-/formidable-1.2.2.tgz", - "integrity": "sha512-V8gLm+41I/8kguQ4/o1D3RIHRmhYFG4pnNyonvua+40rqcEmT4+V71yaZ3B457xbbgCsCfjSPi65u/W6vK1U5Q==", - "dev": true - }, "forwarded": { "version": "0.1.2", "resolved": "https://registry.npmjs.org/forwarded/-/forwarded-0.1.2.tgz", @@ -10831,10 +11724,17 @@ "readable-stream": "^2.0.0" } }, + "fromentries": { + "version": "1.3.2", + "resolved": "https://registry.npmjs.org/fromentries/-/fromentries-1.3.2.tgz", + "integrity": "sha512-cHEpEQHUg0f8XdtZCc2ZAhrHzKzT0MrFUTcvx+hfxYu7rGMDc5SKoXFh+n4YigxsHXRzc6OrCshdR1bWH6HHyg==", + "dev": true + }, "fs-constants": { "version": "1.0.0", "resolved": "https://registry.npmjs.org/fs-constants/-/fs-constants-1.0.0.tgz", - "integrity": "sha512-y6OAwoSIf7FyjMIv94u+b5rdheZEjzR63GTyZJm5qh4Bi+2YgwLCcI/fPFZkL5PSixOt6ZNKm+w+Hfp/Bciwow==" + "integrity": "sha512-y6OAwoSIf7FyjMIv94u+b5rdheZEjzR63GTyZJm5qh4Bi+2YgwLCcI/fPFZkL5PSixOt6ZNKm+w+Hfp/Bciwow==", + "optional": true }, "fs-exists-sync": { "version": "0.1.0", @@ -10907,48 +11807,6 @@ "nan": "^2.12.1" } }, - "ftp": { - "version": "0.3.10", - "resolved": "https://registry.npmjs.org/ftp/-/ftp-0.3.10.tgz", - "integrity": "sha1-kZfYYa2BQvPmPVqDv+TFn3MwiF0=", - "dev": true, - "requires": { - "readable-stream": "1.1.x", - "xregexp": "2.0.0" - }, - "dependencies": { - "isarray": { - "version": "0.0.1", - "resolved": "https://registry.npmjs.org/isarray/-/isarray-0.0.1.tgz", - "integrity": "sha1-ihis/Kmo9Bd+Cav8YDiTmwXR7t8=", - "dev": true - }, - "readable-stream": { - "version": "1.1.14", - "resolved": "https://registry.npmjs.org/readable-stream/-/readable-stream-1.1.14.tgz", - "integrity": "sha1-fPTFTvZI44EwhMY23SB54WbAgdk=", - "dev": true, - "requires": { - "core-util-is": "~1.0.0", - "inherits": "~2.0.1", - "isarray": "0.0.1", - "string_decoder": "~0.10.x" - } - }, - "string_decoder": { - "version": "0.10.31", - "resolved": "https://registry.npmjs.org/string_decoder/-/string_decoder-0.10.31.tgz", - "integrity": "sha1-YuIDvEF2bGwoyfyEMB2rHFMQ+pQ=", - "dev": true - }, - "xregexp": { - "version": "2.0.0", - "resolved": "https://registry.npmjs.org/xregexp/-/xregexp-2.0.0.tgz", - "integrity": "sha1-UqY+VsoLhKfzpfPWGHLxJq16WUM=", - "dev": true - } - } - }, "function-bind": { "version": "1.1.1", "resolved": "https://registry.npmjs.org/function-bind/-/function-bind-1.1.1.tgz", @@ -11028,33 +11886,6 @@ "pump": "^3.0.0" } }, - "get-uri": { - "version": "3.0.2", - "resolved": "https://registry.npmjs.org/get-uri/-/get-uri-3.0.2.tgz", - "integrity": "sha512-+5s0SJbGoyiJTZZ2JTpFPLMPSch72KEqGOTvQsBqg0RBWvwhWUSYZFAtz3TPW0GXJuLBJPts1E241iHg+VRfhg==", - "dev": true, - "requires": { - "@tootallnate/once": "1", - "data-uri-to-buffer": "3", - "debug": "4", - "file-uri-to-path": "2", - "fs-extra": "^8.1.0", - "ftp": "^0.3.10" - }, - "dependencies": { - "fs-extra": { - "version": "8.1.0", - "resolved": "https://registry.npmjs.org/fs-extra/-/fs-extra-8.1.0.tgz", - "integrity": "sha512-yhlQgA6mnOJUKOsRUFsgJdQCvkKhcz8tlZG5HBQfReYZy46OwLcY+Zia0mtdHsOo9y/hP+CxMN0TU9QxoOtG4g==", - "dev": true, - "requires": { - "graceful-fs": "^4.2.0", - "jsonfile": "^4.0.0", - "universalify": "^0.1.0" - } - } - } - }, "get-value": { "version": "2.0.6", "resolved": "https://registry.npmjs.org/get-value/-/get-value-2.0.6.tgz", @@ -11132,9 +11963,9 @@ "integrity": "sha512-WOBp/EEGUiIsJSp7wcv/y6MO+lV9UoncWqxuFfm8eBwzWNgyfBd6Gz+IeKQ9jCmyhoH99g15M3T+QaVHFjizVA==" }, "globby": { - "version": "11.0.2", - "resolved": "https://registry.npmjs.org/globby/-/globby-11.0.2.tgz", - "integrity": "sha512-2ZThXDvvV8fYFRVIxnrMQBipZQDr7MxKAmQK1vujaj9/7eF0efG7BPUKJ7jP7G5SLF37xKDXvO4S/KKLj/Z0og==", + "version": "11.0.3", + "resolved": "https://registry.npmjs.org/globby/-/globby-11.0.3.tgz", + "integrity": "sha512-ffdmosjA807y7+lA1NM0jELARVmYul/715xiILEjo3hBLPTcirgQNnXECn5g3mtR8TOLCVbkfua1Hpen25/Xcg==", "requires": { "array-union": "^2.1.0", "dir-glob": "^3.0.1", @@ -11394,6 +12225,27 @@ "integrity": "sha512-9Qn4yBxelxoh2Ow62nP+Ka/kMnOXRi8BXnRaUwezLNhqelnN49xKz4F/dPP8OYLxLxq6JDtZb2i9XznUQbNPTg==", "dev": true }, + "handlebars": { + "version": "4.7.7", + "resolved": "https://registry.npmjs.org/handlebars/-/handlebars-4.7.7.tgz", + "integrity": "sha512-aAcXm5OAfE/8IXkcZvCepKU3VzW1/39Fb5ZuqMtgI/hT8X2YgoMvBY5dLhq/cpOvw7Lk1nK/UF71aLG/ZnVYRA==", + "dev": true, + "requires": { + "minimist": "^1.2.5", + "neo-async": "^2.6.0", + "source-map": "^0.6.1", + "uglify-js": "^3.1.4", + "wordwrap": "^1.0.0" + }, + "dependencies": { + "source-map": { + "version": "0.6.1", + "resolved": "https://registry.npmjs.org/source-map/-/source-map-0.6.1.tgz", + "integrity": "sha512-UjgapumWlbMhkBgzT7Ykc5YXUT46F0iKu8SGXq0bcwP5dz/h0Plj6enJqjz1Zbq2l5WaqYnrVbwWOWMyF3F47g==", + "dev": true + } + } + }, "har-schema": { "version": "2.0.0", "resolved": "https://registry.npmjs.org/har-schema/-/har-schema-2.0.0.tgz", @@ -11498,11 +12350,30 @@ "version": "1.1.7", "resolved": "https://registry.npmjs.org/hash.js/-/hash.js-1.1.7.tgz", "integrity": "sha512-taOaskGt4z4SOANNseOviYDvjEJinIkRgmp7LbKP2YTTmVxWBl87s/uzK9r+44BclBSp2X7K1hqeNfz9JbBeXA==", + "dev": true, "requires": { "inherits": "^2.0.3", "minimalistic-assert": "^1.0.1" } }, + "hasha": { + "version": "5.2.2", + "resolved": "https://registry.npmjs.org/hasha/-/hasha-5.2.2.tgz", + "integrity": "sha512-Hrp5vIK/xr5SkeN2onO32H0MgNZ0f17HRNH39WfL0SYUNOTZ5Lz1TJ8Pajo/87dYGEFlLMm7mIc/k/s6Bvz9HQ==", + "dev": true, + "requires": { + "is-stream": "^2.0.0", + "type-fest": "^0.8.0" + }, + "dependencies": { + "is-stream": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/is-stream/-/is-stream-2.0.0.tgz", + "integrity": "sha512-XCoy+WlUr7d1+Z8GgSuXmpuUFC9fOhRXglJMx+dwLKTkL44Cjd4W1Z5P+BQZpr+cR93aGP4S/s7Ftw6Nd/kiEw==", + "dev": true + } + } + }, "hasher": { "version": "1.2.0", "resolved": "https://registry.npmjs.org/hasher/-/hasher-1.2.0.tgz", @@ -11542,6 +12413,7 @@ "version": "1.0.1", "resolved": "https://registry.npmjs.org/hmac-drbg/-/hmac-drbg-1.0.1.tgz", "integrity": "sha1-0nRXAQJabHdabFRXk+1QL8DGSaE=", + "dev": true, "requires": { "hash.js": "^1.0.3", "minimalistic-assert": "^1.0.0", @@ -11587,15 +12459,6 @@ "wbuf": "^1.1.0" } }, - "href-content": { - "version": "1.2.3", - "resolved": "https://registry.npmjs.org/href-content/-/href-content-1.2.3.tgz", - "integrity": "sha512-Ap8D5Bw0e0IpRMxw6vX6+w6TRie5Jpto92529WxfZLDSpwB0u0cuX7xuRXSSvy/M1vvPRluvME2ktK5n0znoAA==", - "dev": true, - "requires": { - "remote-content": "^1.2.3" - } - }, "html-element-map": { "version": "1.3.0", "resolved": "https://registry.npmjs.org/html-element-map/-/html-element-map-1.3.0.tgz", @@ -11625,6 +12488,15 @@ "resolved": "https://registry.npmjs.org/html-escaper/-/html-escaper-2.0.2.tgz", "integrity": "sha512-H2iMtd0I4Mt5eYiapRdIDjp+XzelXQ0tFE4JS7YFwFevXXMmOp9myNrUvCg0D6ws8iqkRPBfKHgbwig1SmlLfg==" }, + "html-inline-css-webpack-plugin": { + "version": "1.11.0", + "resolved": "https://registry.npmjs.org/html-inline-css-webpack-plugin/-/html-inline-css-webpack-plugin-1.11.0.tgz", + "integrity": "sha512-VOBX7DOSKTZGwJnToWYhfzq9tt3mbTV0VncCy3APA4ljME20NbkQYiixJMZu782Crpp/kEcml1HbZbYtlXQzgQ==", + "dev": true, + "requires": { + "lodash": "^4.17.15" + } + }, "html-loader": { "version": "0.5.5", "resolved": "https://registry.npmjs.org/html-loader/-/html-loader-0.5.5.tgz", @@ -11670,6 +12542,55 @@ } } }, + "html-minifier-terser": { + "version": "5.1.1", + "resolved": "https://registry.npmjs.org/html-minifier-terser/-/html-minifier-terser-5.1.1.tgz", + "integrity": "sha512-ZPr5MNObqnV/T9akshPKbVgyOqLmy+Bxo7juKCfTfnjNniTAMdy4hz21YQqoofMBJD2kdREaqPPdThoR78Tgxg==", + "dev": true, + "requires": { + "camel-case": "^4.1.1", + "clean-css": "^4.2.3", + "commander": "^4.1.1", + "he": "^1.2.0", + "param-case": "^3.0.3", + "relateurl": "^0.2.7", + "terser": "^4.6.3" + }, + "dependencies": { + "camel-case": { + "version": "4.1.2", + "resolved": "https://registry.npmjs.org/camel-case/-/camel-case-4.1.2.tgz", + "integrity": "sha512-gxGWBrTT1JuMx6R+o5PTXMmUnhnVzLQ9SNutD4YqKtI6ap897t3tKECYla6gCWEkplXnlNybEkZg9GEGxKFCgw==", + "dev": true, + "requires": { + "pascal-case": "^3.1.2", + "tslib": "^2.0.3" + } + }, + "commander": { + "version": "4.1.1", + "resolved": "https://registry.npmjs.org/commander/-/commander-4.1.1.tgz", + "integrity": "sha512-NOKm8xhkzAjzFx8B2v5OAHT+u5pRQc2UCa2Vq9jYL/31o2wi9mxBA7LIFs3sV5VSC49z6pEhfbMULvShKj26WA==", + "dev": true + }, + "param-case": { + "version": "3.0.4", + "resolved": "https://registry.npmjs.org/param-case/-/param-case-3.0.4.tgz", + "integrity": "sha512-RXlj7zCYokReqWpOPH9oYivUzLYZ5vAPIfEmCTNViosC78F8F0H9y7T7gG2M39ymgutxF5gcFEsyZQSph9Bp3A==", + "dev": true, + "requires": { + "dot-case": "^3.0.4", + "tslib": "^2.0.3" + } + }, + "tslib": { + "version": "2.2.0", + "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.2.0.tgz", + "integrity": "sha512-gS9GVHRU+RGn5KQM2rllAlR3dU6m7AcpJKdtH8gFvQiC4Otgk98XnmMU+nZenHt/+VhnBPWwgrJsyrdcw6i23w==", + "dev": true + } + } + }, "html-parse-stringify2": { "version": "2.0.1", "resolved": "https://registry.npmjs.org/html-parse-stringify2/-/html-parse-stringify2-2.0.1.tgz", @@ -11703,50 +12624,22 @@ } }, "html-webpack-plugin": { - "version": "3.2.0", - "resolved": "https://registry.npmjs.org/html-webpack-plugin/-/html-webpack-plugin-3.2.0.tgz", - "integrity": "sha1-sBq71yOsqqeze2r0SS69oD2d03s=", + "version": "4.5.2", + "resolved": "https://registry.npmjs.org/html-webpack-plugin/-/html-webpack-plugin-4.5.2.tgz", + "integrity": "sha512-q5oYdzjKUIPQVjOosjgvCHQOv9Ett9CYYHlgvJeXG0qQvdSojnBq4vAdQBwn1+yGveAwHCoe/rMR86ozX3+c2A==", "dev": true, "requires": { - "html-minifier": "^3.2.3", - "loader-utils": "^0.2.16", - "lodash": "^4.17.3", - "pretty-error": "^2.0.2", - "tapable": "^1.0.0", - "toposort": "^1.0.0", + "@types/html-minifier-terser": "^5.0.0", + "@types/tapable": "^1.0.5", + "@types/webpack": "^4.41.8", + "html-minifier-terser": "^5.0.1", + "loader-utils": "^1.2.3", + "lodash": "^4.17.20", + "pretty-error": "^2.1.1", + "tapable": "^1.1.3", "util.promisify": "1.0.0" }, "dependencies": { - "big.js": { - "version": "3.2.0", - "resolved": "https://registry.npmjs.org/big.js/-/big.js-3.2.0.tgz", - "integrity": "sha512-+hN/Zh2D08Mx65pZ/4g5bsmNiZUuChDiQfTUQ7qJr4/kuopCr88xZsAXv6mBoZEsUI4OuGHlX59qE94K2mMW8Q==", - "dev": true - }, - "emojis-list": { - "version": "2.1.0", - "resolved": "https://registry.npmjs.org/emojis-list/-/emojis-list-2.1.0.tgz", - "integrity": "sha1-TapNnbAPmBmIDHn6RXrlsJof04k=", - "dev": true - }, - "json5": { - "version": "0.5.1", - "resolved": "https://registry.npmjs.org/json5/-/json5-0.5.1.tgz", - "integrity": "sha1-Hq3nrMASA0rYTiOWdn6tn6VJWCE=", - "dev": true - }, - "loader-utils": { - "version": "0.2.17", - "resolved": "https://registry.npmjs.org/loader-utils/-/loader-utils-0.2.17.tgz", - "integrity": "sha1-+G5jdNQyBabmxg6RlvF8Apm/s0g=", - "dev": true, - "requires": { - "big.js": "^3.1.3", - "emojis-list": "^2.0.0", - "json5": "^0.5.0", - "object-assign": "^4.0.1" - } - }, "util.promisify": { "version": "1.0.0", "resolved": "https://registry.npmjs.org/util.promisify/-/util.promisify-1.0.0.tgz", @@ -11768,14 +12661,48 @@ } }, "htmlparser2": { - "version": "4.1.0", - "resolved": "https://registry.npmjs.org/htmlparser2/-/htmlparser2-4.1.0.tgz", - "integrity": "sha512-4zDq1a1zhE4gQso/c5LP1OtrhYTncXNSpvJYtWJBtXAETPlMfi3IFNjGuQbYLuVY4ZR0QMqRVvo4Pdy9KLyP8Q==", + "version": "6.1.0", + "resolved": "https://registry.npmjs.org/htmlparser2/-/htmlparser2-6.1.0.tgz", + "integrity": "sha512-gyyPk6rgonLFEDGoeRgQNaEUvdJ4ktTmmUh/h2t7s+M8oPpIPxgNACWa+6ESR57kXstwqPiCut0V8NRpcwgU7A==", "requires": { "domelementtype": "^2.0.1", - "domhandler": "^3.0.0", - "domutils": "^2.0.0", + "domhandler": "^4.0.0", + "domutils": "^2.5.2", "entities": "^2.0.0" + }, + "dependencies": { + "domhandler": { + "version": "4.1.0", + "resolved": "https://registry.npmjs.org/domhandler/-/domhandler-4.1.0.tgz", + "integrity": "sha512-/6/kmsGlMY4Tup/nGVutdrK9yQi4YjWVcVeoQmixpzjOUK1U7pQkvAPHBJeUxOgxF0J8f8lwCJSlCfD0V4CMGQ==", + "requires": { + "domelementtype": "^2.2.0" + }, + "dependencies": { + "domelementtype": { + "version": "2.2.0", + "resolved": "https://registry.npmjs.org/domelementtype/-/domelementtype-2.2.0.tgz", + "integrity": "sha512-DtBMo82pv1dFtUmHyr48beiuq792Sxohr+8Hm9zoxklYPfa6n0Z3Byjj2IV7bmr2IyqClnqEQhfgHJJ5QF0R5A==" + } + } + }, + "domutils": { + "version": "2.5.2", + "resolved": "https://registry.npmjs.org/domutils/-/domutils-2.5.2.tgz", + "integrity": "sha512-MHTthCb1zj8f1GVfRpeZUbohQf/HdBos0oX5gZcQFepOZPLLRyj6Wn7XS7EMnY7CVpwv8863u2vyE83Hfu28HQ==", + "requires": { + "dom-serializer": "^1.0.1", + "domelementtype": "^2.2.0", + "domhandler": "^4.1.0" + }, + "dependencies": { + "domelementtype": { + "version": "2.2.0", + "resolved": "https://registry.npmjs.org/domelementtype/-/domelementtype-2.2.0.tgz", + "integrity": "sha512-DtBMo82pv1dFtUmHyr48beiuq792Sxohr+8Hm9zoxklYPfa6n0Z3Byjj2IV7bmr2IyqClnqEQhfgHJJ5QF0R5A==" + } + } + } } }, "http-deceiver": { @@ -11808,17 +12735,6 @@ "requires-port": "^1.0.0" } }, - "http-proxy-agent": { - "version": "4.0.1", - "resolved": "https://registry.npmjs.org/http-proxy-agent/-/http-proxy-agent-4.0.1.tgz", - "integrity": "sha512-k0zdNgqWTGA6aeIRVpvfVob4fL52dTfaehylg0Y4UvSySvOq/Y+BOyPrgpUrA7HylqvU8vIZGsRuXmspskV0Tg==", - "dev": true, - "requires": { - "@tootallnate/once": "1", - "agent-base": "6", - "debug": "4" - } - }, "http-proxy-middleware": { "version": "0.19.1", "resolved": "https://registry.npmjs.org/http-proxy-middleware/-/http-proxy-middleware-0.19.1.tgz", @@ -11940,6 +12856,20 @@ "integrity": "sha1-xg7taebY/bazEEofy8ocGS3FtQE=", "dev": true }, + "iframe-resizer": { + "version": "4.3.1", + "resolved": "https://registry.npmjs.org/iframe-resizer/-/iframe-resizer-4.3.1.tgz", + "integrity": "sha512-PkoTPNF6EYhTbDjogdKu7JVgKqRwwNBXMeywZaQyzEYM3BNltA8O9fIIrtUkmj+8VZGckXpwtXsWsaQ5lrhd0w==" + }, + "iframe-resizer-react": { + "version": "1.1.0", + "resolved": "https://registry.npmjs.org/iframe-resizer-react/-/iframe-resizer-react-1.1.0.tgz", + "integrity": "sha512-FrytSq91AIJaDgE+6uK/Vdd6IR8CrwLoZ6eGmL2qQMPTzF0xlSV2jaSzRRUh5V2fttD7vzl21jvBl97bV40eBw==", + "requires": { + "iframe-resizer": "^4.3.0", + "warning": "^4.0.3" + } + }, "ignore": { "version": "5.1.8", "resolved": "https://registry.npmjs.org/ignore/-/ignore-5.1.8.tgz", @@ -11952,6 +12882,12 @@ "dev": true, "optional": true }, + "immer": { + "version": "8.0.1", + "resolved": "https://registry.npmjs.org/immer/-/immer-8.0.1.tgz", + "integrity": "sha512-aqXhGP7//Gui2+UrEtvxZxSquQVXTpZ7KDxfCcKAF3Vysvw0CViVaW9RZ1j1xlIYqaaaipBoqdqeibkc18PNvA==", + "dev": true + }, "immutable": { "version": "4.0.0-rc.12", "resolved": "https://registry.npmjs.org/immutable/-/immutable-4.0.0-rc.12.tgz", @@ -12018,142 +12954,6 @@ "resolved": "https://registry.npmjs.org/ini/-/ini-1.3.8.tgz", "integrity": "sha512-JV/yugV2uzW5iMRSiZAyDtQd+nxtUnjeLt0acNdw98kKLrvuRVyB80tsREOE7yvGVgalhZ6RNXCmEHkUKBKxew==" }, - "inline-css": { - "version": "2.2.5", - "resolved": "https://registry.npmjs.org/inline-css/-/inline-css-2.2.5.tgz", - "integrity": "sha1-kbOAq+E1LlXP6uW9ZgtP81oGuDQ=", - "dev": true, - "requires": { - "bluebird": "^3.5.1", - "cheerio": "0.22.0", - "css-rules": "^1.0.0", - "extend": "^3.0.0", - "extract-css": "^1.0.0", - "flatten": "^1.0.2", - "object.pick": "^1.1.1", - "slick": "^1.12.1", - "specificity": "^0.3.2" - }, - "dependencies": { - "cheerio": { - "version": "0.22.0", - "resolved": "https://registry.npmjs.org/cheerio/-/cheerio-0.22.0.tgz", - "integrity": "sha1-qbqoYKP5tZWmuBsahocxIe06Jp4=", - "dev": true, - "requires": { - "css-select": "~1.2.0", - "dom-serializer": "~0.1.0", - "entities": "~1.1.1", - "htmlparser2": "^3.9.1", - "lodash.assignin": "^4.0.9", - "lodash.bind": "^4.1.4", - "lodash.defaults": "^4.0.1", - "lodash.filter": "^4.4.0", - "lodash.flatten": "^4.2.0", - "lodash.foreach": "^4.3.0", - "lodash.map": "^4.4.0", - "lodash.merge": "^4.4.0", - "lodash.pick": "^4.2.1", - "lodash.reduce": "^4.4.0", - "lodash.reject": "^4.4.0", - "lodash.some": "^4.4.0" - } - }, - "css-select": { - "version": "1.2.0", - "resolved": "https://registry.npmjs.org/css-select/-/css-select-1.2.0.tgz", - "integrity": "sha1-KzoRBTnFNV8c2NMUYj6HCxIeyFg=", - "dev": true, - "requires": { - "boolbase": "~1.0.0", - "css-what": "2.1", - "domutils": "1.5.1", - "nth-check": "~1.0.1" - } - }, - "css-what": { - "version": "2.1.3", - "resolved": "https://registry.npmjs.org/css-what/-/css-what-2.1.3.tgz", - "integrity": "sha512-a+EPoD+uZiNfh+5fxw2nO9QwFa6nJe2Or35fGY6Ipw1R3R4AGz1d1TEZrCegvw2YTmZ0jXirGYlzxxpYSHwpEg==", - "dev": true - }, - "dom-serializer": { - "version": "0.1.1", - "resolved": "https://registry.npmjs.org/dom-serializer/-/dom-serializer-0.1.1.tgz", - "integrity": "sha512-l0IU0pPzLWSHBcieZbpOKgkIn3ts3vAh7ZuFyXNwJxJXk/c4Gwj9xaTJwIDVQCXawWD0qb3IzMGH5rglQaO0XA==", - "dev": true, - "requires": { - "domelementtype": "^1.3.0", - "entities": "^1.1.1" - } - }, - "domelementtype": { - "version": "1.3.1", - "resolved": "https://registry.npmjs.org/domelementtype/-/domelementtype-1.3.1.tgz", - "integrity": "sha512-BSKB+TSpMpFI/HOxCNr1O8aMOTZ8hT3pM3GQ0w/mWRmkhEDSFJkkyzz4XQsBV44BChwGkrDfMyjVD0eA2aFV3w==", - "dev": true - }, - "domhandler": { - "version": "2.4.2", - "resolved": "https://registry.npmjs.org/domhandler/-/domhandler-2.4.2.tgz", - "integrity": "sha512-JiK04h0Ht5u/80fdLMCEmV4zkNh2BcoMFBmZ/91WtYZ8qVXSKjiw7fXMgFPnHcSZgOo3XdinHvmnDUeMf5R4wA==", - "dev": true, - "requires": { - "domelementtype": "1" - } - }, - "domutils": { - "version": "1.5.1", - "resolved": "https://registry.npmjs.org/domutils/-/domutils-1.5.1.tgz", - "integrity": "sha1-3NhIiib1Y9YQeeSMn3t+Mjc2gs8=", - "dev": true, - "requires": { - "dom-serializer": "0", - "domelementtype": "1" - } - }, - "entities": { - "version": "1.1.2", - "resolved": "https://registry.npmjs.org/entities/-/entities-1.1.2.tgz", - "integrity": "sha512-f2LZMYl1Fzu7YSBKg+RoROelpOaNrcGmE9AZubeDfrCEia483oW4MI4VyFd5VNHIgQ/7qm1I0wUHK1eJnn2y2w==", - "dev": true - }, - "htmlparser2": { - "version": "3.10.1", - "resolved": "https://registry.npmjs.org/htmlparser2/-/htmlparser2-3.10.1.tgz", - "integrity": "sha512-IgieNijUMbkDovyoKObU1DUhm1iwNYE/fuifEoEHfd1oZKZDaONBSkal7Y01shxsM49R4XaMdGez3WnF9UfiCQ==", - "dev": true, - "requires": { - "domelementtype": "^1.3.1", - "domhandler": "^2.3.0", - "domutils": "^1.5.1", - "entities": "^1.1.1", - "inherits": "^2.0.1", - "readable-stream": "^3.1.1" - } - }, - "nth-check": { - "version": "1.0.2", - "resolved": "https://registry.npmjs.org/nth-check/-/nth-check-1.0.2.tgz", - "integrity": "sha512-WeBOdju8SnzPN5vTUJYxYUxLeXpCaVP5i5e0LF8fg7WORF2Wd7wFX/pk0tYZk7s8T+J7VLy0Da6J1+wCT0AtHg==", - "dev": true, - "requires": { - "boolbase": "~1.0.0" - } - }, - "readable-stream": { - "version": "3.6.0", - "resolved": "https://registry.npmjs.org/readable-stream/-/readable-stream-3.6.0.tgz", - "integrity": "sha512-BViHy7LKeTz4oNnkcLJ+lVSL6vpiFeX6/d3oSH8zCW7UxP2onchk+vTGB143xuFjHS3deTgkKoXXymXqymiIdA==", - "dev": true, - "requires": { - "inherits": "^2.0.3", - "string_decoder": "^1.1.1", - "util-deprecate": "^1.0.1" - } - } - } - }, "internal-ip": { "version": "4.3.0", "resolved": "https://registry.npmjs.org/internal-ip/-/internal-ip-4.3.0.tgz", @@ -12471,6 +13271,12 @@ "isobject": "^3.0.1" } }, + "is-potential-custom-element-name": { + "version": "1.0.1", + "resolved": "https://registry.npmjs.org/is-potential-custom-element-name/-/is-potential-custom-element-name-1.0.1.tgz", + "integrity": "sha512-bCYeRA2rVibKZd+s2625gGnGF/t7DSqDs4dP7CrLA1m7jKWz6pps0LpYLJN8Q64HtmPKJ1hrN3nzPNKFEKOUiQ==", + "dev": true + }, "is-regex": { "version": "1.1.1", "resolved": "https://registry.npmjs.org/is-regex/-/is-regex-1.1.1.tgz", @@ -12487,6 +13293,12 @@ "is-unc-path": "^1.0.0" } }, + "is-root": { + "version": "2.1.0", + "resolved": "https://registry.npmjs.org/is-root/-/is-root-2.1.0.tgz", + "integrity": "sha512-AGOriNp96vNBd3HtU+RzFEc75FfR5ymiYv8E553I71SCeXBiMsVDUtdio1OEFvrPyLIQ9tVR5RxXIFe5PUFjMg==", + "dev": true + }, "is-stream": { "version": "1.1.0", "resolved": "https://registry.npmjs.org/is-stream/-/is-stream-1.1.0.tgz", @@ -12582,6 +13394,15 @@ "resolved": "https://registry.npmjs.org/istanbul-lib-coverage/-/istanbul-lib-coverage-2.0.5.tgz", "integrity": "sha512-8aXznuEPCJvGnMSRft4udDRDtb1V3pkQkMMI5LI+6HuQz5oQ4J2UFn1H82raA3qJtyOLkkwVqICBQkjnGtn5mA==" }, + "istanbul-lib-hook": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/istanbul-lib-hook/-/istanbul-lib-hook-3.0.0.tgz", + "integrity": "sha512-Pt/uge1Q9s+5VAZ+pCo16TYMWPBIl+oaNIjgLQxcX0itS6ueeaA+pEfThZpH8WxhFgCiEb8sAJY6MdUKgiIWaQ==", + "dev": true, + "requires": { + "append-transform": "^2.0.0" + } + }, "istanbul-lib-instrument": { "version": "3.3.0", "resolved": "https://registry.npmjs.org/istanbul-lib-instrument/-/istanbul-lib-instrument-3.3.0.tgz", @@ -12603,6 +13424,94 @@ } } }, + "istanbul-lib-processinfo": { + "version": "2.0.2", + "resolved": "https://registry.npmjs.org/istanbul-lib-processinfo/-/istanbul-lib-processinfo-2.0.2.tgz", + "integrity": "sha512-kOwpa7z9hme+IBPZMzQ5vdQj8srYgAtaRqeI48NGmAQ+/5yKiHLV0QbYqQpxsdEF0+w14SoB8YbnHKcXE2KnYw==", + "dev": true, + "requires": { + "archy": "^1.0.0", + "cross-spawn": "^7.0.0", + "istanbul-lib-coverage": "^3.0.0-alpha.1", + "make-dir": "^3.0.0", + "p-map": "^3.0.0", + "rimraf": "^3.0.0", + "uuid": "^3.3.3" + }, + "dependencies": { + "cross-spawn": { + "version": "7.0.3", + "resolved": "https://registry.npmjs.org/cross-spawn/-/cross-spawn-7.0.3.tgz", + "integrity": "sha512-iRDPJKUPVEND7dHPO8rkbOnPpyDygcDFtWjpeWNCgy8WP2rXcxXL8TskReQl6OrB2G7+UJrags1q15Fudc7G6w==", + "dev": true, + "requires": { + "path-key": "^3.1.0", + "shebang-command": "^2.0.0", + "which": "^2.0.1" + } + }, + "istanbul-lib-coverage": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/istanbul-lib-coverage/-/istanbul-lib-coverage-3.0.0.tgz", + "integrity": "sha512-UiUIqxMgRDET6eR+o5HbfRYP1l0hqkWOs7vNxC/mggutCMUIhWMm8gAHb8tHlyfD3/l6rlgNA5cKdDzEAf6hEg==", + "dev": true + }, + "make-dir": { + "version": "3.1.0", + "resolved": "https://registry.npmjs.org/make-dir/-/make-dir-3.1.0.tgz", + "integrity": "sha512-g3FeP20LNwhALb/6Cz6Dd4F2ngze0jz7tbzrD2wAV+o9FeNHe4rL+yK2md0J/fiSf1sa1ADhXqi5+oVwOM/eGw==", + "dev": true, + "requires": { + "semver": "^6.0.0" + } + }, + "p-map": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/p-map/-/p-map-3.0.0.tgz", + "integrity": "sha512-d3qXVTF/s+W+CdJ5A29wywV2n8CQQYahlgz2bFiA+4eVNJbHJodPZ+/gXwPGh0bOqA+j8S+6+ckmvLGPk1QpxQ==", + "dev": true, + "requires": { + "aggregate-error": "^3.0.0" + } + }, + "path-key": { + "version": "3.1.1", + "resolved": "https://registry.npmjs.org/path-key/-/path-key-3.1.1.tgz", + "integrity": "sha512-ojmeN0qd+y0jszEtoY48r0Peq5dwMEkIlCOu6Q5f41lfkswXuKtYrhgoTpLnyIcHm24Uhqx+5Tqm2InSwLhE6Q==", + "dev": true + }, + "semver": { + "version": "6.3.0", + "resolved": "https://registry.npmjs.org/semver/-/semver-6.3.0.tgz", + "integrity": "sha512-b39TBaTSfV6yBrapU89p5fKekE2m/NwnDocOVruQFS1/veMgdzuPcnOM34M6CwxW8jH/lxEa5rBoDeUwu5HHTw==", + "dev": true + }, + "shebang-command": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/shebang-command/-/shebang-command-2.0.0.tgz", + "integrity": "sha512-kHxr2zZpYtdmrN1qDjrrX/Z1rR1kG8Dx+gkpK1G4eXmvXswmcE1hTWBWYUzlraYw1/yZp6YuDY77YtvbN0dmDA==", + "dev": true, + "requires": { + "shebang-regex": "^3.0.0" + } + }, + "shebang-regex": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/shebang-regex/-/shebang-regex-3.0.0.tgz", + "integrity": "sha512-7++dFhtcx3353uBaq8DDR4NuxBetBzC7ZQOhmTQInHEd6bSrXdiEyzCvG07Z44UYdLShWUyXt5M/yhz8ekcb1A==", + "dev": true + }, + "which": { + "version": "2.0.2", + "resolved": "https://registry.npmjs.org/which/-/which-2.0.2.tgz", + "integrity": "sha512-BLI3Tl1TW3Pvl70l3yq3Y64i+awpwXqsGBYWkkqMtnbXgrMD+yj7rhW0kuEDxzJaYXGjEW5ogapKNMEKNMjibA==", + "dev": true, + "requires": { + "isexe": "^2.0.0" + } + } + } + }, "istanbul-lib-report": { "version": "2.0.8", "resolved": "https://registry.npmjs.org/istanbul-lib-report/-/istanbul-lib-report-2.0.8.tgz", @@ -12848,9 +13757,9 @@ } }, "@types/yargs": { - "version": "15.0.12", - "resolved": "https://registry.npmjs.org/@types/yargs/-/yargs-15.0.12.tgz", - "integrity": "sha512-f+fD/fQAo3BCbCDlrUpznF1A5Zp9rB0noS5vnoormHSIPFKL0Z2DcUJ3Gxp5ytH4uLRNxy7AwYUC9exZzqGMAw==", + "version": "15.0.13", + "resolved": "https://registry.npmjs.org/@types/yargs/-/yargs-15.0.13.tgz", + "integrity": "sha512-kQ5JNTrbDv3Rp5X2n/iUu37IJBDU2gsZ5R/g1/KHOOEc5IKfUFjXT6DENPGduh08I/pamwtEq4oul7gUqKTQDQ==", "dev": true, "requires": { "@types/yargs-parser": "*" @@ -12863,18 +13772,18 @@ "dev": true }, "ansi-escapes": { - "version": "4.3.1", - "resolved": "https://registry.npmjs.org/ansi-escapes/-/ansi-escapes-4.3.1.tgz", - "integrity": "sha512-JWF7ocqNrp8u9oqpgV+wH5ftbt+cfvv+PTjOvKLT3AdYly/LmORARfEVT1iyjwN+4MqE5UmVKoAdIBqeoCHgLA==", + "version": "4.3.2", + "resolved": "https://registry.npmjs.org/ansi-escapes/-/ansi-escapes-4.3.2.tgz", + "integrity": "sha512-gKXj5ALrKWQLsYG9jlTRmR/xKluxHV+Z9QEwNIgCfM1/uwPMCuzVVnh5mwTd+OuBZcwSIMbqssNWRm1lE51QaQ==", "dev": true, "requires": { - "type-fest": "^0.11.0" + "type-fest": "^0.21.3" }, "dependencies": { "type-fest": { - "version": "0.11.0", - "resolved": "https://registry.npmjs.org/type-fest/-/type-fest-0.11.0.tgz", - "integrity": "sha512-OdjXJxnCN1AvyLSzeKIgXTXxV+99ZuXl3Hpo9XpJAv9MBcHrrJOQ5kV7ypXOuQie+AmWG25hLbiKdwYTifzcfQ==", + "version": "0.21.3", + "resolved": "https://registry.npmjs.org/type-fest/-/type-fest-0.21.3.tgz", + "integrity": "sha512-t0rzBq87m3fVcduHDUFhKmyyX+9eo6WQjZvf51Ea/M0Q7+T374Jp1aUiyUl0GKxp8M/OETVHSDvmkyPgvX+X2w==", "dev": true } } @@ -12895,9 +13804,9 @@ } }, "anymatch": { - "version": "3.1.1", - "resolved": "https://registry.npmjs.org/anymatch/-/anymatch-3.1.1.tgz", - "integrity": "sha512-mM8522psRCqzV+6LhomX5wgp25YVibjh8Wj23I5RPkPppSVSjyKD2A2mBJmWGa+KN7f2D6LNh9jkBCeyLktzjg==", + "version": "3.1.2", + "resolved": "https://registry.npmjs.org/anymatch/-/anymatch-3.1.2.tgz", + "integrity": "sha512-P43ePfOAIupkguHUycrc4qJ9kz8ZiuOUijaETwX7THt0Y/GNK7v0aa8rY816xWjZ7rJdA5XdMcpVFTKMq+RvWg==", "dev": true, "requires": { "normalize-path": "^3.0.0", @@ -13103,9 +14012,9 @@ } }, "fsevents": { - "version": "2.3.1", - "resolved": "https://registry.npmjs.org/fsevents/-/fsevents-2.3.1.tgz", - "integrity": "sha512-YR47Eg4hChJGAB1O3yEAOkGO+rlzutoICGqGo9EZ4lKWokzZRSyIW1QmTzqjtw8MJdj9srP869CuWw/hyzSiBw==", + "version": "2.3.2", + "resolved": "https://registry.npmjs.org/fsevents/-/fsevents-2.3.2.tgz", + "integrity": "sha512-xiqMQR4xAeHTuB9uWm+fFRcIOgKBMiOBP+eXiyT7jsgVCq1bkVygt00oASowB7EdtpOHaaPgKt812P9ab+DDKA==", "dev": true, "optional": true }, @@ -13723,6 +14632,17 @@ "dev": true, "requires": { "p-limit": "^2.2.0" + }, + "dependencies": { + "p-limit": { + "version": "2.3.0", + "resolved": "https://registry.npmjs.org/p-limit/-/p-limit-2.3.0.tgz", + "integrity": "sha512-//88mFWSJx8lxCzwdAABTJL2MyWB12+eIY7MDL2SqLmAkeKU9qxRvWuSyTjm3FUmpBEMuFfckAIqEaVGUDxb6w==", + "dev": true, + "requires": { + "p-try": "^2.0.0" + } + } } }, "parse-json": { @@ -13891,9 +14811,9 @@ } }, "string-width": { - "version": "4.2.0", - "resolved": "https://registry.npmjs.org/string-width/-/string-width-4.2.0.tgz", - "integrity": "sha512-zUz5JD+tgqtuDjMhwIg5uFVV3dtqZ9yQJlZVfq4I01/K5Paj5UHj7VyrQOJvzawSVlKpObApbfD0Ed6yJc+1eg==", + "version": "4.2.2", + "resolved": "https://registry.npmjs.org/string-width/-/string-width-4.2.2.tgz", + "integrity": "sha512-XBJbT3N4JhVumXE0eoLU9DCjcaF92KLNqTmFCnG1pf8duUxFGwtP6AD6nkjw9a3IdiRtL3E2w3JDiE/xi3vOeA==", "dev": true, "requires": { "emoji-regex": "^8.0.0", @@ -14053,6 +14973,1263 @@ "throat": "^4.0.0" } }, + "jest-circus": { + "version": "26.6.3", + "resolved": "https://registry.npmjs.org/jest-circus/-/jest-circus-26.6.3.tgz", + "integrity": "sha512-ACrpWZGcQMpbv13XbzRzpytEJlilP/Su0JtNCi5r/xLpOUhnaIJr8leYYpLEMgPFURZISEHrnnpmB54Q/UziPw==", + "dev": true, + "requires": { + "@babel/traverse": "^7.1.0", + "@jest/environment": "^26.6.2", + "@jest/test-result": "^26.6.2", + "@jest/types": "^26.6.2", + "@types/babel__traverse": "^7.0.4", + "@types/node": "*", + "chalk": "^4.0.0", + "co": "^4.6.0", + "dedent": "^0.7.0", + "expect": "^26.6.2", + "is-generator-fn": "^2.0.0", + "jest-each": "^26.6.2", + "jest-matcher-utils": "^26.6.2", + "jest-message-util": "^26.6.2", + "jest-runner": "^26.6.3", + "jest-runtime": "^26.6.3", + "jest-snapshot": "^26.6.2", + "jest-util": "^26.6.2", + "pretty-format": "^26.6.2", + "stack-utils": "^2.0.2", + "throat": "^5.0.0" + }, + "dependencies": { + "@jest/console": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/@jest/console/-/console-26.6.2.tgz", + "integrity": "sha512-IY1R2i2aLsLr7Id3S6p2BA82GNWryt4oSvEXLAKc+L2zdi89dSkE8xC1C+0kpATG4JhBJREnQOH7/zmccM2B0g==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "@types/node": "*", + "chalk": "^4.0.0", + "jest-message-util": "^26.6.2", + "jest-util": "^26.6.2", + "slash": "^3.0.0" + } + }, + "@jest/environment": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/@jest/environment/-/environment-26.6.2.tgz", + "integrity": "sha512-nFy+fHl28zUrRsCeMB61VDThV1pVTtlEokBRgqPrcT1JNq4yRNIyTHfyht6PqtUvY9IsuLGTrbG8kPXjSZIZwA==", + "dev": true, + "requires": { + "@jest/fake-timers": "^26.6.2", + "@jest/types": "^26.6.2", + "@types/node": "*", + "jest-mock": "^26.6.2" + } + }, + "@jest/fake-timers": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/@jest/fake-timers/-/fake-timers-26.6.2.tgz", + "integrity": "sha512-14Uleatt7jdzefLPYM3KLcnUl1ZNikaKq34enpb5XG9i81JpppDb5muZvonvKyrl7ftEHkKS5L5/eB/kxJ+bvA==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "@sinonjs/fake-timers": "^6.0.1", + "@types/node": "*", + "jest-message-util": "^26.6.2", + "jest-mock": "^26.6.2", + "jest-util": "^26.6.2" + } + }, + "@jest/globals": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/@jest/globals/-/globals-26.6.2.tgz", + "integrity": "sha512-85Ltnm7HlB/KesBUuALwQ68YTU72w9H2xW9FjZ1eL1U3lhtefjjl5c2MiUbpXt/i6LaPRvoOFJ22yCBSfQ0JIA==", + "dev": true, + "requires": { + "@jest/environment": "^26.6.2", + "@jest/types": "^26.6.2", + "expect": "^26.6.2" + } + }, + "@jest/source-map": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/@jest/source-map/-/source-map-26.6.2.tgz", + "integrity": "sha512-YwYcCwAnNmOVsZ8mr3GfnzdXDAl4LaenZP5z+G0c8bzC9/dugL8zRmxZzdoTl4IaS3CryS1uWnROLPFmb6lVvA==", + "dev": true, + "requires": { + "callsites": "^3.0.0", + "graceful-fs": "^4.2.4", + "source-map": "^0.6.0" + } + }, + "@jest/test-result": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/@jest/test-result/-/test-result-26.6.2.tgz", + "integrity": "sha512-5O7H5c/7YlojphYNrK02LlDIV2GNPYisKwHm2QTKjNZeEzezCbwYs9swJySv2UfPMyZ0VdsmMv7jIlD/IKYQpQ==", + "dev": true, + "requires": { + "@jest/console": "^26.6.2", + "@jest/types": "^26.6.2", + "@types/istanbul-lib-coverage": "^2.0.0", + "collect-v8-coverage": "^1.0.0" + } + }, + "@jest/test-sequencer": { + "version": "26.6.3", + "resolved": "https://registry.npmjs.org/@jest/test-sequencer/-/test-sequencer-26.6.3.tgz", + "integrity": "sha512-YHlVIjP5nfEyjlrSr8t/YdNfU/1XEt7c5b4OxcXCjyRhjzLYu/rO69/WHPuYcbCWkz8kAeZVZp2N2+IOLLEPGw==", + "dev": true, + "requires": { + "@jest/test-result": "^26.6.2", + "graceful-fs": "^4.2.4", + "jest-haste-map": "^26.6.2", + "jest-runner": "^26.6.3", + "jest-runtime": "^26.6.3" + } + }, + "@jest/transform": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/@jest/transform/-/transform-26.6.2.tgz", + "integrity": "sha512-E9JjhUgNzvuQ+vVAL21vlyfy12gP0GhazGgJC4h6qUt1jSdUXGWJ1wfu/X7Sd8etSgxV4ovT1pb9v5D6QW4XgA==", + "dev": true, + "requires": { + "@babel/core": "^7.1.0", + "@jest/types": "^26.6.2", + "babel-plugin-istanbul": "^6.0.0", + "chalk": "^4.0.0", + "convert-source-map": "^1.4.0", + "fast-json-stable-stringify": "^2.0.0", + "graceful-fs": "^4.2.4", + "jest-haste-map": "^26.6.2", + "jest-regex-util": "^26.0.0", + "jest-util": "^26.6.2", + "micromatch": "^4.0.2", + "pirates": "^4.0.1", + "slash": "^3.0.0", + "source-map": "^0.6.1", + "write-file-atomic": "^3.0.0" + } + }, + "@jest/types": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/@jest/types/-/types-26.6.2.tgz", + "integrity": "sha512-fC6QCp7Sc5sX6g8Tvbmj4XUTbyrik0akgRy03yjXbQaBWWNWGE7SGtJk98m0N8nzegD/7SggrUlivxo5ax4KWQ==", + "dev": true, + "requires": { + "@types/istanbul-lib-coverage": "^2.0.0", + "@types/istanbul-reports": "^3.0.0", + "@types/node": "*", + "@types/yargs": "^15.0.0", + "chalk": "^4.0.0" + } + }, + "@types/istanbul-reports": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/@types/istanbul-reports/-/istanbul-reports-3.0.0.tgz", + "integrity": "sha512-nwKNbvnwJ2/mndE9ItP/zc2TCzw6uuodnF4EHYWD+gCQDVBuRQL5UzbZD0/ezy1iKsFU2ZQiDqg4M9dN4+wZgA==", + "dev": true, + "requires": { + "@types/istanbul-lib-report": "*" + } + }, + "@types/prettier": { + "version": "2.2.3", + "resolved": "https://registry.npmjs.org/@types/prettier/-/prettier-2.2.3.tgz", + "integrity": "sha512-PijRCG/K3s3w1We6ynUKdxEc5AcuuH3NBmMDP8uvKVp6X43UY7NQlTzczakXP3DJR0F4dfNQIGjU2cUeRYs2AA==", + "dev": true + }, + "@types/stack-utils": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/@types/stack-utils/-/stack-utils-2.0.0.tgz", + "integrity": "sha512-RJJrrySY7A8havqpGObOB4W92QXKJo63/jFLLgpvOtsGUqbQZ9Sbgl35KMm1DjC6j7AvmmU2bIno+3IyEaemaw==", + "dev": true + }, + "@types/yargs": { + "version": "15.0.13", + "resolved": "https://registry.npmjs.org/@types/yargs/-/yargs-15.0.13.tgz", + "integrity": "sha512-kQ5JNTrbDv3Rp5X2n/iUu37IJBDU2gsZ5R/g1/KHOOEc5IKfUFjXT6DENPGduh08I/pamwtEq4oul7gUqKTQDQ==", + "dev": true, + "requires": { + "@types/yargs-parser": "*" + } + }, + "acorn": { + "version": "8.1.1", + "resolved": "https://registry.npmjs.org/acorn/-/acorn-8.1.1.tgz", + "integrity": "sha512-xYiIVjNuqtKXMxlRMDc6mZUhXehod4a3gbZ1qRlM7icK4EbxUFNLhWoPblCvFtB2Y9CIqHP3CF/rdxLItaQv8g==", + "dev": true + }, + "acorn-globals": { + "version": "6.0.0", + "resolved": "https://registry.npmjs.org/acorn-globals/-/acorn-globals-6.0.0.tgz", + "integrity": "sha512-ZQl7LOWaF5ePqqcX4hLuv/bLXYQNfNWw2c0/yX/TsPRKamzHcTGQnlCjHT3TsmkOUVEPS3crCxiPfdzE/Trlhg==", + "dev": true, + "requires": { + "acorn": "^7.1.1", + "acorn-walk": "^7.1.1" + }, + "dependencies": { + "acorn": { + "version": "7.4.1", + "resolved": "https://registry.npmjs.org/acorn/-/acorn-7.4.1.tgz", + "integrity": "sha512-nQyp0o1/mNdbTO1PO6kHkwSrmgZ0MT/jCCpNiwbUjGoRN4dlBhqJtoQuCnEOKzgTVwg0ZWiCoQy6SxMebQVh8A==", + "dev": true + } + } + }, + "acorn-walk": { + "version": "7.2.0", + "resolved": "https://registry.npmjs.org/acorn-walk/-/acorn-walk-7.2.0.tgz", + "integrity": "sha512-OPdCF6GsMIP+Az+aWfAAOEt2/+iVDKE7oy6lJ098aoe59oAmK76qV6Gw60SbZ8jHuG2wH058GF4pLFbYamYrVA==", + "dev": true + }, + "ansi-regex": { + "version": "5.0.0", + "resolved": "https://registry.npmjs.org/ansi-regex/-/ansi-regex-5.0.0.tgz", + "integrity": "sha512-bY6fj56OUQ0hU1KjFNDQuJFezqKdrAyFdIevADiqrWHwSlbmBNMHp5ak2f40Pm8JTFyM2mqxkG6ngkHO11f/lg==", + "dev": true + }, + "ansi-styles": { + "version": "4.3.0", + "resolved": "https://registry.npmjs.org/ansi-styles/-/ansi-styles-4.3.0.tgz", + "integrity": "sha512-zbB9rCJAT1rbjiVDb2hqKFHNYLxgtk8NURxZ3IZwD3F6NtxbXZQCnnSi1Lkx+IDohdPlFp222wVALIheZJQSEg==", + "dev": true, + "requires": { + "color-convert": "^2.0.1" + } + }, + "anymatch": { + "version": "3.1.2", + "resolved": "https://registry.npmjs.org/anymatch/-/anymatch-3.1.2.tgz", + "integrity": "sha512-P43ePfOAIupkguHUycrc4qJ9kz8ZiuOUijaETwX7THt0Y/GNK7v0aa8rY816xWjZ7rJdA5XdMcpVFTKMq+RvWg==", + "dev": true, + "requires": { + "normalize-path": "^3.0.0", + "picomatch": "^2.0.4" + } + }, + "babel-jest": { + "version": "26.6.3", + "resolved": "https://registry.npmjs.org/babel-jest/-/babel-jest-26.6.3.tgz", + "integrity": "sha512-pl4Q+GAVOHwvjrck6jKjvmGhnO3jHX/xuB9d27f+EJZ/6k+6nMuPjorrYp7s++bKKdANwzElBWnLWaObvTnaZA==", + "dev": true, + "requires": { + "@jest/transform": "^26.6.2", + "@jest/types": "^26.6.2", + "@types/babel__core": "^7.1.7", + "babel-plugin-istanbul": "^6.0.0", + "babel-preset-jest": "^26.6.2", + "chalk": "^4.0.0", + "graceful-fs": "^4.2.4", + "slash": "^3.0.0" + } + }, + "babel-plugin-istanbul": { + "version": "6.0.0", + "resolved": "https://registry.npmjs.org/babel-plugin-istanbul/-/babel-plugin-istanbul-6.0.0.tgz", + "integrity": "sha512-AF55rZXpe7trmEylbaE1Gv54wn6rwU03aptvRoVIGP8YykoSxqdVLV1TfwflBCE/QtHmqtP8SWlTENqbK8GCSQ==", + "dev": true, + "requires": { + "@babel/helper-plugin-utils": "^7.0.0", + "@istanbuljs/load-nyc-config": "^1.0.0", + "@istanbuljs/schema": "^0.1.2", + "istanbul-lib-instrument": "^4.0.0", + "test-exclude": "^6.0.0" + } + }, + "babel-plugin-jest-hoist": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/babel-plugin-jest-hoist/-/babel-plugin-jest-hoist-26.6.2.tgz", + "integrity": "sha512-PO9t0697lNTmcEHH69mdtYiOIkkOlj9fySqfO3K1eCcdISevLAE0xY59VLLUj0SoiPiTX/JU2CYFpILydUa5Lw==", + "dev": true, + "requires": { + "@babel/template": "^7.3.3", + "@babel/types": "^7.3.3", + "@types/babel__core": "^7.0.0", + "@types/babel__traverse": "^7.0.6" + } + }, + "babel-preset-current-node-syntax": { + "version": "1.0.1", + "resolved": "https://registry.npmjs.org/babel-preset-current-node-syntax/-/babel-preset-current-node-syntax-1.0.1.tgz", + "integrity": "sha512-M7LQ0bxarkxQoN+vz5aJPsLBn77n8QgTFmo8WK0/44auK2xlCXrYcUxHFxgU7qW5Yzw/CjmLRK2uJzaCd7LvqQ==", + "dev": true, + "requires": { + "@babel/plugin-syntax-async-generators": "^7.8.4", + "@babel/plugin-syntax-bigint": "^7.8.3", + "@babel/plugin-syntax-class-properties": "^7.8.3", + "@babel/plugin-syntax-import-meta": "^7.8.3", + "@babel/plugin-syntax-json-strings": "^7.8.3", + "@babel/plugin-syntax-logical-assignment-operators": "^7.8.3", + "@babel/plugin-syntax-nullish-coalescing-operator": "^7.8.3", + "@babel/plugin-syntax-numeric-separator": "^7.8.3", + "@babel/plugin-syntax-object-rest-spread": "^7.8.3", + "@babel/plugin-syntax-optional-catch-binding": "^7.8.3", + "@babel/plugin-syntax-optional-chaining": "^7.8.3", + "@babel/plugin-syntax-top-level-await": "^7.8.3" + } + }, + "babel-preset-jest": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/babel-preset-jest/-/babel-preset-jest-26.6.2.tgz", + "integrity": "sha512-YvdtlVm9t3k777c5NPQIv6cxFFFapys25HiUmuSgHwIZhfifweR5c5Sf5nwE3MAbfu327CYSvps8Yx6ANLyleQ==", + "dev": true, + "requires": { + "babel-plugin-jest-hoist": "^26.6.2", + "babel-preset-current-node-syntax": "^1.0.0" + } + }, + "braces": { + "version": "3.0.2", + "resolved": "https://registry.npmjs.org/braces/-/braces-3.0.2.tgz", + "integrity": "sha512-b8um+L1RzM3WDSzvhm6gIz1yfTbBt6YTlcEKAvsmqCZZFw46z626lVj9j1yEPW33H5H+lBQpZMP1k8l+78Ha0A==", + "dev": true, + "requires": { + "fill-range": "^7.0.1" + } + }, + "camelcase": { + "version": "6.2.0", + "resolved": "https://registry.npmjs.org/camelcase/-/camelcase-6.2.0.tgz", + "integrity": "sha512-c7wVvbw3f37nuobQNtgsgG9POC9qMbNuMQmTCqZv23b6MIz0fcYpBiOlv9gEN/hdLdnZTDQhg6e9Dq5M1vKvfg==", + "dev": true + }, + "chalk": { + "version": "4.1.0", + "resolved": "https://registry.npmjs.org/chalk/-/chalk-4.1.0.tgz", + "integrity": "sha512-qwx12AxXe2Q5xQ43Ac//I6v5aXTipYrSESdOgzrN+9XjgEpyjpKuvSGaN4qE93f7TQTlerQQ8S+EQ0EyDoVL1A==", + "dev": true, + "requires": { + "ansi-styles": "^4.1.0", + "supports-color": "^7.1.0" + } + }, + "cliui": { + "version": "6.0.0", + "resolved": "https://registry.npmjs.org/cliui/-/cliui-6.0.0.tgz", + "integrity": "sha512-t6wbgtoCXvAzst7QgXxJYqPt0usEfbgQdftEPbLL/cvv6HPE5VgvqCuAIDR0NgU52ds6rFwqrgakNLrHEjCbrQ==", + "dev": true, + "requires": { + "string-width": "^4.2.0", + "strip-ansi": "^6.0.0", + "wrap-ansi": "^6.2.0" + } + }, + "color-convert": { + "version": "2.0.1", + "resolved": "https://registry.npmjs.org/color-convert/-/color-convert-2.0.1.tgz", + "integrity": "sha512-RRECPsj7iu/xb5oKYcsFHSppFNnsj/52OVTRKb4zP5onXwVF3zVmmToNcOfGC+CRDpfK/U584fMg38ZHCaElKQ==", + "dev": true, + "requires": { + "color-name": "~1.1.4" + } + }, + "color-name": { + "version": "1.1.4", + "resolved": "https://registry.npmjs.org/color-name/-/color-name-1.1.4.tgz", + "integrity": "sha512-dOy+3AuW3a2wNbZHIuMZpTcgjGuLU/uBL/ubcZF9OXbDo8ff4O8yVp5Bf0efS8uEoYo5q4Fx7dY9OgQGXgAsQA==", + "dev": true + }, + "cssom": { + "version": "0.4.4", + "resolved": "https://registry.npmjs.org/cssom/-/cssom-0.4.4.tgz", + "integrity": "sha512-p3pvU7r1MyyqbTk+WbNJIgJjG2VmTIaB10rI93LzVPrmDJKkzKYMtxxyAvQXR/NS6otuzveI7+7BBq3SjBS2mw==", + "dev": true + }, + "cssstyle": { + "version": "2.3.0", + "resolved": "https://registry.npmjs.org/cssstyle/-/cssstyle-2.3.0.tgz", + "integrity": "sha512-AZL67abkUzIuvcHqk7c09cezpGNcxUxU4Ioi/05xHk4DQeTkWmGYftIE6ctU6AEt+Gn4n1lDStOtj7FKycP71A==", + "dev": true, + "requires": { + "cssom": "~0.3.6" + }, + "dependencies": { + "cssom": { + "version": "0.3.8", + "resolved": "https://registry.npmjs.org/cssom/-/cssom-0.3.8.tgz", + "integrity": "sha512-b0tGHbfegbhPJpxpiBPU2sCkigAqtM9O121le6bbOlgyV+NyGyCmVfJ6QW9eRjz8CpNfWEOYBIMIGRYkLwsIYg==", + "dev": true + } + } + }, + "data-urls": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/data-urls/-/data-urls-2.0.0.tgz", + "integrity": "sha512-X5eWTSXO/BJmpdIKCRuKUgSCgAN0OwliVK3yPKbwIWU1Tdw5BRajxlzMidvh+gwko9AfQ9zIj52pzF91Q3YAvQ==", + "dev": true, + "requires": { + "abab": "^2.0.3", + "whatwg-mimetype": "^2.3.0", + "whatwg-url": "^8.0.0" + } + }, + "detect-newline": { + "version": "3.1.0", + "resolved": "https://registry.npmjs.org/detect-newline/-/detect-newline-3.1.0.tgz", + "integrity": "sha512-TLz+x/vEXm/Y7P7wn1EJFNLxYpUD4TgMosxY6fAVJUnJMbupHBOncxyWUG9OpTaH9EBD7uFI5LfEgmMOc54DsA==", + "dev": true + }, + "diff-sequences": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/diff-sequences/-/diff-sequences-26.6.2.tgz", + "integrity": "sha512-Mv/TDa3nZ9sbc5soK+OoA74BsS3mL37yixCvUAQkiuA4Wz6YtwP/K47n2rv2ovzHZvoiQeA5FTQOschKkEwB0Q==", + "dev": true + }, + "domexception": { + "version": "2.0.1", + "resolved": "https://registry.npmjs.org/domexception/-/domexception-2.0.1.tgz", + "integrity": "sha512-yxJ2mFy/sibVQlu5qHjOkf9J3K6zgmCxgJ94u2EdvDOV09H+32LtRswEcUsmUWN72pVLOEnTSRaIVVzVQgS0dg==", + "dev": true, + "requires": { + "webidl-conversions": "^5.0.0" + }, + "dependencies": { + "webidl-conversions": { + "version": "5.0.0", + "resolved": "https://registry.npmjs.org/webidl-conversions/-/webidl-conversions-5.0.0.tgz", + "integrity": "sha512-VlZwKPCkYKxQgeSbH5EyngOmRp7Ww7I9rQLERETtf5ofd9pGeswWiOtogpEO850jziPRarreGxn5QIiTqpb2wA==", + "dev": true + } + } + }, + "emoji-regex": { + "version": "8.0.0", + "resolved": "https://registry.npmjs.org/emoji-regex/-/emoji-regex-8.0.0.tgz", + "integrity": "sha512-MSjYzcWNOA0ewAHpz0MxpYFvwg6yjy1NG3xteoqz644VCo/RPgnr1/GGt+ic3iJTzQ8Eu3TdM14SawnVUmGE6A==", + "dev": true + }, + "escape-string-regexp": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/escape-string-regexp/-/escape-string-regexp-2.0.0.tgz", + "integrity": "sha512-UpzcLCXolUWcNu5HtVMHYdXJjArjsF9C0aNnquZYY4uW/Vu0miy5YoWvbV345HauVvcAUnpRuhMMcqTcGOY2+w==", + "dev": true + }, + "escodegen": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/escodegen/-/escodegen-2.0.0.tgz", + "integrity": "sha512-mmHKys/C8BFUGI+MAWNcSYoORYLMdPzjrknd2Vc+bUsjN5bXcr8EhrNB+UTqfL1y3I9c4fw2ihgtMPQLBRiQxw==", + "dev": true, + "requires": { + "esprima": "^4.0.1", + "estraverse": "^5.2.0", + "esutils": "^2.0.2", + "optionator": "^0.8.1", + "source-map": "~0.6.1" + } + }, + "estraverse": { + "version": "5.2.0", + "resolved": "https://registry.npmjs.org/estraverse/-/estraverse-5.2.0.tgz", + "integrity": "sha512-BxbNGGNm0RyRYvUdHpIwv9IWzeM9XClbOxwoATuFdOE7ZE6wHL+HQ5T8hoPM+zHvmKzzsEqhgy0GrQ5X13afiQ==", + "dev": true + }, + "expect": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/expect/-/expect-26.6.2.tgz", + "integrity": "sha512-9/hlOBkQl2l/PLHJx6JjoDF6xPKcJEsUlWKb23rKE7KzeDqUZKXKNMW27KIue5JMdBV9HgmoJPcc8HtO85t9IA==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "ansi-styles": "^4.0.0", + "jest-get-type": "^26.3.0", + "jest-matcher-utils": "^26.6.2", + "jest-message-util": "^26.6.2", + "jest-regex-util": "^26.0.0" + } + }, + "fill-range": { + "version": "7.0.1", + "resolved": "https://registry.npmjs.org/fill-range/-/fill-range-7.0.1.tgz", + "integrity": "sha512-qOo9F+dMUmC2Lcb4BbVvnKJxTPjCm+RRpe4gDuGrzkL7mEVl/djYSu2OdQ2Pa302N4oqkSg9ir6jaLWJ2USVpQ==", + "dev": true, + "requires": { + "to-regex-range": "^5.0.1" + } + }, + "find-up": { + "version": "4.1.0", + "resolved": "https://registry.npmjs.org/find-up/-/find-up-4.1.0.tgz", + "integrity": "sha512-PpOwAdQ/YlXQ2vj8a3h8IipDuYRi3wceVQQGYWxNINccq40Anw7BlsEXCMbt1Zt+OLA6Fq9suIpIWD0OsnISlw==", + "dev": true, + "requires": { + "locate-path": "^5.0.0", + "path-exists": "^4.0.0" + } + }, + "fsevents": { + "version": "2.3.2", + "resolved": "https://registry.npmjs.org/fsevents/-/fsevents-2.3.2.tgz", + "integrity": "sha512-xiqMQR4xAeHTuB9uWm+fFRcIOgKBMiOBP+eXiyT7jsgVCq1bkVygt00oASowB7EdtpOHaaPgKt812P9ab+DDKA==", + "dev": true, + "optional": true + }, + "has-flag": { + "version": "4.0.0", + "resolved": "https://registry.npmjs.org/has-flag/-/has-flag-4.0.0.tgz", + "integrity": "sha512-EykJT/Q1KjTWctppgIAgfSO0tKVuZUjhgMr17kqTumMl6Afv3EISleU7qZUzoXDFTAHTDC4NOoG/ZxU3EvlMPQ==", + "dev": true + }, + "html-encoding-sniffer": { + "version": "2.0.1", + "resolved": "https://registry.npmjs.org/html-encoding-sniffer/-/html-encoding-sniffer-2.0.1.tgz", + "integrity": "sha512-D5JbOMBIR/TVZkubHT+OyT2705QvogUW4IBn6nHd756OwieSF9aDYFj4dv6HHEVGYbHaLETa3WggZYWWMyy3ZQ==", + "dev": true, + "requires": { + "whatwg-encoding": "^1.0.5" + } + }, + "is-fullwidth-code-point": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/is-fullwidth-code-point/-/is-fullwidth-code-point-3.0.0.tgz", + "integrity": "sha512-zymm5+u+sCsSWyD9qNaejV3DFvhCKclKdizYaJUuHA83RLjb7nSuGnddCHGv0hk+KY7BMAlsWeK4Ueg6EV6XQg==", + "dev": true + }, + "is-number": { + "version": "7.0.0", + "resolved": "https://registry.npmjs.org/is-number/-/is-number-7.0.0.tgz", + "integrity": "sha512-41Cifkg6e8TylSpdtTpeLVMqvSBEVzTttHvERD741+pnZ8ANv0004MRL43QKPDlK9cGvNp6NZWZUBlbGXYxxng==", + "dev": true + }, + "istanbul-lib-coverage": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/istanbul-lib-coverage/-/istanbul-lib-coverage-3.0.0.tgz", + "integrity": "sha512-UiUIqxMgRDET6eR+o5HbfRYP1l0hqkWOs7vNxC/mggutCMUIhWMm8gAHb8tHlyfD3/l6rlgNA5cKdDzEAf6hEg==", + "dev": true + }, + "istanbul-lib-instrument": { + "version": "4.0.3", + "resolved": "https://registry.npmjs.org/istanbul-lib-instrument/-/istanbul-lib-instrument-4.0.3.tgz", + "integrity": "sha512-BXgQl9kf4WTCPCCpmFGoJkz/+uhvm7h7PFKUYxh7qarQd3ER33vHG//qaE8eN25l07YqZPpHXU9I09l/RD5aGQ==", + "dev": true, + "requires": { + "@babel/core": "^7.7.5", + "@istanbuljs/schema": "^0.1.2", + "istanbul-lib-coverage": "^3.0.0", + "semver": "^6.3.0" + } + }, + "jest-config": { + "version": "26.6.3", + "resolved": "https://registry.npmjs.org/jest-config/-/jest-config-26.6.3.tgz", + "integrity": "sha512-t5qdIj/bCj2j7NFVHb2nFB4aUdfucDn3JRKgrZnplb8nieAirAzRSHP8uDEd+qV6ygzg9Pz4YG7UTJf94LPSyg==", + "dev": true, + "requires": { + "@babel/core": "^7.1.0", + "@jest/test-sequencer": "^26.6.3", + "@jest/types": "^26.6.2", + "babel-jest": "^26.6.3", + "chalk": "^4.0.0", + "deepmerge": "^4.2.2", + "glob": "^7.1.1", + "graceful-fs": "^4.2.4", + "jest-environment-jsdom": "^26.6.2", + "jest-environment-node": "^26.6.2", + "jest-get-type": "^26.3.0", + "jest-jasmine2": "^26.6.3", + "jest-regex-util": "^26.0.0", + "jest-resolve": "^26.6.2", + "jest-util": "^26.6.2", + "jest-validate": "^26.6.2", + "micromatch": "^4.0.2", + "pretty-format": "^26.6.2" + } + }, + "jest-diff": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-diff/-/jest-diff-26.6.2.tgz", + "integrity": "sha512-6m+9Z3Gv9wN0WFVasqjCL/06+EFCMTqDEUl/b87HYK2rAPTyfz4ZIuSlPhY51PIQRWx5TaxeF1qmXKe9gfN3sA==", + "dev": true, + "requires": { + "chalk": "^4.0.0", + "diff-sequences": "^26.6.2", + "jest-get-type": "^26.3.0", + "pretty-format": "^26.6.2" + } + }, + "jest-docblock": { + "version": "26.0.0", + "resolved": "https://registry.npmjs.org/jest-docblock/-/jest-docblock-26.0.0.tgz", + "integrity": "sha512-RDZ4Iz3QbtRWycd8bUEPxQsTlYazfYn/h5R65Fc6gOfwozFhoImx+affzky/FFBuqISPTqjXomoIGJVKBWoo0w==", + "dev": true, + "requires": { + "detect-newline": "^3.0.0" + } + }, + "jest-each": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-each/-/jest-each-26.6.2.tgz", + "integrity": "sha512-Mer/f0KaATbjl8MCJ+0GEpNdqmnVmDYqCTJYTvoo7rqmRiDllmp2AYN+06F93nXcY3ur9ShIjS+CO/uD+BbH4A==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "chalk": "^4.0.0", + "jest-get-type": "^26.3.0", + "jest-util": "^26.6.2", + "pretty-format": "^26.6.2" + } + }, + "jest-environment-jsdom": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-environment-jsdom/-/jest-environment-jsdom-26.6.2.tgz", + "integrity": "sha512-jgPqCruTlt3Kwqg5/WVFyHIOJHsiAvhcp2qiR2QQstuG9yWox5+iHpU3ZrcBxW14T4fe5Z68jAfLRh7joCSP2Q==", + "dev": true, + "requires": { + "@jest/environment": "^26.6.2", + "@jest/fake-timers": "^26.6.2", + "@jest/types": "^26.6.2", + "@types/node": "*", + "jest-mock": "^26.6.2", + "jest-util": "^26.6.2", + "jsdom": "^16.4.0" + } + }, + "jest-environment-node": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-environment-node/-/jest-environment-node-26.6.2.tgz", + "integrity": "sha512-zhtMio3Exty18dy8ee8eJ9kjnRyZC1N4C1Nt/VShN1apyXc8rWGtJ9lI7vqiWcyyXS4BVSEn9lxAM2D+07/Tag==", + "dev": true, + "requires": { + "@jest/environment": "^26.6.2", + "@jest/fake-timers": "^26.6.2", + "@jest/types": "^26.6.2", + "@types/node": "*", + "jest-mock": "^26.6.2", + "jest-util": "^26.6.2" + } + }, + "jest-get-type": { + "version": "26.3.0", + "resolved": "https://registry.npmjs.org/jest-get-type/-/jest-get-type-26.3.0.tgz", + "integrity": "sha512-TpfaviN1R2pQWkIihlfEanwOXK0zcxrKEE4MlU6Tn7keoXdN6/3gK/xl0yEh8DOunn5pOVGKf8hB4R9gVh04ig==", + "dev": true + }, + "jest-haste-map": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-haste-map/-/jest-haste-map-26.6.2.tgz", + "integrity": "sha512-easWIJXIw71B2RdR8kgqpjQrbMRWQBgiBwXYEhtGUTaX+doCjBheluShdDMeR8IMfJiTqH4+zfhtg29apJf/8w==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "@types/graceful-fs": "^4.1.2", + "@types/node": "*", + "anymatch": "^3.0.3", + "fb-watchman": "^2.0.0", + "fsevents": "^2.1.2", + "graceful-fs": "^4.2.4", + "jest-regex-util": "^26.0.0", + "jest-serializer": "^26.6.2", + "jest-util": "^26.6.2", + "jest-worker": "^26.6.2", + "micromatch": "^4.0.2", + "sane": "^4.0.3", + "walker": "^1.0.7" + } + }, + "jest-jasmine2": { + "version": "26.6.3", + "resolved": "https://registry.npmjs.org/jest-jasmine2/-/jest-jasmine2-26.6.3.tgz", + "integrity": "sha512-kPKUrQtc8aYwBV7CqBg5pu+tmYXlvFlSFYn18ev4gPFtrRzB15N2gW/Roew3187q2w2eHuu0MU9TJz6w0/nPEg==", + "dev": true, + "requires": { + "@babel/traverse": "^7.1.0", + "@jest/environment": "^26.6.2", + "@jest/source-map": "^26.6.2", + "@jest/test-result": "^26.6.2", + "@jest/types": "^26.6.2", + "@types/node": "*", + "chalk": "^4.0.0", + "co": "^4.6.0", + "expect": "^26.6.2", + "is-generator-fn": "^2.0.0", + "jest-each": "^26.6.2", + "jest-matcher-utils": "^26.6.2", + "jest-message-util": "^26.6.2", + "jest-runtime": "^26.6.3", + "jest-snapshot": "^26.6.2", + "jest-util": "^26.6.2", + "pretty-format": "^26.6.2", + "throat": "^5.0.0" + } + }, + "jest-leak-detector": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-leak-detector/-/jest-leak-detector-26.6.2.tgz", + "integrity": "sha512-i4xlXpsVSMeKvg2cEKdfhh0H39qlJlP5Ex1yQxwF9ubahboQYMgTtz5oML35AVA3B4Eu+YsmwaiKVev9KCvLxg==", + "dev": true, + "requires": { + "jest-get-type": "^26.3.0", + "pretty-format": "^26.6.2" + } + }, + "jest-matcher-utils": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-matcher-utils/-/jest-matcher-utils-26.6.2.tgz", + "integrity": "sha512-llnc8vQgYcNqDrqRDXWwMr9i7rS5XFiCwvh6DTP7Jqa2mqpcCBBlpCbn+trkG0KNhPu/h8rzyBkriOtBstvWhw==", + "dev": true, + "requires": { + "chalk": "^4.0.0", + "jest-diff": "^26.6.2", + "jest-get-type": "^26.3.0", + "pretty-format": "^26.6.2" + } + }, + "jest-message-util": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-message-util/-/jest-message-util-26.6.2.tgz", + "integrity": "sha512-rGiLePzQ3AzwUshu2+Rn+UMFk0pHN58sOG+IaJbk5Jxuqo3NYO1U2/MIR4S1sKgsoYSXSzdtSa0TgrmtUwEbmA==", + "dev": true, + "requires": { + "@babel/code-frame": "^7.0.0", + "@jest/types": "^26.6.2", + "@types/stack-utils": "^2.0.0", + "chalk": "^4.0.0", + "graceful-fs": "^4.2.4", + "micromatch": "^4.0.2", + "pretty-format": "^26.6.2", + "slash": "^3.0.0", + "stack-utils": "^2.0.2" + } + }, + "jest-mock": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-mock/-/jest-mock-26.6.2.tgz", + "integrity": "sha512-YyFjePHHp1LzpzYcmgqkJ0nm0gg/lJx2aZFzFy1S6eUqNjXsOqTK10zNRff2dNfssgokjkG65OlWNcIlgd3zew==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "@types/node": "*" + } + }, + "jest-regex-util": { + "version": "26.0.0", + "resolved": "https://registry.npmjs.org/jest-regex-util/-/jest-regex-util-26.0.0.tgz", + "integrity": "sha512-Gv3ZIs/nA48/Zvjrl34bf+oD76JHiGDUxNOVgUjh3j890sblXryjY4rss71fPtD/njchl6PSE2hIhvyWa1eT0A==", + "dev": true + }, + "jest-resolve": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-resolve/-/jest-resolve-26.6.2.tgz", + "integrity": "sha512-sOxsZOq25mT1wRsfHcbtkInS+Ek7Q8jCHUB0ZUTP0tc/c41QHriU/NunqMfCUWsL4H3MHpvQD4QR9kSYhS7UvQ==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "chalk": "^4.0.0", + "graceful-fs": "^4.2.4", + "jest-pnp-resolver": "^1.2.2", + "jest-util": "^26.6.2", + "read-pkg-up": "^7.0.1", + "resolve": "^1.18.1", + "slash": "^3.0.0" + } + }, + "jest-runner": { + "version": "26.6.3", + "resolved": "https://registry.npmjs.org/jest-runner/-/jest-runner-26.6.3.tgz", + "integrity": "sha512-atgKpRHnaA2OvByG/HpGA4g6CSPS/1LK0jK3gATJAoptC1ojltpmVlYC3TYgdmGp+GLuhzpH30Gvs36szSL2JQ==", + "dev": true, + "requires": { + "@jest/console": "^26.6.2", + "@jest/environment": "^26.6.2", + "@jest/test-result": "^26.6.2", + "@jest/types": "^26.6.2", + "@types/node": "*", + "chalk": "^4.0.0", + "emittery": "^0.7.1", + "exit": "^0.1.2", + "graceful-fs": "^4.2.4", + "jest-config": "^26.6.3", + "jest-docblock": "^26.0.0", + "jest-haste-map": "^26.6.2", + "jest-leak-detector": "^26.6.2", + "jest-message-util": "^26.6.2", + "jest-resolve": "^26.6.2", + "jest-runtime": "^26.6.3", + "jest-util": "^26.6.2", + "jest-worker": "^26.6.2", + "source-map-support": "^0.5.6", + "throat": "^5.0.0" + } + }, + "jest-runtime": { + "version": "26.6.3", + "resolved": "https://registry.npmjs.org/jest-runtime/-/jest-runtime-26.6.3.tgz", + "integrity": "sha512-lrzyR3N8sacTAMeonbqpnSka1dHNux2uk0qqDXVkMv2c/A3wYnvQ4EXuI013Y6+gSKSCxdaczvf4HF0mVXHRdw==", + "dev": true, + "requires": { + "@jest/console": "^26.6.2", + "@jest/environment": "^26.6.2", + "@jest/fake-timers": "^26.6.2", + "@jest/globals": "^26.6.2", + "@jest/source-map": "^26.6.2", + "@jest/test-result": "^26.6.2", + "@jest/transform": "^26.6.2", + "@jest/types": "^26.6.2", + "@types/yargs": "^15.0.0", + "chalk": "^4.0.0", + "cjs-module-lexer": "^0.6.0", + "collect-v8-coverage": "^1.0.0", + "exit": "^0.1.2", + "glob": "^7.1.3", + "graceful-fs": "^4.2.4", + "jest-config": "^26.6.3", + "jest-haste-map": "^26.6.2", + "jest-message-util": "^26.6.2", + "jest-mock": "^26.6.2", + "jest-regex-util": "^26.0.0", + "jest-resolve": "^26.6.2", + "jest-snapshot": "^26.6.2", + "jest-util": "^26.6.2", + "jest-validate": "^26.6.2", + "slash": "^3.0.0", + "strip-bom": "^4.0.0", + "yargs": "^15.4.1" + } + }, + "jest-serializer": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-serializer/-/jest-serializer-26.6.2.tgz", + "integrity": "sha512-S5wqyz0DXnNJPd/xfIzZ5Xnp1HrJWBczg8mMfMpN78OJ5eDxXyf+Ygld9wX1DnUWbIbhM1YDY95NjR4CBXkb2g==", + "dev": true, + "requires": { + "@types/node": "*", + "graceful-fs": "^4.2.4" + } + }, + "jest-snapshot": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-snapshot/-/jest-snapshot-26.6.2.tgz", + "integrity": "sha512-OLhxz05EzUtsAmOMzuupt1lHYXCNib0ECyuZ/PZOx9TrZcC8vL0x+DUG3TL+GLX3yHG45e6YGjIm0XwDc3q3og==", + "dev": true, + "requires": { + "@babel/types": "^7.0.0", + "@jest/types": "^26.6.2", + "@types/babel__traverse": "^7.0.4", + "@types/prettier": "^2.0.0", + "chalk": "^4.0.0", + "expect": "^26.6.2", + "graceful-fs": "^4.2.4", + "jest-diff": "^26.6.2", + "jest-get-type": "^26.3.0", + "jest-haste-map": "^26.6.2", + "jest-matcher-utils": "^26.6.2", + "jest-message-util": "^26.6.2", + "jest-resolve": "^26.6.2", + "natural-compare": "^1.4.0", + "pretty-format": "^26.6.2", + "semver": "^7.3.2" + }, + "dependencies": { + "semver": { + "version": "7.3.5", + "resolved": "https://registry.npmjs.org/semver/-/semver-7.3.5.tgz", + "integrity": "sha512-PoeGJYh8HK4BTO/a9Tf6ZG3veo/A7ZVsYrSA6J8ny9nb3B1VrpkuN+z9OE5wfE5p6H4LchYZsegiQgbJD94ZFQ==", + "dev": true, + "requires": { + "lru-cache": "^6.0.0" + } + } + } + }, + "jest-util": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-util/-/jest-util-26.6.2.tgz", + "integrity": "sha512-MDW0fKfsn0OI7MS7Euz6h8HNDXVQ0gaM9uW6RjfDmd1DAFcaxX9OqIakHIqhbnmF08Cf2DLDG+ulq8YQQ0Lp0Q==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "@types/node": "*", + "chalk": "^4.0.0", + "graceful-fs": "^4.2.4", + "is-ci": "^2.0.0", + "micromatch": "^4.0.2" + } + }, + "jest-validate": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-validate/-/jest-validate-26.6.2.tgz", + "integrity": "sha512-NEYZ9Aeyj0i5rQqbq+tpIOom0YS1u2MVu6+euBsvpgIme+FOfRmoC4R5p0JiAUpaFvFy24xgrpMknarR/93XjQ==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "camelcase": "^6.0.0", + "chalk": "^4.0.0", + "jest-get-type": "^26.3.0", + "leven": "^3.1.0", + "pretty-format": "^26.6.2" + } + }, + "jest-worker": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-worker/-/jest-worker-26.6.2.tgz", + "integrity": "sha512-KWYVV1c4i+jbMpaBC+U++4Va0cp8OisU185o73T1vo99hqi7w8tSJfUXYswwqqrjzwxa6KpRK54WhPvwf5w6PQ==", + "dev": true, + "requires": { + "@types/node": "*", + "merge-stream": "^2.0.0", + "supports-color": "^7.0.0" + } + }, + "jsdom": { + "version": "16.5.3", + "resolved": "https://registry.npmjs.org/jsdom/-/jsdom-16.5.3.tgz", + "integrity": "sha512-Qj1H+PEvUsOtdPJ056ewXM4UJPCi4hhLA8wpiz9F2YvsRBhuFsXxtrIFAgGBDynQA9isAMGE91PfUYbdMPXuTA==", + "dev": true, + "requires": { + "abab": "^2.0.5", + "acorn": "^8.1.0", + "acorn-globals": "^6.0.0", + "cssom": "^0.4.4", + "cssstyle": "^2.3.0", + "data-urls": "^2.0.0", + "decimal.js": "^10.2.1", + "domexception": "^2.0.1", + "escodegen": "^2.0.0", + "html-encoding-sniffer": "^2.0.1", + "is-potential-custom-element-name": "^1.0.0", + "nwsapi": "^2.2.0", + "parse5": "6.0.1", + "request": "^2.88.2", + "request-promise-native": "^1.0.9", + "saxes": "^5.0.1", + "symbol-tree": "^3.2.4", + "tough-cookie": "^4.0.0", + "w3c-hr-time": "^1.0.2", + "w3c-xmlserializer": "^2.0.0", + "webidl-conversions": "^6.1.0", + "whatwg-encoding": "^1.0.5", + "whatwg-mimetype": "^2.3.0", + "whatwg-url": "^8.5.0", + "ws": "^7.4.4", + "xml-name-validator": "^3.0.0" + } + }, + "locate-path": { + "version": "5.0.0", + "resolved": "https://registry.npmjs.org/locate-path/-/locate-path-5.0.0.tgz", + "integrity": "sha512-t7hw9pI+WvuwNJXwk5zVHpyhIqzg2qTlklJOf0mVxGSbe3Fp2VieZcduNYjaLDoy6p9uGpQEGWG87WpMKlNq8g==", + "dev": true, + "requires": { + "p-locate": "^4.1.0" + } + }, + "micromatch": { + "version": "4.0.4", + "resolved": "https://registry.npmjs.org/micromatch/-/micromatch-4.0.4.tgz", + "integrity": "sha512-pRmzw/XUcwXGpD9aI9q/0XOwLNygjETJ8y0ao0wdqprrzDa4YnxLcz7fQRZr8voh8V10kGhABbNcHVk5wHgWwg==", + "dev": true, + "requires": { + "braces": "^3.0.1", + "picomatch": "^2.2.3" + } + }, + "normalize-path": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/normalize-path/-/normalize-path-3.0.0.tgz", + "integrity": "sha512-6eZs5Ls3WtCisHWp9S2GUy8dqkpGi4BVSz3GaqiE6ezub0512ESztXUwUB6C6IKbQkY2Pnb/mD4WYojCRwcwLA==", + "dev": true + }, + "p-locate": { + "version": "4.1.0", + "resolved": "https://registry.npmjs.org/p-locate/-/p-locate-4.1.0.tgz", + "integrity": "sha512-R79ZZ/0wAxKGu3oYMlz8jy/kbhsNrS7SKZ7PxEHBgJ5+F2mtFW2fK2cOtBh1cHYkQsbzFV7I+EoRKe6Yt0oK7A==", + "dev": true, + "requires": { + "p-limit": "^2.2.0" + } + }, + "parse-json": { + "version": "5.2.0", + "resolved": "https://registry.npmjs.org/parse-json/-/parse-json-5.2.0.tgz", + "integrity": "sha512-ayCKvm/phCGxOkYRSCM82iDwct8/EonSEgCSxWxD7ve6jHggsFl4fZVQBPRNgQoKiuV/odhFrGzQXZwbifC8Rg==", + "dev": true, + "requires": { + "@babel/code-frame": "^7.0.0", + "error-ex": "^1.3.1", + "json-parse-even-better-errors": "^2.3.0", + "lines-and-columns": "^1.1.6" + } + }, + "parse5": { + "version": "6.0.1", + "resolved": "https://registry.npmjs.org/parse5/-/parse5-6.0.1.tgz", + "integrity": "sha512-Ofn/CTFzRGTTxwpNEs9PP93gXShHcTq255nzRYSKe8AkVpZY7e1fpmTfOyoIvjP5HG7Z2ZM7VS9PPhQGW2pOpw==", + "dev": true + }, + "path-exists": { + "version": "4.0.0", + "resolved": "https://registry.npmjs.org/path-exists/-/path-exists-4.0.0.tgz", + "integrity": "sha512-ak9Qy5Q7jYb2Wwcey5Fpvg2KoAc/ZIhLSLOSBmRmygPsGwkVVt0fZa0qrtMz+m6tJTAHfZQ8FnmB4MG4LWy7/w==", + "dev": true + }, + "picomatch": { + "version": "2.2.3", + "resolved": "https://registry.npmjs.org/picomatch/-/picomatch-2.2.3.tgz", + "integrity": "sha512-KpELjfwcCDUb9PeigTs2mBJzXUPzAuP2oPcA989He8Rte0+YUAjw1JVedDhuTKPkHjSYzMN3npC9luThGYEKdg==", + "dev": true + }, + "pretty-format": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/pretty-format/-/pretty-format-26.6.2.tgz", + "integrity": "sha512-7AeGuCYNGmycyQbCqd/3PWH4eOoX/OiCa0uphp57NVTeAGdJGaAliecxwBDHYQCIvrW7aDBZCYeNTP/WX69mkg==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "ansi-regex": "^5.0.0", + "ansi-styles": "^4.0.0", + "react-is": "^17.0.1" + } + }, + "react-is": { + "version": "17.0.2", + "resolved": "https://registry.npmjs.org/react-is/-/react-is-17.0.2.tgz", + "integrity": "sha512-w2GsyukL62IJnlaff/nRegPQR94C/XXamvMWmSHRJ4y7Ts/4ocGRmTHvOs8PSE6pB3dWOrD/nueuU5sduBsQ4w==", + "dev": true + }, + "read-pkg": { + "version": "5.2.0", + "resolved": "https://registry.npmjs.org/read-pkg/-/read-pkg-5.2.0.tgz", + "integrity": "sha512-Ug69mNOpfvKDAc2Q8DRpMjjzdtrnv9HcSMX+4VsZxD1aZ6ZzrIE7rlzXBtWTyhULSMKg076AW6WR5iZpD0JiOg==", + "dev": true, + "requires": { + "@types/normalize-package-data": "^2.4.0", + "normalize-package-data": "^2.5.0", + "parse-json": "^5.0.0", + "type-fest": "^0.6.0" + }, + "dependencies": { + "type-fest": { + "version": "0.6.0", + "resolved": "https://registry.npmjs.org/type-fest/-/type-fest-0.6.0.tgz", + "integrity": "sha512-q+MB8nYR1KDLrgr4G5yemftpMC7/QLqVndBmEEdqzmNj5dcFOO4Oo8qlwZE3ULT3+Zim1F8Kq4cBnikNhlCMlg==", + "dev": true + } + } + }, + "read-pkg-up": { + "version": "7.0.1", + "resolved": "https://registry.npmjs.org/read-pkg-up/-/read-pkg-up-7.0.1.tgz", + "integrity": "sha512-zK0TB7Xd6JpCLmlLmufqykGE+/TlOePD6qKClNW7hHDKFh/J7/7gCWGR7joEQEW1bKq3a3yUZSObOoWLFQ4ohg==", + "dev": true, + "requires": { + "find-up": "^4.1.0", + "read-pkg": "^5.2.0", + "type-fest": "^0.8.1" + } + }, + "saxes": { + "version": "5.0.1", + "resolved": "https://registry.npmjs.org/saxes/-/saxes-5.0.1.tgz", + "integrity": "sha512-5LBh1Tls8c9xgGjw3QrMwETmTMVk0oFgvrFSvWx62llR2hcEInrKNZ2GZCCuuy2lvWrdl5jhbpeqc5hRYKFOcw==", + "dev": true, + "requires": { + "xmlchars": "^2.2.0" + } + }, + "semver": { + "version": "6.3.0", + "resolved": "https://registry.npmjs.org/semver/-/semver-6.3.0.tgz", + "integrity": "sha512-b39TBaTSfV6yBrapU89p5fKekE2m/NwnDocOVruQFS1/veMgdzuPcnOM34M6CwxW8jH/lxEa5rBoDeUwu5HHTw==", + "dev": true + }, + "slash": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/slash/-/slash-3.0.0.tgz", + "integrity": "sha512-g9Q1haeby36OSStwb4ntCGGGaKsaVSjQ68fBxoQcutl5fS1vuY18H3wSt3jFyFtrkx+Kz0V1G85A4MyAdDMi2Q==", + "dev": true + }, + "source-map": { + "version": "0.6.1", + "resolved": "https://registry.npmjs.org/source-map/-/source-map-0.6.1.tgz", + "integrity": "sha512-UjgapumWlbMhkBgzT7Ykc5YXUT46F0iKu8SGXq0bcwP5dz/h0Plj6enJqjz1Zbq2l5WaqYnrVbwWOWMyF3F47g==", + "dev": true + }, + "stack-utils": { + "version": "2.0.3", + "resolved": "https://registry.npmjs.org/stack-utils/-/stack-utils-2.0.3.tgz", + "integrity": "sha512-gL//fkxfWUsIlFL2Tl42Cl6+HFALEaB1FU76I/Fy+oZjRreP7OPMXFlGbxM7NQsI0ZpUfw76sHnv0WNYuTb7Iw==", + "dev": true, + "requires": { + "escape-string-regexp": "^2.0.0" + } + }, + "string-width": { + "version": "4.2.2", + "resolved": "https://registry.npmjs.org/string-width/-/string-width-4.2.2.tgz", + "integrity": "sha512-XBJbT3N4JhVumXE0eoLU9DCjcaF92KLNqTmFCnG1pf8duUxFGwtP6AD6nkjw9a3IdiRtL3E2w3JDiE/xi3vOeA==", + "dev": true, + "requires": { + "emoji-regex": "^8.0.0", + "is-fullwidth-code-point": "^3.0.0", + "strip-ansi": "^6.0.0" + } + }, + "strip-ansi": { + "version": "6.0.0", + "resolved": "https://registry.npmjs.org/strip-ansi/-/strip-ansi-6.0.0.tgz", + "integrity": "sha512-AuvKTrTfQNYNIctbR1K/YGTR1756GycPsg7b9bdV9Duqur4gv6aKqHXah67Z8ImS7WEz5QVcOtlfW2rZEugt6w==", + "dev": true, + "requires": { + "ansi-regex": "^5.0.0" + } + }, + "strip-bom": { + "version": "4.0.0", + "resolved": "https://registry.npmjs.org/strip-bom/-/strip-bom-4.0.0.tgz", + "integrity": "sha512-3xurFv5tEgii33Zi8Jtp55wEIILR9eh34FAW00PZf+JnSsTmV/ioewSgQl97JHvgjoRGwPShsWm+IdrxB35d0w==", + "dev": true + }, + "supports-color": { + "version": "7.2.0", + "resolved": "https://registry.npmjs.org/supports-color/-/supports-color-7.2.0.tgz", + "integrity": "sha512-qpCAvRl9stuOHveKsn7HncJRvv501qIacKzQlO/+Lwxc9+0q2wLyv4Dfvt80/DPn2pqOBsJdDiogXGR9+OvwRw==", + "dev": true, + "requires": { + "has-flag": "^4.0.0" + } + }, + "test-exclude": { + "version": "6.0.0", + "resolved": "https://registry.npmjs.org/test-exclude/-/test-exclude-6.0.0.tgz", + "integrity": "sha512-cAGWPIyOHU6zlmg88jwm7VRyXnMN7iV68OGAbYDk/Mh/xC/pzVPlQtY6ngoIH/5/tciuhGfvESU8GrHrcxD56w==", + "dev": true, + "requires": { + "@istanbuljs/schema": "^0.1.2", + "glob": "^7.1.4", + "minimatch": "^3.0.4" + } + }, + "throat": { + "version": "5.0.0", + "resolved": "https://registry.npmjs.org/throat/-/throat-5.0.0.tgz", + "integrity": "sha512-fcwX4mndzpLQKBS1DVYhGAcYaYt7vsHNIvQV+WXMvnow5cgjPphq5CaayLaGsjRdSCKZFNGt7/GYAuXaNOiYCA==", + "dev": true + }, + "to-regex-range": { + "version": "5.0.1", + "resolved": "https://registry.npmjs.org/to-regex-range/-/to-regex-range-5.0.1.tgz", + "integrity": "sha512-65P7iz6X5yEr1cwcgvQxbbIw7Uk3gOy5dIdtZ4rDveLqhrdJP+Li/Hx6tyK0NEb+2GCyneCMJiGqrADCSNk8sQ==", + "dev": true, + "requires": { + "is-number": "^7.0.0" + } + }, + "tough-cookie": { + "version": "4.0.0", + "resolved": "https://registry.npmjs.org/tough-cookie/-/tough-cookie-4.0.0.tgz", + "integrity": "sha512-tHdtEpQCMrc1YLrMaqXXcj6AxhYi/xgit6mZu1+EDWUn+qhUf8wMQoFIy9NXuq23zAwtcB0t/MjACGR18pcRbg==", + "dev": true, + "requires": { + "psl": "^1.1.33", + "punycode": "^2.1.1", + "universalify": "^0.1.2" + } + }, + "tr46": { + "version": "2.0.2", + "resolved": "https://registry.npmjs.org/tr46/-/tr46-2.0.2.tgz", + "integrity": "sha512-3n1qG+/5kg+jrbTzwAykB5yRYtQCTqOGKq5U5PE3b0a1/mzo6snDhjGS0zJVJunO0NrT3Dg1MLy5TjWP/UJppg==", + "dev": true, + "requires": { + "punycode": "^2.1.1" + } + }, + "w3c-xmlserializer": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/w3c-xmlserializer/-/w3c-xmlserializer-2.0.0.tgz", + "integrity": "sha512-4tzD0mF8iSiMiNs30BiLO3EpfGLZUT2MSX/G+o7ZywDzliWQ3OPtTZ0PTC3B3ca1UAf4cJMHB+2Bf56EriJuRA==", + "dev": true, + "requires": { + "xml-name-validator": "^3.0.0" + } + }, + "webidl-conversions": { + "version": "6.1.0", + "resolved": "https://registry.npmjs.org/webidl-conversions/-/webidl-conversions-6.1.0.tgz", + "integrity": "sha512-qBIvFLGiBpLjfwmYAaHPXsn+ho5xZnGvyGvsarywGNc8VyQJUMHJ8OBKGGrPER0okBeMDaan4mNBlgBROxuI8w==", + "dev": true + }, + "whatwg-url": { + "version": "8.5.0", + "resolved": "https://registry.npmjs.org/whatwg-url/-/whatwg-url-8.5.0.tgz", + "integrity": "sha512-fy+R77xWv0AiqfLl4nuGUlQ3/6b5uNfQ4WAbGQVMYshCTCCPK9psC1nWh3XHuxGVCtlcDDQPQW1csmmIQo+fwg==", + "dev": true, + "requires": { + "lodash": "^4.7.0", + "tr46": "^2.0.2", + "webidl-conversions": "^6.1.0" + } + }, + "wrap-ansi": { + "version": "6.2.0", + "resolved": "https://registry.npmjs.org/wrap-ansi/-/wrap-ansi-6.2.0.tgz", + "integrity": "sha512-r6lPcBGxZXlIcymEu7InxDMhdW0KDxpLgoFLcguasxCaJ/SOIZwINatK9KY/tf+ZrlywOKU0UDj3ATXUBfxJXA==", + "dev": true, + "requires": { + "ansi-styles": "^4.0.0", + "string-width": "^4.1.0", + "strip-ansi": "^6.0.0" + } + }, + "write-file-atomic": { + "version": "3.0.3", + "resolved": "https://registry.npmjs.org/write-file-atomic/-/write-file-atomic-3.0.3.tgz", + "integrity": "sha512-AvHcyZ5JnSfq3ioSyjrBkH9yW4m7Ayk8/9My/DD9onKeu/94fwrMocemO2QAJFAlnnDN+ZDS+ZjAR5ua1/PV/Q==", + "dev": true, + "requires": { + "imurmurhash": "^0.1.4", + "is-typedarray": "^1.0.0", + "signal-exit": "^3.0.2", + "typedarray-to-buffer": "^3.1.5" + } + }, + "ws": { + "version": "7.4.5", + "resolved": "https://registry.npmjs.org/ws/-/ws-7.4.5.tgz", + "integrity": "sha512-xzyu3hFvomRfXKH8vOFMU3OguG6oOvhXMo3xsGy3xWExqaM2dxBbVxuD99O7m3ZUFMvvscsZDqxfgMaRr/Nr1g==", + "dev": true + }, + "yargs": { + "version": "15.4.1", + "resolved": "https://registry.npmjs.org/yargs/-/yargs-15.4.1.tgz", + "integrity": "sha512-aePbxDmcYW++PaqBsJ+HYUFwCdv4LVvdnhBy78E57PIor8/OVvhMrADFFEDh8DHDFRv/O9i3lPhsENjO7QX0+A==", + "dev": true, + "requires": { + "cliui": "^6.0.0", + "decamelize": "^1.2.0", + "find-up": "^4.1.0", + "get-caller-file": "^2.0.1", + "require-directory": "^2.1.1", + "require-main-filename": "^2.0.0", + "set-blocking": "^2.0.0", + "string-width": "^4.2.0", + "which-module": "^2.0.0", + "y18n": "^4.0.0", + "yargs-parser": "^18.1.2" + } + }, + "yargs-parser": { + "version": "18.1.3", + "resolved": "https://registry.npmjs.org/yargs-parser/-/yargs-parser-18.1.3.tgz", + "integrity": "sha512-o50j0JeToy/4K6OZcaQmW6lyXXKhq7csREXcDwk2omFPJEwUNOVtJKvmDr9EI1fAJZUyZcRF7kxGBWmRXudrCQ==", + "dev": true, + "requires": { + "camelcase": "^5.0.0", + "decamelize": "^1.2.0" + }, + "dependencies": { + "camelcase": { + "version": "5.3.1", + "resolved": "https://registry.npmjs.org/camelcase/-/camelcase-5.3.1.tgz", + "integrity": "sha512-L28STB170nwWS63UjtlEOE3dldQApaJXZkOI1uMFfzf3rRuPegHaHesyee+YxQ+W6SvRDQV6UrdOdRiR153wJg==", + "dev": true + } + } + } + } + }, "jest-config": { "version": "24.9.0", "resolved": "https://registry.npmjs.org/jest-config/-/jest-config-24.9.0.tgz", @@ -14101,85 +16278,6 @@ } } }, - "jest-dev-server": { - "version": "4.4.0", - "resolved": "https://registry.npmjs.org/jest-dev-server/-/jest-dev-server-4.4.0.tgz", - "integrity": "sha512-STEHJ3iPSC8HbrQ3TME0ozGX2KT28lbT4XopPxUm2WimsX3fcB3YOptRh12YphQisMhfqNSNTZUmWyT3HEXS2A==", - "dev": true, - "requires": { - "chalk": "^3.0.0", - "cwd": "^0.10.0", - "find-process": "^1.4.3", - "prompts": "^2.3.0", - "spawnd": "^4.4.0", - "tree-kill": "^1.2.2", - "wait-on": "^3.3.0" - }, - "dependencies": { - "ansi-styles": { - "version": "4.3.0", - "resolved": "https://registry.npmjs.org/ansi-styles/-/ansi-styles-4.3.0.tgz", - "integrity": "sha512-zbB9rCJAT1rbjiVDb2hqKFHNYLxgtk8NURxZ3IZwD3F6NtxbXZQCnnSi1Lkx+IDohdPlFp222wVALIheZJQSEg==", - "dev": true, - "requires": { - "color-convert": "^2.0.1" - } - }, - "chalk": { - "version": "3.0.0", - "resolved": "https://registry.npmjs.org/chalk/-/chalk-3.0.0.tgz", - "integrity": "sha512-4D3B6Wf41KOYRFdszmDqMCGq5VV/uMAB273JILmO+3jAlh8X4qDtdtgCR3fxtbLEMzSx22QdhnDcJvu2u1fVwg==", - "dev": true, - "requires": { - "ansi-styles": "^4.1.0", - "supports-color": "^7.1.0" - } - }, - "color-convert": { - "version": "2.0.1", - "resolved": "https://registry.npmjs.org/color-convert/-/color-convert-2.0.1.tgz", - "integrity": "sha512-RRECPsj7iu/xb5oKYcsFHSppFNnsj/52OVTRKb4zP5onXwVF3zVmmToNcOfGC+CRDpfK/U584fMg38ZHCaElKQ==", - "dev": true, - "requires": { - "color-name": "~1.1.4" - } - }, - "color-name": { - "version": "1.1.4", - "resolved": "https://registry.npmjs.org/color-name/-/color-name-1.1.4.tgz", - "integrity": "sha512-dOy+3AuW3a2wNbZHIuMZpTcgjGuLU/uBL/ubcZF9OXbDo8ff4O8yVp5Bf0efS8uEoYo5q4Fx7dY9OgQGXgAsQA==", - "dev": true - }, - "has-flag": { - "version": "4.0.0", - "resolved": "https://registry.npmjs.org/has-flag/-/has-flag-4.0.0.tgz", - "integrity": "sha512-EykJT/Q1KjTWctppgIAgfSO0tKVuZUjhgMr17kqTumMl6Afv3EISleU7qZUzoXDFTAHTDC4NOoG/ZxU3EvlMPQ==", - "dev": true - }, - "supports-color": { - "version": "7.2.0", - "resolved": "https://registry.npmjs.org/supports-color/-/supports-color-7.2.0.tgz", - "integrity": "sha512-qpCAvRl9stuOHveKsn7HncJRvv501qIacKzQlO/+Lwxc9+0q2wLyv4Dfvt80/DPn2pqOBsJdDiogXGR9+OvwRw==", - "dev": true, - "requires": { - "has-flag": "^4.0.0" - } - }, - "wait-on": { - "version": "3.3.0", - "resolved": "https://registry.npmjs.org/wait-on/-/wait-on-3.3.0.tgz", - "integrity": "sha512-97dEuUapx4+Y12aknWZn7D25kkjMk16PbWoYzpSdA8bYpVfS6hpl2a2pOWZ3c+Tyt3/i4/pglyZctG3J4V1hWQ==", - "dev": true, - "requires": { - "@hapi/joi": "^15.0.3", - "core-js": "^2.6.5", - "minimist": "^1.2.0", - "request": "^2.88.0", - "rx": "^4.1.0" - } - } - } - }, "jest-diff": { "version": "24.9.0", "resolved": "https://registry.npmjs.org/jest-diff/-/jest-diff-24.9.0.tgz", @@ -14236,69 +16334,6 @@ "jest-util": "^24.9.0" } }, - "jest-environment-puppeteer": { - "version": "4.4.0", - "resolved": "https://registry.npmjs.org/jest-environment-puppeteer/-/jest-environment-puppeteer-4.4.0.tgz", - "integrity": "sha512-iV8S8+6qkdTM6OBR/M9gKywEk8GDSOe05hspCs5D8qKSwtmlUfdtHfB4cakdc68lC6YfK3AUsLirpfgodCHjzQ==", - "dev": true, - "requires": { - "chalk": "^3.0.0", - "cwd": "^0.10.0", - "jest-dev-server": "^4.4.0", - "merge-deep": "^3.0.2" - }, - "dependencies": { - "ansi-styles": { - "version": "4.3.0", - "resolved": "https://registry.npmjs.org/ansi-styles/-/ansi-styles-4.3.0.tgz", - "integrity": "sha512-zbB9rCJAT1rbjiVDb2hqKFHNYLxgtk8NURxZ3IZwD3F6NtxbXZQCnnSi1Lkx+IDohdPlFp222wVALIheZJQSEg==", - "dev": true, - "requires": { - "color-convert": "^2.0.1" - } - }, - "chalk": { - "version": "3.0.0", - "resolved": "https://registry.npmjs.org/chalk/-/chalk-3.0.0.tgz", - "integrity": "sha512-4D3B6Wf41KOYRFdszmDqMCGq5VV/uMAB273JILmO+3jAlh8X4qDtdtgCR3fxtbLEMzSx22QdhnDcJvu2u1fVwg==", - "dev": true, - "requires": { - "ansi-styles": "^4.1.0", - "supports-color": "^7.1.0" - } - }, - "color-convert": { - "version": "2.0.1", - "resolved": "https://registry.npmjs.org/color-convert/-/color-convert-2.0.1.tgz", - "integrity": "sha512-RRECPsj7iu/xb5oKYcsFHSppFNnsj/52OVTRKb4zP5onXwVF3zVmmToNcOfGC+CRDpfK/U584fMg38ZHCaElKQ==", - "dev": true, - "requires": { - "color-name": "~1.1.4" - } - }, - "color-name": { - "version": "1.1.4", - "resolved": "https://registry.npmjs.org/color-name/-/color-name-1.1.4.tgz", - "integrity": "sha512-dOy+3AuW3a2wNbZHIuMZpTcgjGuLU/uBL/ubcZF9OXbDo8ff4O8yVp5Bf0efS8uEoYo5q4Fx7dY9OgQGXgAsQA==", - "dev": true - }, - "has-flag": { - "version": "4.0.0", - "resolved": "https://registry.npmjs.org/has-flag/-/has-flag-4.0.0.tgz", - "integrity": "sha512-EykJT/Q1KjTWctppgIAgfSO0tKVuZUjhgMr17kqTumMl6Afv3EISleU7qZUzoXDFTAHTDC4NOoG/ZxU3EvlMPQ==", - "dev": true - }, - "supports-color": { - "version": "7.2.0", - "resolved": "https://registry.npmjs.org/supports-color/-/supports-color-7.2.0.tgz", - "integrity": "sha512-qpCAvRl9stuOHveKsn7HncJRvv501qIacKzQlO/+Lwxc9+0q2wLyv4Dfvt80/DPn2pqOBsJdDiogXGR9+OvwRw==", - "dev": true, - "requires": { - "has-flag": "^4.0.0" - } - } - } - }, "jest-get-type": { "version": "24.9.0", "resolved": "https://registry.npmjs.org/jest-get-type/-/jest-get-type-24.9.0.tgz", @@ -14389,19 +16424,1378 @@ "@jest/types": "^24.9.0" } }, + "jest-playwright-preset": { + "version": "1.5.1", + "resolved": "https://registry.npmjs.org/jest-playwright-preset/-/jest-playwright-preset-1.5.1.tgz", + "integrity": "sha512-zsFAe61V72vSLkd1fCcf7YbHmbdAB82SLBdUuCUF43aODIojshQEDF88KdWL9P+4JQ+DvEABT+6sFX4sY0rR2w==", + "dev": true, + "requires": { + "expect-playwright": "^0.3.3", + "jest-circus": "^26.6.3", + "jest-environment-node": "^26.6.2", + "jest-process-manager": "^0.2.9", + "jest-runner": "^26.6.3", + "nyc": "^15.1.0", + "playwright-core": ">=1.2.0", + "rimraf": "^3.0.2", + "uuid": "^8.3.2" + }, + "dependencies": { + "@jest/console": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/@jest/console/-/console-26.6.2.tgz", + "integrity": "sha512-IY1R2i2aLsLr7Id3S6p2BA82GNWryt4oSvEXLAKc+L2zdi89dSkE8xC1C+0kpATG4JhBJREnQOH7/zmccM2B0g==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "@types/node": "*", + "chalk": "^4.0.0", + "jest-message-util": "^26.6.2", + "jest-util": "^26.6.2", + "slash": "^3.0.0" + } + }, + "@jest/environment": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/@jest/environment/-/environment-26.6.2.tgz", + "integrity": "sha512-nFy+fHl28zUrRsCeMB61VDThV1pVTtlEokBRgqPrcT1JNq4yRNIyTHfyht6PqtUvY9IsuLGTrbG8kPXjSZIZwA==", + "dev": true, + "requires": { + "@jest/fake-timers": "^26.6.2", + "@jest/types": "^26.6.2", + "@types/node": "*", + "jest-mock": "^26.6.2" + } + }, + "@jest/fake-timers": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/@jest/fake-timers/-/fake-timers-26.6.2.tgz", + "integrity": "sha512-14Uleatt7jdzefLPYM3KLcnUl1ZNikaKq34enpb5XG9i81JpppDb5muZvonvKyrl7ftEHkKS5L5/eB/kxJ+bvA==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "@sinonjs/fake-timers": "^6.0.1", + "@types/node": "*", + "jest-message-util": "^26.6.2", + "jest-mock": "^26.6.2", + "jest-util": "^26.6.2" + } + }, + "@jest/globals": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/@jest/globals/-/globals-26.6.2.tgz", + "integrity": "sha512-85Ltnm7HlB/KesBUuALwQ68YTU72w9H2xW9FjZ1eL1U3lhtefjjl5c2MiUbpXt/i6LaPRvoOFJ22yCBSfQ0JIA==", + "dev": true, + "requires": { + "@jest/environment": "^26.6.2", + "@jest/types": "^26.6.2", + "expect": "^26.6.2" + } + }, + "@jest/source-map": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/@jest/source-map/-/source-map-26.6.2.tgz", + "integrity": "sha512-YwYcCwAnNmOVsZ8mr3GfnzdXDAl4LaenZP5z+G0c8bzC9/dugL8zRmxZzdoTl4IaS3CryS1uWnROLPFmb6lVvA==", + "dev": true, + "requires": { + "callsites": "^3.0.0", + "graceful-fs": "^4.2.4", + "source-map": "^0.6.0" + } + }, + "@jest/test-result": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/@jest/test-result/-/test-result-26.6.2.tgz", + "integrity": "sha512-5O7H5c/7YlojphYNrK02LlDIV2GNPYisKwHm2QTKjNZeEzezCbwYs9swJySv2UfPMyZ0VdsmMv7jIlD/IKYQpQ==", + "dev": true, + "requires": { + "@jest/console": "^26.6.2", + "@jest/types": "^26.6.2", + "@types/istanbul-lib-coverage": "^2.0.0", + "collect-v8-coverage": "^1.0.0" + } + }, + "@jest/test-sequencer": { + "version": "26.6.3", + "resolved": "https://registry.npmjs.org/@jest/test-sequencer/-/test-sequencer-26.6.3.tgz", + "integrity": "sha512-YHlVIjP5nfEyjlrSr8t/YdNfU/1XEt7c5b4OxcXCjyRhjzLYu/rO69/WHPuYcbCWkz8kAeZVZp2N2+IOLLEPGw==", + "dev": true, + "requires": { + "@jest/test-result": "^26.6.2", + "graceful-fs": "^4.2.4", + "jest-haste-map": "^26.6.2", + "jest-runner": "^26.6.3", + "jest-runtime": "^26.6.3" + } + }, + "@jest/transform": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/@jest/transform/-/transform-26.6.2.tgz", + "integrity": "sha512-E9JjhUgNzvuQ+vVAL21vlyfy12gP0GhazGgJC4h6qUt1jSdUXGWJ1wfu/X7Sd8etSgxV4ovT1pb9v5D6QW4XgA==", + "dev": true, + "requires": { + "@babel/core": "^7.1.0", + "@jest/types": "^26.6.2", + "babel-plugin-istanbul": "^6.0.0", + "chalk": "^4.0.0", + "convert-source-map": "^1.4.0", + "fast-json-stable-stringify": "^2.0.0", + "graceful-fs": "^4.2.4", + "jest-haste-map": "^26.6.2", + "jest-regex-util": "^26.0.0", + "jest-util": "^26.6.2", + "micromatch": "^4.0.2", + "pirates": "^4.0.1", + "slash": "^3.0.0", + "source-map": "^0.6.1", + "write-file-atomic": "^3.0.0" + } + }, + "@jest/types": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/@jest/types/-/types-26.6.2.tgz", + "integrity": "sha512-fC6QCp7Sc5sX6g8Tvbmj4XUTbyrik0akgRy03yjXbQaBWWNWGE7SGtJk98m0N8nzegD/7SggrUlivxo5ax4KWQ==", + "dev": true, + "requires": { + "@types/istanbul-lib-coverage": "^2.0.0", + "@types/istanbul-reports": "^3.0.0", + "@types/node": "*", + "@types/yargs": "^15.0.0", + "chalk": "^4.0.0" + } + }, + "@types/istanbul-reports": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/@types/istanbul-reports/-/istanbul-reports-3.0.0.tgz", + "integrity": "sha512-nwKNbvnwJ2/mndE9ItP/zc2TCzw6uuodnF4EHYWD+gCQDVBuRQL5UzbZD0/ezy1iKsFU2ZQiDqg4M9dN4+wZgA==", + "dev": true, + "requires": { + "@types/istanbul-lib-report": "*" + } + }, + "@types/prettier": { + "version": "2.2.3", + "resolved": "https://registry.npmjs.org/@types/prettier/-/prettier-2.2.3.tgz", + "integrity": "sha512-PijRCG/K3s3w1We6ynUKdxEc5AcuuH3NBmMDP8uvKVp6X43UY7NQlTzczakXP3DJR0F4dfNQIGjU2cUeRYs2AA==", + "dev": true + }, + "@types/stack-utils": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/@types/stack-utils/-/stack-utils-2.0.0.tgz", + "integrity": "sha512-RJJrrySY7A8havqpGObOB4W92QXKJo63/jFLLgpvOtsGUqbQZ9Sbgl35KMm1DjC6j7AvmmU2bIno+3IyEaemaw==", + "dev": true + }, + "@types/yargs": { + "version": "15.0.13", + "resolved": "https://registry.npmjs.org/@types/yargs/-/yargs-15.0.13.tgz", + "integrity": "sha512-kQ5JNTrbDv3Rp5X2n/iUu37IJBDU2gsZ5R/g1/KHOOEc5IKfUFjXT6DENPGduh08I/pamwtEq4oul7gUqKTQDQ==", + "dev": true, + "requires": { + "@types/yargs-parser": "*" + } + }, + "acorn": { + "version": "8.1.1", + "resolved": "https://registry.npmjs.org/acorn/-/acorn-8.1.1.tgz", + "integrity": "sha512-xYiIVjNuqtKXMxlRMDc6mZUhXehod4a3gbZ1qRlM7icK4EbxUFNLhWoPblCvFtB2Y9CIqHP3CF/rdxLItaQv8g==", + "dev": true + }, + "acorn-globals": { + "version": "6.0.0", + "resolved": "https://registry.npmjs.org/acorn-globals/-/acorn-globals-6.0.0.tgz", + "integrity": "sha512-ZQl7LOWaF5ePqqcX4hLuv/bLXYQNfNWw2c0/yX/TsPRKamzHcTGQnlCjHT3TsmkOUVEPS3crCxiPfdzE/Trlhg==", + "dev": true, + "requires": { + "acorn": "^7.1.1", + "acorn-walk": "^7.1.1" + }, + "dependencies": { + "acorn": { + "version": "7.4.1", + "resolved": "https://registry.npmjs.org/acorn/-/acorn-7.4.1.tgz", + "integrity": "sha512-nQyp0o1/mNdbTO1PO6kHkwSrmgZ0MT/jCCpNiwbUjGoRN4dlBhqJtoQuCnEOKzgTVwg0ZWiCoQy6SxMebQVh8A==", + "dev": true + } + } + }, + "acorn-walk": { + "version": "7.2.0", + "resolved": "https://registry.npmjs.org/acorn-walk/-/acorn-walk-7.2.0.tgz", + "integrity": "sha512-OPdCF6GsMIP+Az+aWfAAOEt2/+iVDKE7oy6lJ098aoe59oAmK76qV6Gw60SbZ8jHuG2wH058GF4pLFbYamYrVA==", + "dev": true + }, + "ansi-regex": { + "version": "5.0.0", + "resolved": "https://registry.npmjs.org/ansi-regex/-/ansi-regex-5.0.0.tgz", + "integrity": "sha512-bY6fj56OUQ0hU1KjFNDQuJFezqKdrAyFdIevADiqrWHwSlbmBNMHp5ak2f40Pm8JTFyM2mqxkG6ngkHO11f/lg==", + "dev": true + }, + "ansi-styles": { + "version": "4.3.0", + "resolved": "https://registry.npmjs.org/ansi-styles/-/ansi-styles-4.3.0.tgz", + "integrity": "sha512-zbB9rCJAT1rbjiVDb2hqKFHNYLxgtk8NURxZ3IZwD3F6NtxbXZQCnnSi1Lkx+IDohdPlFp222wVALIheZJQSEg==", + "dev": true, + "requires": { + "color-convert": "^2.0.1" + } + }, + "anymatch": { + "version": "3.1.2", + "resolved": "https://registry.npmjs.org/anymatch/-/anymatch-3.1.2.tgz", + "integrity": "sha512-P43ePfOAIupkguHUycrc4qJ9kz8ZiuOUijaETwX7THt0Y/GNK7v0aa8rY816xWjZ7rJdA5XdMcpVFTKMq+RvWg==", + "dev": true, + "requires": { + "normalize-path": "^3.0.0", + "picomatch": "^2.0.4" + } + }, + "babel-jest": { + "version": "26.6.3", + "resolved": "https://registry.npmjs.org/babel-jest/-/babel-jest-26.6.3.tgz", + "integrity": "sha512-pl4Q+GAVOHwvjrck6jKjvmGhnO3jHX/xuB9d27f+EJZ/6k+6nMuPjorrYp7s++bKKdANwzElBWnLWaObvTnaZA==", + "dev": true, + "requires": { + "@jest/transform": "^26.6.2", + "@jest/types": "^26.6.2", + "@types/babel__core": "^7.1.7", + "babel-plugin-istanbul": "^6.0.0", + "babel-preset-jest": "^26.6.2", + "chalk": "^4.0.0", + "graceful-fs": "^4.2.4", + "slash": "^3.0.0" + } + }, + "babel-plugin-istanbul": { + "version": "6.0.0", + "resolved": "https://registry.npmjs.org/babel-plugin-istanbul/-/babel-plugin-istanbul-6.0.0.tgz", + "integrity": "sha512-AF55rZXpe7trmEylbaE1Gv54wn6rwU03aptvRoVIGP8YykoSxqdVLV1TfwflBCE/QtHmqtP8SWlTENqbK8GCSQ==", + "dev": true, + "requires": { + "@babel/helper-plugin-utils": "^7.0.0", + "@istanbuljs/load-nyc-config": "^1.0.0", + "@istanbuljs/schema": "^0.1.2", + "istanbul-lib-instrument": "^4.0.0", + "test-exclude": "^6.0.0" + } + }, + "babel-plugin-jest-hoist": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/babel-plugin-jest-hoist/-/babel-plugin-jest-hoist-26.6.2.tgz", + "integrity": "sha512-PO9t0697lNTmcEHH69mdtYiOIkkOlj9fySqfO3K1eCcdISevLAE0xY59VLLUj0SoiPiTX/JU2CYFpILydUa5Lw==", + "dev": true, + "requires": { + "@babel/template": "^7.3.3", + "@babel/types": "^7.3.3", + "@types/babel__core": "^7.0.0", + "@types/babel__traverse": "^7.0.6" + } + }, + "babel-preset-current-node-syntax": { + "version": "1.0.1", + "resolved": "https://registry.npmjs.org/babel-preset-current-node-syntax/-/babel-preset-current-node-syntax-1.0.1.tgz", + "integrity": "sha512-M7LQ0bxarkxQoN+vz5aJPsLBn77n8QgTFmo8WK0/44auK2xlCXrYcUxHFxgU7qW5Yzw/CjmLRK2uJzaCd7LvqQ==", + "dev": true, + "requires": { + "@babel/plugin-syntax-async-generators": "^7.8.4", + "@babel/plugin-syntax-bigint": "^7.8.3", + "@babel/plugin-syntax-class-properties": "^7.8.3", + "@babel/plugin-syntax-import-meta": "^7.8.3", + "@babel/plugin-syntax-json-strings": "^7.8.3", + "@babel/plugin-syntax-logical-assignment-operators": "^7.8.3", + "@babel/plugin-syntax-nullish-coalescing-operator": "^7.8.3", + "@babel/plugin-syntax-numeric-separator": "^7.8.3", + "@babel/plugin-syntax-object-rest-spread": "^7.8.3", + "@babel/plugin-syntax-optional-catch-binding": "^7.8.3", + "@babel/plugin-syntax-optional-chaining": "^7.8.3", + "@babel/plugin-syntax-top-level-await": "^7.8.3" + } + }, + "babel-preset-jest": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/babel-preset-jest/-/babel-preset-jest-26.6.2.tgz", + "integrity": "sha512-YvdtlVm9t3k777c5NPQIv6cxFFFapys25HiUmuSgHwIZhfifweR5c5Sf5nwE3MAbfu327CYSvps8Yx6ANLyleQ==", + "dev": true, + "requires": { + "babel-plugin-jest-hoist": "^26.6.2", + "babel-preset-current-node-syntax": "^1.0.0" + } + }, + "braces": { + "version": "3.0.2", + "resolved": "https://registry.npmjs.org/braces/-/braces-3.0.2.tgz", + "integrity": "sha512-b8um+L1RzM3WDSzvhm6gIz1yfTbBt6YTlcEKAvsmqCZZFw46z626lVj9j1yEPW33H5H+lBQpZMP1k8l+78Ha0A==", + "dev": true, + "requires": { + "fill-range": "^7.0.1" + } + }, + "camelcase": { + "version": "6.2.0", + "resolved": "https://registry.npmjs.org/camelcase/-/camelcase-6.2.0.tgz", + "integrity": "sha512-c7wVvbw3f37nuobQNtgsgG9POC9qMbNuMQmTCqZv23b6MIz0fcYpBiOlv9gEN/hdLdnZTDQhg6e9Dq5M1vKvfg==", + "dev": true + }, + "chalk": { + "version": "4.1.0", + "resolved": "https://registry.npmjs.org/chalk/-/chalk-4.1.0.tgz", + "integrity": "sha512-qwx12AxXe2Q5xQ43Ac//I6v5aXTipYrSESdOgzrN+9XjgEpyjpKuvSGaN4qE93f7TQTlerQQ8S+EQ0EyDoVL1A==", + "dev": true, + "requires": { + "ansi-styles": "^4.1.0", + "supports-color": "^7.1.0" + } + }, + "cliui": { + "version": "6.0.0", + "resolved": "https://registry.npmjs.org/cliui/-/cliui-6.0.0.tgz", + "integrity": "sha512-t6wbgtoCXvAzst7QgXxJYqPt0usEfbgQdftEPbLL/cvv6HPE5VgvqCuAIDR0NgU52ds6rFwqrgakNLrHEjCbrQ==", + "dev": true, + "requires": { + "string-width": "^4.2.0", + "strip-ansi": "^6.0.0", + "wrap-ansi": "^6.2.0" + } + }, + "color-convert": { + "version": "2.0.1", + "resolved": "https://registry.npmjs.org/color-convert/-/color-convert-2.0.1.tgz", + "integrity": "sha512-RRECPsj7iu/xb5oKYcsFHSppFNnsj/52OVTRKb4zP5onXwVF3zVmmToNcOfGC+CRDpfK/U584fMg38ZHCaElKQ==", + "dev": true, + "requires": { + "color-name": "~1.1.4" + } + }, + "color-name": { + "version": "1.1.4", + "resolved": "https://registry.npmjs.org/color-name/-/color-name-1.1.4.tgz", + "integrity": "sha512-dOy+3AuW3a2wNbZHIuMZpTcgjGuLU/uBL/ubcZF9OXbDo8ff4O8yVp5Bf0efS8uEoYo5q4Fx7dY9OgQGXgAsQA==", + "dev": true + }, + "commander": { + "version": "6.2.1", + "resolved": "https://registry.npmjs.org/commander/-/commander-6.2.1.tgz", + "integrity": "sha512-U7VdrJFnJgo4xjrHpTzu0yrHPGImdsmD95ZlgYSEajAn2JKzDhDTPG9kBTefmObL2w/ngeZnilk+OV9CG3d7UA==", + "dev": true + }, + "cssom": { + "version": "0.4.4", + "resolved": "https://registry.npmjs.org/cssom/-/cssom-0.4.4.tgz", + "integrity": "sha512-p3pvU7r1MyyqbTk+WbNJIgJjG2VmTIaB10rI93LzVPrmDJKkzKYMtxxyAvQXR/NS6otuzveI7+7BBq3SjBS2mw==", + "dev": true + }, + "cssstyle": { + "version": "2.3.0", + "resolved": "https://registry.npmjs.org/cssstyle/-/cssstyle-2.3.0.tgz", + "integrity": "sha512-AZL67abkUzIuvcHqk7c09cezpGNcxUxU4Ioi/05xHk4DQeTkWmGYftIE6ctU6AEt+Gn4n1lDStOtj7FKycP71A==", + "dev": true, + "requires": { + "cssom": "~0.3.6" + }, + "dependencies": { + "cssom": { + "version": "0.3.8", + "resolved": "https://registry.npmjs.org/cssom/-/cssom-0.3.8.tgz", + "integrity": "sha512-b0tGHbfegbhPJpxpiBPU2sCkigAqtM9O121le6bbOlgyV+NyGyCmVfJ6QW9eRjz8CpNfWEOYBIMIGRYkLwsIYg==", + "dev": true + } + } + }, + "data-urls": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/data-urls/-/data-urls-2.0.0.tgz", + "integrity": "sha512-X5eWTSXO/BJmpdIKCRuKUgSCgAN0OwliVK3yPKbwIWU1Tdw5BRajxlzMidvh+gwko9AfQ9zIj52pzF91Q3YAvQ==", + "dev": true, + "requires": { + "abab": "^2.0.3", + "whatwg-mimetype": "^2.3.0", + "whatwg-url": "^8.0.0" + } + }, + "detect-newline": { + "version": "3.1.0", + "resolved": "https://registry.npmjs.org/detect-newline/-/detect-newline-3.1.0.tgz", + "integrity": "sha512-TLz+x/vEXm/Y7P7wn1EJFNLxYpUD4TgMosxY6fAVJUnJMbupHBOncxyWUG9OpTaH9EBD7uFI5LfEgmMOc54DsA==", + "dev": true + }, + "diff-sequences": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/diff-sequences/-/diff-sequences-26.6.2.tgz", + "integrity": "sha512-Mv/TDa3nZ9sbc5soK+OoA74BsS3mL37yixCvUAQkiuA4Wz6YtwP/K47n2rv2ovzHZvoiQeA5FTQOschKkEwB0Q==", + "dev": true + }, + "domexception": { + "version": "2.0.1", + "resolved": "https://registry.npmjs.org/domexception/-/domexception-2.0.1.tgz", + "integrity": "sha512-yxJ2mFy/sibVQlu5qHjOkf9J3K6zgmCxgJ94u2EdvDOV09H+32LtRswEcUsmUWN72pVLOEnTSRaIVVzVQgS0dg==", + "dev": true, + "requires": { + "webidl-conversions": "^5.0.0" + }, + "dependencies": { + "webidl-conversions": { + "version": "5.0.0", + "resolved": "https://registry.npmjs.org/webidl-conversions/-/webidl-conversions-5.0.0.tgz", + "integrity": "sha512-VlZwKPCkYKxQgeSbH5EyngOmRp7Ww7I9rQLERETtf5ofd9pGeswWiOtogpEO850jziPRarreGxn5QIiTqpb2wA==", + "dev": true + } + } + }, + "emoji-regex": { + "version": "8.0.0", + "resolved": "https://registry.npmjs.org/emoji-regex/-/emoji-regex-8.0.0.tgz", + "integrity": "sha512-MSjYzcWNOA0ewAHpz0MxpYFvwg6yjy1NG3xteoqz644VCo/RPgnr1/GGt+ic3iJTzQ8Eu3TdM14SawnVUmGE6A==", + "dev": true + }, + "escape-string-regexp": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/escape-string-regexp/-/escape-string-regexp-2.0.0.tgz", + "integrity": "sha512-UpzcLCXolUWcNu5HtVMHYdXJjArjsF9C0aNnquZYY4uW/Vu0miy5YoWvbV345HauVvcAUnpRuhMMcqTcGOY2+w==", + "dev": true + }, + "escodegen": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/escodegen/-/escodegen-2.0.0.tgz", + "integrity": "sha512-mmHKys/C8BFUGI+MAWNcSYoORYLMdPzjrknd2Vc+bUsjN5bXcr8EhrNB+UTqfL1y3I9c4fw2ihgtMPQLBRiQxw==", + "dev": true, + "requires": { + "esprima": "^4.0.1", + "estraverse": "^5.2.0", + "esutils": "^2.0.2", + "optionator": "^0.8.1", + "source-map": "~0.6.1" + } + }, + "estraverse": { + "version": "5.2.0", + "resolved": "https://registry.npmjs.org/estraverse/-/estraverse-5.2.0.tgz", + "integrity": "sha512-BxbNGGNm0RyRYvUdHpIwv9IWzeM9XClbOxwoATuFdOE7ZE6wHL+HQ5T8hoPM+zHvmKzzsEqhgy0GrQ5X13afiQ==", + "dev": true + }, + "expect": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/expect/-/expect-26.6.2.tgz", + "integrity": "sha512-9/hlOBkQl2l/PLHJx6JjoDF6xPKcJEsUlWKb23rKE7KzeDqUZKXKNMW27KIue5JMdBV9HgmoJPcc8HtO85t9IA==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "ansi-styles": "^4.0.0", + "jest-get-type": "^26.3.0", + "jest-matcher-utils": "^26.6.2", + "jest-message-util": "^26.6.2", + "jest-regex-util": "^26.0.0" + } + }, + "fill-range": { + "version": "7.0.1", + "resolved": "https://registry.npmjs.org/fill-range/-/fill-range-7.0.1.tgz", + "integrity": "sha512-qOo9F+dMUmC2Lcb4BbVvnKJxTPjCm+RRpe4gDuGrzkL7mEVl/djYSu2OdQ2Pa302N4oqkSg9ir6jaLWJ2USVpQ==", + "dev": true, + "requires": { + "to-regex-range": "^5.0.1" + } + }, + "find-up": { + "version": "4.1.0", + "resolved": "https://registry.npmjs.org/find-up/-/find-up-4.1.0.tgz", + "integrity": "sha512-PpOwAdQ/YlXQ2vj8a3h8IipDuYRi3wceVQQGYWxNINccq40Anw7BlsEXCMbt1Zt+OLA6Fq9suIpIWD0OsnISlw==", + "dev": true, + "requires": { + "locate-path": "^5.0.0", + "path-exists": "^4.0.0" + } + }, + "fsevents": { + "version": "2.3.2", + "resolved": "https://registry.npmjs.org/fsevents/-/fsevents-2.3.2.tgz", + "integrity": "sha512-xiqMQR4xAeHTuB9uWm+fFRcIOgKBMiOBP+eXiyT7jsgVCq1bkVygt00oASowB7EdtpOHaaPgKt812P9ab+DDKA==", + "dev": true, + "optional": true + }, + "has-flag": { + "version": "4.0.0", + "resolved": "https://registry.npmjs.org/has-flag/-/has-flag-4.0.0.tgz", + "integrity": "sha512-EykJT/Q1KjTWctppgIAgfSO0tKVuZUjhgMr17kqTumMl6Afv3EISleU7qZUzoXDFTAHTDC4NOoG/ZxU3EvlMPQ==", + "dev": true + }, + "html-encoding-sniffer": { + "version": "2.0.1", + "resolved": "https://registry.npmjs.org/html-encoding-sniffer/-/html-encoding-sniffer-2.0.1.tgz", + "integrity": "sha512-D5JbOMBIR/TVZkubHT+OyT2705QvogUW4IBn6nHd756OwieSF9aDYFj4dv6HHEVGYbHaLETa3WggZYWWMyy3ZQ==", + "dev": true, + "requires": { + "whatwg-encoding": "^1.0.5" + } + }, + "is-fullwidth-code-point": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/is-fullwidth-code-point/-/is-fullwidth-code-point-3.0.0.tgz", + "integrity": "sha512-zymm5+u+sCsSWyD9qNaejV3DFvhCKclKdizYaJUuHA83RLjb7nSuGnddCHGv0hk+KY7BMAlsWeK4Ueg6EV6XQg==", + "dev": true + }, + "is-number": { + "version": "7.0.0", + "resolved": "https://registry.npmjs.org/is-number/-/is-number-7.0.0.tgz", + "integrity": "sha512-41Cifkg6e8TylSpdtTpeLVMqvSBEVzTttHvERD741+pnZ8ANv0004MRL43QKPDlK9cGvNp6NZWZUBlbGXYxxng==", + "dev": true + }, + "istanbul-lib-coverage": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/istanbul-lib-coverage/-/istanbul-lib-coverage-3.0.0.tgz", + "integrity": "sha512-UiUIqxMgRDET6eR+o5HbfRYP1l0hqkWOs7vNxC/mggutCMUIhWMm8gAHb8tHlyfD3/l6rlgNA5cKdDzEAf6hEg==", + "dev": true + }, + "istanbul-lib-instrument": { + "version": "4.0.3", + "resolved": "https://registry.npmjs.org/istanbul-lib-instrument/-/istanbul-lib-instrument-4.0.3.tgz", + "integrity": "sha512-BXgQl9kf4WTCPCCpmFGoJkz/+uhvm7h7PFKUYxh7qarQd3ER33vHG//qaE8eN25l07YqZPpHXU9I09l/RD5aGQ==", + "dev": true, + "requires": { + "@babel/core": "^7.7.5", + "@istanbuljs/schema": "^0.1.2", + "istanbul-lib-coverage": "^3.0.0", + "semver": "^6.3.0" + } + }, + "jest-config": { + "version": "26.6.3", + "resolved": "https://registry.npmjs.org/jest-config/-/jest-config-26.6.3.tgz", + "integrity": "sha512-t5qdIj/bCj2j7NFVHb2nFB4aUdfucDn3JRKgrZnplb8nieAirAzRSHP8uDEd+qV6ygzg9Pz4YG7UTJf94LPSyg==", + "dev": true, + "requires": { + "@babel/core": "^7.1.0", + "@jest/test-sequencer": "^26.6.3", + "@jest/types": "^26.6.2", + "babel-jest": "^26.6.3", + "chalk": "^4.0.0", + "deepmerge": "^4.2.2", + "glob": "^7.1.1", + "graceful-fs": "^4.2.4", + "jest-environment-jsdom": "^26.6.2", + "jest-environment-node": "^26.6.2", + "jest-get-type": "^26.3.0", + "jest-jasmine2": "^26.6.3", + "jest-regex-util": "^26.0.0", + "jest-resolve": "^26.6.2", + "jest-util": "^26.6.2", + "jest-validate": "^26.6.2", + "micromatch": "^4.0.2", + "pretty-format": "^26.6.2" + } + }, + "jest-diff": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-diff/-/jest-diff-26.6.2.tgz", + "integrity": "sha512-6m+9Z3Gv9wN0WFVasqjCL/06+EFCMTqDEUl/b87HYK2rAPTyfz4ZIuSlPhY51PIQRWx5TaxeF1qmXKe9gfN3sA==", + "dev": true, + "requires": { + "chalk": "^4.0.0", + "diff-sequences": "^26.6.2", + "jest-get-type": "^26.3.0", + "pretty-format": "^26.6.2" + } + }, + "jest-docblock": { + "version": "26.0.0", + "resolved": "https://registry.npmjs.org/jest-docblock/-/jest-docblock-26.0.0.tgz", + "integrity": "sha512-RDZ4Iz3QbtRWycd8bUEPxQsTlYazfYn/h5R65Fc6gOfwozFhoImx+affzky/FFBuqISPTqjXomoIGJVKBWoo0w==", + "dev": true, + "requires": { + "detect-newline": "^3.0.0" + } + }, + "jest-each": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-each/-/jest-each-26.6.2.tgz", + "integrity": "sha512-Mer/f0KaATbjl8MCJ+0GEpNdqmnVmDYqCTJYTvoo7rqmRiDllmp2AYN+06F93nXcY3ur9ShIjS+CO/uD+BbH4A==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "chalk": "^4.0.0", + "jest-get-type": "^26.3.0", + "jest-util": "^26.6.2", + "pretty-format": "^26.6.2" + } + }, + "jest-environment-jsdom": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-environment-jsdom/-/jest-environment-jsdom-26.6.2.tgz", + "integrity": "sha512-jgPqCruTlt3Kwqg5/WVFyHIOJHsiAvhcp2qiR2QQstuG9yWox5+iHpU3ZrcBxW14T4fe5Z68jAfLRh7joCSP2Q==", + "dev": true, + "requires": { + "@jest/environment": "^26.6.2", + "@jest/fake-timers": "^26.6.2", + "@jest/types": "^26.6.2", + "@types/node": "*", + "jest-mock": "^26.6.2", + "jest-util": "^26.6.2", + "jsdom": "^16.4.0" + } + }, + "jest-environment-node": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-environment-node/-/jest-environment-node-26.6.2.tgz", + "integrity": "sha512-zhtMio3Exty18dy8ee8eJ9kjnRyZC1N4C1Nt/VShN1apyXc8rWGtJ9lI7vqiWcyyXS4BVSEn9lxAM2D+07/Tag==", + "dev": true, + "requires": { + "@jest/environment": "^26.6.2", + "@jest/fake-timers": "^26.6.2", + "@jest/types": "^26.6.2", + "@types/node": "*", + "jest-mock": "^26.6.2", + "jest-util": "^26.6.2" + } + }, + "jest-get-type": { + "version": "26.3.0", + "resolved": "https://registry.npmjs.org/jest-get-type/-/jest-get-type-26.3.0.tgz", + "integrity": "sha512-TpfaviN1R2pQWkIihlfEanwOXK0zcxrKEE4MlU6Tn7keoXdN6/3gK/xl0yEh8DOunn5pOVGKf8hB4R9gVh04ig==", + "dev": true + }, + "jest-haste-map": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-haste-map/-/jest-haste-map-26.6.2.tgz", + "integrity": "sha512-easWIJXIw71B2RdR8kgqpjQrbMRWQBgiBwXYEhtGUTaX+doCjBheluShdDMeR8IMfJiTqH4+zfhtg29apJf/8w==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "@types/graceful-fs": "^4.1.2", + "@types/node": "*", + "anymatch": "^3.0.3", + "fb-watchman": "^2.0.0", + "fsevents": "^2.1.2", + "graceful-fs": "^4.2.4", + "jest-regex-util": "^26.0.0", + "jest-serializer": "^26.6.2", + "jest-util": "^26.6.2", + "jest-worker": "^26.6.2", + "micromatch": "^4.0.2", + "sane": "^4.0.3", + "walker": "^1.0.7" + } + }, + "jest-jasmine2": { + "version": "26.6.3", + "resolved": "https://registry.npmjs.org/jest-jasmine2/-/jest-jasmine2-26.6.3.tgz", + "integrity": "sha512-kPKUrQtc8aYwBV7CqBg5pu+tmYXlvFlSFYn18ev4gPFtrRzB15N2gW/Roew3187q2w2eHuu0MU9TJz6w0/nPEg==", + "dev": true, + "requires": { + "@babel/traverse": "^7.1.0", + "@jest/environment": "^26.6.2", + "@jest/source-map": "^26.6.2", + "@jest/test-result": "^26.6.2", + "@jest/types": "^26.6.2", + "@types/node": "*", + "chalk": "^4.0.0", + "co": "^4.6.0", + "expect": "^26.6.2", + "is-generator-fn": "^2.0.0", + "jest-each": "^26.6.2", + "jest-matcher-utils": "^26.6.2", + "jest-message-util": "^26.6.2", + "jest-runtime": "^26.6.3", + "jest-snapshot": "^26.6.2", + "jest-util": "^26.6.2", + "pretty-format": "^26.6.2", + "throat": "^5.0.0" + } + }, + "jest-leak-detector": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-leak-detector/-/jest-leak-detector-26.6.2.tgz", + "integrity": "sha512-i4xlXpsVSMeKvg2cEKdfhh0H39qlJlP5Ex1yQxwF9ubahboQYMgTtz5oML35AVA3B4Eu+YsmwaiKVev9KCvLxg==", + "dev": true, + "requires": { + "jest-get-type": "^26.3.0", + "pretty-format": "^26.6.2" + } + }, + "jest-matcher-utils": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-matcher-utils/-/jest-matcher-utils-26.6.2.tgz", + "integrity": "sha512-llnc8vQgYcNqDrqRDXWwMr9i7rS5XFiCwvh6DTP7Jqa2mqpcCBBlpCbn+trkG0KNhPu/h8rzyBkriOtBstvWhw==", + "dev": true, + "requires": { + "chalk": "^4.0.0", + "jest-diff": "^26.6.2", + "jest-get-type": "^26.3.0", + "pretty-format": "^26.6.2" + } + }, + "jest-message-util": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-message-util/-/jest-message-util-26.6.2.tgz", + "integrity": "sha512-rGiLePzQ3AzwUshu2+Rn+UMFk0pHN58sOG+IaJbk5Jxuqo3NYO1U2/MIR4S1sKgsoYSXSzdtSa0TgrmtUwEbmA==", + "dev": true, + "requires": { + "@babel/code-frame": "^7.0.0", + "@jest/types": "^26.6.2", + "@types/stack-utils": "^2.0.0", + "chalk": "^4.0.0", + "graceful-fs": "^4.2.4", + "micromatch": "^4.0.2", + "pretty-format": "^26.6.2", + "slash": "^3.0.0", + "stack-utils": "^2.0.2" + } + }, + "jest-mock": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-mock/-/jest-mock-26.6.2.tgz", + "integrity": "sha512-YyFjePHHp1LzpzYcmgqkJ0nm0gg/lJx2aZFzFy1S6eUqNjXsOqTK10zNRff2dNfssgokjkG65OlWNcIlgd3zew==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "@types/node": "*" + } + }, + "jest-regex-util": { + "version": "26.0.0", + "resolved": "https://registry.npmjs.org/jest-regex-util/-/jest-regex-util-26.0.0.tgz", + "integrity": "sha512-Gv3ZIs/nA48/Zvjrl34bf+oD76JHiGDUxNOVgUjh3j890sblXryjY4rss71fPtD/njchl6PSE2hIhvyWa1eT0A==", + "dev": true + }, + "jest-resolve": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-resolve/-/jest-resolve-26.6.2.tgz", + "integrity": "sha512-sOxsZOq25mT1wRsfHcbtkInS+Ek7Q8jCHUB0ZUTP0tc/c41QHriU/NunqMfCUWsL4H3MHpvQD4QR9kSYhS7UvQ==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "chalk": "^4.0.0", + "graceful-fs": "^4.2.4", + "jest-pnp-resolver": "^1.2.2", + "jest-util": "^26.6.2", + "read-pkg-up": "^7.0.1", + "resolve": "^1.18.1", + "slash": "^3.0.0" + } + }, + "jest-runner": { + "version": "26.6.3", + "resolved": "https://registry.npmjs.org/jest-runner/-/jest-runner-26.6.3.tgz", + "integrity": "sha512-atgKpRHnaA2OvByG/HpGA4g6CSPS/1LK0jK3gATJAoptC1ojltpmVlYC3TYgdmGp+GLuhzpH30Gvs36szSL2JQ==", + "dev": true, + "requires": { + "@jest/console": "^26.6.2", + "@jest/environment": "^26.6.2", + "@jest/test-result": "^26.6.2", + "@jest/types": "^26.6.2", + "@types/node": "*", + "chalk": "^4.0.0", + "emittery": "^0.7.1", + "exit": "^0.1.2", + "graceful-fs": "^4.2.4", + "jest-config": "^26.6.3", + "jest-docblock": "^26.0.0", + "jest-haste-map": "^26.6.2", + "jest-leak-detector": "^26.6.2", + "jest-message-util": "^26.6.2", + "jest-resolve": "^26.6.2", + "jest-runtime": "^26.6.3", + "jest-util": "^26.6.2", + "jest-worker": "^26.6.2", + "source-map-support": "^0.5.6", + "throat": "^5.0.0" + } + }, + "jest-runtime": { + "version": "26.6.3", + "resolved": "https://registry.npmjs.org/jest-runtime/-/jest-runtime-26.6.3.tgz", + "integrity": "sha512-lrzyR3N8sacTAMeonbqpnSka1dHNux2uk0qqDXVkMv2c/A3wYnvQ4EXuI013Y6+gSKSCxdaczvf4HF0mVXHRdw==", + "dev": true, + "requires": { + "@jest/console": "^26.6.2", + "@jest/environment": "^26.6.2", + "@jest/fake-timers": "^26.6.2", + "@jest/globals": "^26.6.2", + "@jest/source-map": "^26.6.2", + "@jest/test-result": "^26.6.2", + "@jest/transform": "^26.6.2", + "@jest/types": "^26.6.2", + "@types/yargs": "^15.0.0", + "chalk": "^4.0.0", + "cjs-module-lexer": "^0.6.0", + "collect-v8-coverage": "^1.0.0", + "exit": "^0.1.2", + "glob": "^7.1.3", + "graceful-fs": "^4.2.4", + "jest-config": "^26.6.3", + "jest-haste-map": "^26.6.2", + "jest-message-util": "^26.6.2", + "jest-mock": "^26.6.2", + "jest-regex-util": "^26.0.0", + "jest-resolve": "^26.6.2", + "jest-snapshot": "^26.6.2", + "jest-util": "^26.6.2", + "jest-validate": "^26.6.2", + "slash": "^3.0.0", + "strip-bom": "^4.0.0", + "yargs": "^15.4.1" + } + }, + "jest-serializer": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-serializer/-/jest-serializer-26.6.2.tgz", + "integrity": "sha512-S5wqyz0DXnNJPd/xfIzZ5Xnp1HrJWBczg8mMfMpN78OJ5eDxXyf+Ygld9wX1DnUWbIbhM1YDY95NjR4CBXkb2g==", + "dev": true, + "requires": { + "@types/node": "*", + "graceful-fs": "^4.2.4" + } + }, + "jest-snapshot": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-snapshot/-/jest-snapshot-26.6.2.tgz", + "integrity": "sha512-OLhxz05EzUtsAmOMzuupt1lHYXCNib0ECyuZ/PZOx9TrZcC8vL0x+DUG3TL+GLX3yHG45e6YGjIm0XwDc3q3og==", + "dev": true, + "requires": { + "@babel/types": "^7.0.0", + "@jest/types": "^26.6.2", + "@types/babel__traverse": "^7.0.4", + "@types/prettier": "^2.0.0", + "chalk": "^4.0.0", + "expect": "^26.6.2", + "graceful-fs": "^4.2.4", + "jest-diff": "^26.6.2", + "jest-get-type": "^26.3.0", + "jest-haste-map": "^26.6.2", + "jest-matcher-utils": "^26.6.2", + "jest-message-util": "^26.6.2", + "jest-resolve": "^26.6.2", + "natural-compare": "^1.4.0", + "pretty-format": "^26.6.2", + "semver": "^7.3.2" + }, + "dependencies": { + "semver": { + "version": "7.3.5", + "resolved": "https://registry.npmjs.org/semver/-/semver-7.3.5.tgz", + "integrity": "sha512-PoeGJYh8HK4BTO/a9Tf6ZG3veo/A7ZVsYrSA6J8ny9nb3B1VrpkuN+z9OE5wfE5p6H4LchYZsegiQgbJD94ZFQ==", + "dev": true, + "requires": { + "lru-cache": "^6.0.0" + } + } + } + }, + "jest-util": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-util/-/jest-util-26.6.2.tgz", + "integrity": "sha512-MDW0fKfsn0OI7MS7Euz6h8HNDXVQ0gaM9uW6RjfDmd1DAFcaxX9OqIakHIqhbnmF08Cf2DLDG+ulq8YQQ0Lp0Q==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "@types/node": "*", + "chalk": "^4.0.0", + "graceful-fs": "^4.2.4", + "is-ci": "^2.0.0", + "micromatch": "^4.0.2" + } + }, + "jest-validate": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-validate/-/jest-validate-26.6.2.tgz", + "integrity": "sha512-NEYZ9Aeyj0i5rQqbq+tpIOom0YS1u2MVu6+euBsvpgIme+FOfRmoC4R5p0JiAUpaFvFy24xgrpMknarR/93XjQ==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "camelcase": "^6.0.0", + "chalk": "^4.0.0", + "jest-get-type": "^26.3.0", + "leven": "^3.1.0", + "pretty-format": "^26.6.2" + } + }, + "jest-worker": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/jest-worker/-/jest-worker-26.6.2.tgz", + "integrity": "sha512-KWYVV1c4i+jbMpaBC+U++4Va0cp8OisU185o73T1vo99hqi7w8tSJfUXYswwqqrjzwxa6KpRK54WhPvwf5w6PQ==", + "dev": true, + "requires": { + "@types/node": "*", + "merge-stream": "^2.0.0", + "supports-color": "^7.0.0" + } + }, + "jsdom": { + "version": "16.5.3", + "resolved": "https://registry.npmjs.org/jsdom/-/jsdom-16.5.3.tgz", + "integrity": "sha512-Qj1H+PEvUsOtdPJ056ewXM4UJPCi4hhLA8wpiz9F2YvsRBhuFsXxtrIFAgGBDynQA9isAMGE91PfUYbdMPXuTA==", + "dev": true, + "requires": { + "abab": "^2.0.5", + "acorn": "^8.1.0", + "acorn-globals": "^6.0.0", + "cssom": "^0.4.4", + "cssstyle": "^2.3.0", + "data-urls": "^2.0.0", + "decimal.js": "^10.2.1", + "domexception": "^2.0.1", + "escodegen": "^2.0.0", + "html-encoding-sniffer": "^2.0.1", + "is-potential-custom-element-name": "^1.0.0", + "nwsapi": "^2.2.0", + "parse5": "6.0.1", + "request": "^2.88.2", + "request-promise-native": "^1.0.9", + "saxes": "^5.0.1", + "symbol-tree": "^3.2.4", + "tough-cookie": "^4.0.0", + "w3c-hr-time": "^1.0.2", + "w3c-xmlserializer": "^2.0.0", + "webidl-conversions": "^6.1.0", + "whatwg-encoding": "^1.0.5", + "whatwg-mimetype": "^2.3.0", + "whatwg-url": "^8.5.0", + "ws": "^7.4.4", + "xml-name-validator": "^3.0.0" + } + }, + "locate-path": { + "version": "5.0.0", + "resolved": "https://registry.npmjs.org/locate-path/-/locate-path-5.0.0.tgz", + "integrity": "sha512-t7hw9pI+WvuwNJXwk5zVHpyhIqzg2qTlklJOf0mVxGSbe3Fp2VieZcduNYjaLDoy6p9uGpQEGWG87WpMKlNq8g==", + "dev": true, + "requires": { + "p-locate": "^4.1.0" + } + }, + "micromatch": { + "version": "4.0.4", + "resolved": "https://registry.npmjs.org/micromatch/-/micromatch-4.0.4.tgz", + "integrity": "sha512-pRmzw/XUcwXGpD9aI9q/0XOwLNygjETJ8y0ao0wdqprrzDa4YnxLcz7fQRZr8voh8V10kGhABbNcHVk5wHgWwg==", + "dev": true, + "requires": { + "braces": "^3.0.1", + "picomatch": "^2.2.3" + } + }, + "normalize-path": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/normalize-path/-/normalize-path-3.0.0.tgz", + "integrity": "sha512-6eZs5Ls3WtCisHWp9S2GUy8dqkpGi4BVSz3GaqiE6ezub0512ESztXUwUB6C6IKbQkY2Pnb/mD4WYojCRwcwLA==", + "dev": true + }, + "p-locate": { + "version": "4.1.0", + "resolved": "https://registry.npmjs.org/p-locate/-/p-locate-4.1.0.tgz", + "integrity": "sha512-R79ZZ/0wAxKGu3oYMlz8jy/kbhsNrS7SKZ7PxEHBgJ5+F2mtFW2fK2cOtBh1cHYkQsbzFV7I+EoRKe6Yt0oK7A==", + "dev": true, + "requires": { + "p-limit": "^2.2.0" + } + }, + "parse-json": { + "version": "5.2.0", + "resolved": "https://registry.npmjs.org/parse-json/-/parse-json-5.2.0.tgz", + "integrity": "sha512-ayCKvm/phCGxOkYRSCM82iDwct8/EonSEgCSxWxD7ve6jHggsFl4fZVQBPRNgQoKiuV/odhFrGzQXZwbifC8Rg==", + "dev": true, + "requires": { + "@babel/code-frame": "^7.0.0", + "error-ex": "^1.3.1", + "json-parse-even-better-errors": "^2.3.0", + "lines-and-columns": "^1.1.6" + } + }, + "parse5": { + "version": "6.0.1", + "resolved": "https://registry.npmjs.org/parse5/-/parse5-6.0.1.tgz", + "integrity": "sha512-Ofn/CTFzRGTTxwpNEs9PP93gXShHcTq255nzRYSKe8AkVpZY7e1fpmTfOyoIvjP5HG7Z2ZM7VS9PPhQGW2pOpw==", + "dev": true + }, + "path-exists": { + "version": "4.0.0", + "resolved": "https://registry.npmjs.org/path-exists/-/path-exists-4.0.0.tgz", + "integrity": "sha512-ak9Qy5Q7jYb2Wwcey5Fpvg2KoAc/ZIhLSLOSBmRmygPsGwkVVt0fZa0qrtMz+m6tJTAHfZQ8FnmB4MG4LWy7/w==", + "dev": true + }, + "picomatch": { + "version": "2.2.3", + "resolved": "https://registry.npmjs.org/picomatch/-/picomatch-2.2.3.tgz", + "integrity": "sha512-KpELjfwcCDUb9PeigTs2mBJzXUPzAuP2oPcA989He8Rte0+YUAjw1JVedDhuTKPkHjSYzMN3npC9luThGYEKdg==", + "dev": true + }, + "playwright-core": { + "version": "1.10.0", + "resolved": "https://registry.npmjs.org/playwright-core/-/playwright-core-1.10.0.tgz", + "integrity": "sha512-SDA5KPwnJJSfnNX/b7h8y0ChwBmcbbcCofYXkZGMVuzXZsmHPGLOBRhgkwN2nzJ10Ezf4cd1OcVOeOLKPxjeRg==", + "dev": true, + "requires": { + "commander": "^6.1.0", + "debug": "^4.1.1", + "extract-zip": "^2.0.1", + "https-proxy-agent": "^5.0.0", + "jpeg-js": "^0.4.2", + "mime": "^2.4.6", + "pngjs": "^5.0.0", + "progress": "^2.0.3", + "proper-lockfile": "^4.1.1", + "proxy-from-env": "^1.1.0", + "rimraf": "^3.0.2", + "stack-utils": "^2.0.3", + "ws": "^7.3.1" + } + }, + "pretty-format": { + "version": "26.6.2", + "resolved": "https://registry.npmjs.org/pretty-format/-/pretty-format-26.6.2.tgz", + "integrity": "sha512-7AeGuCYNGmycyQbCqd/3PWH4eOoX/OiCa0uphp57NVTeAGdJGaAliecxwBDHYQCIvrW7aDBZCYeNTP/WX69mkg==", + "dev": true, + "requires": { + "@jest/types": "^26.6.2", + "ansi-regex": "^5.0.0", + "ansi-styles": "^4.0.0", + "react-is": "^17.0.1" + } + }, + "react-is": { + "version": "17.0.2", + "resolved": "https://registry.npmjs.org/react-is/-/react-is-17.0.2.tgz", + "integrity": "sha512-w2GsyukL62IJnlaff/nRegPQR94C/XXamvMWmSHRJ4y7Ts/4ocGRmTHvOs8PSE6pB3dWOrD/nueuU5sduBsQ4w==", + "dev": true + }, + "read-pkg": { + "version": "5.2.0", + "resolved": "https://registry.npmjs.org/read-pkg/-/read-pkg-5.2.0.tgz", + "integrity": "sha512-Ug69mNOpfvKDAc2Q8DRpMjjzdtrnv9HcSMX+4VsZxD1aZ6ZzrIE7rlzXBtWTyhULSMKg076AW6WR5iZpD0JiOg==", + "dev": true, + "requires": { + "@types/normalize-package-data": "^2.4.0", + "normalize-package-data": "^2.5.0", + "parse-json": "^5.0.0", + "type-fest": "^0.6.0" + }, + "dependencies": { + "type-fest": { + "version": "0.6.0", + "resolved": "https://registry.npmjs.org/type-fest/-/type-fest-0.6.0.tgz", + "integrity": "sha512-q+MB8nYR1KDLrgr4G5yemftpMC7/QLqVndBmEEdqzmNj5dcFOO4Oo8qlwZE3ULT3+Zim1F8Kq4cBnikNhlCMlg==", + "dev": true + } + } + }, + "read-pkg-up": { + "version": "7.0.1", + "resolved": "https://registry.npmjs.org/read-pkg-up/-/read-pkg-up-7.0.1.tgz", + "integrity": "sha512-zK0TB7Xd6JpCLmlLmufqykGE+/TlOePD6qKClNW7hHDKFh/J7/7gCWGR7joEQEW1bKq3a3yUZSObOoWLFQ4ohg==", + "dev": true, + "requires": { + "find-up": "^4.1.0", + "read-pkg": "^5.2.0", + "type-fest": "^0.8.1" + } + }, + "rimraf": { + "version": "3.0.2", + "resolved": "https://registry.npmjs.org/rimraf/-/rimraf-3.0.2.tgz", + "integrity": "sha512-JZkJMZkAGFFPP2YqXZXPbMlMBgsxzE8ILs4lMIX/2o0L9UBw9O/Y3o6wFw/i9YLapcUJWwqbi3kdxIPdC62TIA==", + "dev": true, + "requires": { + "glob": "^7.1.3" + } + }, + "saxes": { + "version": "5.0.1", + "resolved": "https://registry.npmjs.org/saxes/-/saxes-5.0.1.tgz", + "integrity": "sha512-5LBh1Tls8c9xgGjw3QrMwETmTMVk0oFgvrFSvWx62llR2hcEInrKNZ2GZCCuuy2lvWrdl5jhbpeqc5hRYKFOcw==", + "dev": true, + "requires": { + "xmlchars": "^2.2.0" + } + }, + "semver": { + "version": "6.3.0", + "resolved": "https://registry.npmjs.org/semver/-/semver-6.3.0.tgz", + "integrity": "sha512-b39TBaTSfV6yBrapU89p5fKekE2m/NwnDocOVruQFS1/veMgdzuPcnOM34M6CwxW8jH/lxEa5rBoDeUwu5HHTw==", + "dev": true + }, + "slash": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/slash/-/slash-3.0.0.tgz", + "integrity": "sha512-g9Q1haeby36OSStwb4ntCGGGaKsaVSjQ68fBxoQcutl5fS1vuY18H3wSt3jFyFtrkx+Kz0V1G85A4MyAdDMi2Q==", + "dev": true + }, + "source-map": { + "version": "0.6.1", + "resolved": "https://registry.npmjs.org/source-map/-/source-map-0.6.1.tgz", + "integrity": "sha512-UjgapumWlbMhkBgzT7Ykc5YXUT46F0iKu8SGXq0bcwP5dz/h0Plj6enJqjz1Zbq2l5WaqYnrVbwWOWMyF3F47g==", + "dev": true + }, + "stack-utils": { + "version": "2.0.3", + "resolved": "https://registry.npmjs.org/stack-utils/-/stack-utils-2.0.3.tgz", + "integrity": "sha512-gL//fkxfWUsIlFL2Tl42Cl6+HFALEaB1FU76I/Fy+oZjRreP7OPMXFlGbxM7NQsI0ZpUfw76sHnv0WNYuTb7Iw==", + "dev": true, + "requires": { + "escape-string-regexp": "^2.0.0" + } + }, + "string-width": { + "version": "4.2.2", + "resolved": "https://registry.npmjs.org/string-width/-/string-width-4.2.2.tgz", + "integrity": "sha512-XBJbT3N4JhVumXE0eoLU9DCjcaF92KLNqTmFCnG1pf8duUxFGwtP6AD6nkjw9a3IdiRtL3E2w3JDiE/xi3vOeA==", + "dev": true, + "requires": { + "emoji-regex": "^8.0.0", + "is-fullwidth-code-point": "^3.0.0", + "strip-ansi": "^6.0.0" + } + }, + "strip-ansi": { + "version": "6.0.0", + "resolved": "https://registry.npmjs.org/strip-ansi/-/strip-ansi-6.0.0.tgz", + "integrity": "sha512-AuvKTrTfQNYNIctbR1K/YGTR1756GycPsg7b9bdV9Duqur4gv6aKqHXah67Z8ImS7WEz5QVcOtlfW2rZEugt6w==", + "dev": true, + "requires": { + "ansi-regex": "^5.0.0" + } + }, + "strip-bom": { + "version": "4.0.0", + "resolved": "https://registry.npmjs.org/strip-bom/-/strip-bom-4.0.0.tgz", + "integrity": "sha512-3xurFv5tEgii33Zi8Jtp55wEIILR9eh34FAW00PZf+JnSsTmV/ioewSgQl97JHvgjoRGwPShsWm+IdrxB35d0w==", + "dev": true + }, + "supports-color": { + "version": "7.2.0", + "resolved": "https://registry.npmjs.org/supports-color/-/supports-color-7.2.0.tgz", + "integrity": "sha512-qpCAvRl9stuOHveKsn7HncJRvv501qIacKzQlO/+Lwxc9+0q2wLyv4Dfvt80/DPn2pqOBsJdDiogXGR9+OvwRw==", + "dev": true, + "requires": { + "has-flag": "^4.0.0" + } + }, + "test-exclude": { + "version": "6.0.0", + "resolved": "https://registry.npmjs.org/test-exclude/-/test-exclude-6.0.0.tgz", + "integrity": "sha512-cAGWPIyOHU6zlmg88jwm7VRyXnMN7iV68OGAbYDk/Mh/xC/pzVPlQtY6ngoIH/5/tciuhGfvESU8GrHrcxD56w==", + "dev": true, + "requires": { + "@istanbuljs/schema": "^0.1.2", + "glob": "^7.1.4", + "minimatch": "^3.0.4" + } + }, + "throat": { + "version": "5.0.0", + "resolved": "https://registry.npmjs.org/throat/-/throat-5.0.0.tgz", + "integrity": "sha512-fcwX4mndzpLQKBS1DVYhGAcYaYt7vsHNIvQV+WXMvnow5cgjPphq5CaayLaGsjRdSCKZFNGt7/GYAuXaNOiYCA==", + "dev": true + }, + "to-regex-range": { + "version": "5.0.1", + "resolved": "https://registry.npmjs.org/to-regex-range/-/to-regex-range-5.0.1.tgz", + "integrity": "sha512-65P7iz6X5yEr1cwcgvQxbbIw7Uk3gOy5dIdtZ4rDveLqhrdJP+Li/Hx6tyK0NEb+2GCyneCMJiGqrADCSNk8sQ==", + "dev": true, + "requires": { + "is-number": "^7.0.0" + } + }, + "tough-cookie": { + "version": "4.0.0", + "resolved": "https://registry.npmjs.org/tough-cookie/-/tough-cookie-4.0.0.tgz", + "integrity": "sha512-tHdtEpQCMrc1YLrMaqXXcj6AxhYi/xgit6mZu1+EDWUn+qhUf8wMQoFIy9NXuq23zAwtcB0t/MjACGR18pcRbg==", + "dev": true, + "requires": { + "psl": "^1.1.33", + "punycode": "^2.1.1", + "universalify": "^0.1.2" + } + }, + "tr46": { + "version": "2.0.2", + "resolved": "https://registry.npmjs.org/tr46/-/tr46-2.0.2.tgz", + "integrity": "sha512-3n1qG+/5kg+jrbTzwAykB5yRYtQCTqOGKq5U5PE3b0a1/mzo6snDhjGS0zJVJunO0NrT3Dg1MLy5TjWP/UJppg==", + "dev": true, + "requires": { + "punycode": "^2.1.1" + } + }, + "uuid": { + "version": "8.3.2", + "resolved": "https://registry.npmjs.org/uuid/-/uuid-8.3.2.tgz", + "integrity": "sha512-+NYs2QeMWy+GWFOEm9xnn6HCDp0l7QBD7ml8zLUmJ+93Q5NF0NocErnwkTkXVFNiX3/fpC6afS8Dhb/gz7R7eg==", + "dev": true + }, + "w3c-xmlserializer": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/w3c-xmlserializer/-/w3c-xmlserializer-2.0.0.tgz", + "integrity": "sha512-4tzD0mF8iSiMiNs30BiLO3EpfGLZUT2MSX/G+o7ZywDzliWQ3OPtTZ0PTC3B3ca1UAf4cJMHB+2Bf56EriJuRA==", + "dev": true, + "requires": { + "xml-name-validator": "^3.0.0" + } + }, + "webidl-conversions": { + "version": "6.1.0", + "resolved": "https://registry.npmjs.org/webidl-conversions/-/webidl-conversions-6.1.0.tgz", + "integrity": "sha512-qBIvFLGiBpLjfwmYAaHPXsn+ho5xZnGvyGvsarywGNc8VyQJUMHJ8OBKGGrPER0okBeMDaan4mNBlgBROxuI8w==", + "dev": true + }, + "whatwg-url": { + "version": "8.5.0", + "resolved": "https://registry.npmjs.org/whatwg-url/-/whatwg-url-8.5.0.tgz", + "integrity": "sha512-fy+R77xWv0AiqfLl4nuGUlQ3/6b5uNfQ4WAbGQVMYshCTCCPK9psC1nWh3XHuxGVCtlcDDQPQW1csmmIQo+fwg==", + "dev": true, + "requires": { + "lodash": "^4.7.0", + "tr46": "^2.0.2", + "webidl-conversions": "^6.1.0" + } + }, + "wrap-ansi": { + "version": "6.2.0", + "resolved": "https://registry.npmjs.org/wrap-ansi/-/wrap-ansi-6.2.0.tgz", + "integrity": "sha512-r6lPcBGxZXlIcymEu7InxDMhdW0KDxpLgoFLcguasxCaJ/SOIZwINatK9KY/tf+ZrlywOKU0UDj3ATXUBfxJXA==", + "dev": true, + "requires": { + "ansi-styles": "^4.0.0", + "string-width": "^4.1.0", + "strip-ansi": "^6.0.0" + } + }, + "write-file-atomic": { + "version": "3.0.3", + "resolved": "https://registry.npmjs.org/write-file-atomic/-/write-file-atomic-3.0.3.tgz", + "integrity": "sha512-AvHcyZ5JnSfq3ioSyjrBkH9yW4m7Ayk8/9My/DD9onKeu/94fwrMocemO2QAJFAlnnDN+ZDS+ZjAR5ua1/PV/Q==", + "dev": true, + "requires": { + "imurmurhash": "^0.1.4", + "is-typedarray": "^1.0.0", + "signal-exit": "^3.0.2", + "typedarray-to-buffer": "^3.1.5" + } + }, + "ws": { + "version": "7.4.5", + "resolved": "https://registry.npmjs.org/ws/-/ws-7.4.5.tgz", + "integrity": "sha512-xzyu3hFvomRfXKH8vOFMU3OguG6oOvhXMo3xsGy3xWExqaM2dxBbVxuD99O7m3ZUFMvvscsZDqxfgMaRr/Nr1g==", + "dev": true + }, + "yargs": { + "version": "15.4.1", + "resolved": "https://registry.npmjs.org/yargs/-/yargs-15.4.1.tgz", + "integrity": "sha512-aePbxDmcYW++PaqBsJ+HYUFwCdv4LVvdnhBy78E57PIor8/OVvhMrADFFEDh8DHDFRv/O9i3lPhsENjO7QX0+A==", + "dev": true, + "requires": { + "cliui": "^6.0.0", + "decamelize": "^1.2.0", + "find-up": "^4.1.0", + "get-caller-file": "^2.0.1", + "require-directory": "^2.1.1", + "require-main-filename": "^2.0.0", + "set-blocking": "^2.0.0", + "string-width": "^4.2.0", + "which-module": "^2.0.0", + "y18n": "^4.0.0", + "yargs-parser": "^18.1.2" + } + }, + "yargs-parser": { + "version": "18.1.3", + "resolved": "https://registry.npmjs.org/yargs-parser/-/yargs-parser-18.1.3.tgz", + "integrity": "sha512-o50j0JeToy/4K6OZcaQmW6lyXXKhq7csREXcDwk2omFPJEwUNOVtJKvmDr9EI1fAJZUyZcRF7kxGBWmRXudrCQ==", + "dev": true, + "requires": { + "camelcase": "^5.0.0", + "decamelize": "^1.2.0" + }, + "dependencies": { + "camelcase": { + "version": "5.3.1", + "resolved": "https://registry.npmjs.org/camelcase/-/camelcase-5.3.1.tgz", + "integrity": "sha512-L28STB170nwWS63UjtlEOE3dldQApaJXZkOI1uMFfzf3rRuPegHaHesyee+YxQ+W6SvRDQV6UrdOdRiR153wJg==", + "dev": true + } + } + } + } + }, "jest-pnp-resolver": { "version": "1.2.2", "resolved": "https://registry.npmjs.org/jest-pnp-resolver/-/jest-pnp-resolver-1.2.2.tgz", "integrity": "sha512-olV41bKSMm8BdnuMsewT4jqlZ8+3TCARAXjZGT9jcoSnrfUnRCqnMoF9XEeoWjbzObpqF9dRhHQj0Xb9QdF6/w==" }, - "jest-puppeteer": { - "version": "4.4.0", - "resolved": "https://registry.npmjs.org/jest-puppeteer/-/jest-puppeteer-4.4.0.tgz", - "integrity": "sha512-ZaiCTlPZ07B9HW0erAWNX6cyzBqbXMM7d2ugai4epBDKpKvRDpItlRQC6XjERoJELKZsPziFGS0OhhUvTvQAXA==", + "jest-process-manager": { + "version": "0.2.9", + "resolved": "https://registry.npmjs.org/jest-process-manager/-/jest-process-manager-0.2.9.tgz", + "integrity": "sha512-IKVdOSz1NLwKg9HTeyEDn63waMvKK6wcS+tCarGquNIktlXt4zAW2cfJ9vAA/xBcidWYKOPXHvy1l1N8qfw3Ww==", "dev": true, "requires": { - "expect-puppeteer": "^4.4.0", - "jest-environment-puppeteer": "^4.4.0" + "@types/wait-on": "^5.2.0", + "chalk": "^4.1.0", + "cwd": "^0.10.0", + "exit": "^0.1.2", + "find-process": "^1.4.4", + "prompts": "^2.4.0", + "signal-exit": "^3.0.3", + "spawnd": "^4.4.0", + "tree-kill": "^1.2.2", + "wait-on": "^5.2.1" + }, + "dependencies": { + "ansi-styles": { + "version": "4.3.0", + "resolved": "https://registry.npmjs.org/ansi-styles/-/ansi-styles-4.3.0.tgz", + "integrity": "sha512-zbB9rCJAT1rbjiVDb2hqKFHNYLxgtk8NURxZ3IZwD3F6NtxbXZQCnnSi1Lkx+IDohdPlFp222wVALIheZJQSEg==", + "dev": true, + "requires": { + "color-convert": "^2.0.1" + } + }, + "chalk": { + "version": "4.1.0", + "resolved": "https://registry.npmjs.org/chalk/-/chalk-4.1.0.tgz", + "integrity": "sha512-qwx12AxXe2Q5xQ43Ac//I6v5aXTipYrSESdOgzrN+9XjgEpyjpKuvSGaN4qE93f7TQTlerQQ8S+EQ0EyDoVL1A==", + "dev": true, + "requires": { + "ansi-styles": "^4.1.0", + "supports-color": "^7.1.0" + } + }, + "color-convert": { + "version": "2.0.1", + "resolved": "https://registry.npmjs.org/color-convert/-/color-convert-2.0.1.tgz", + "integrity": "sha512-RRECPsj7iu/xb5oKYcsFHSppFNnsj/52OVTRKb4zP5onXwVF3zVmmToNcOfGC+CRDpfK/U584fMg38ZHCaElKQ==", + "dev": true, + "requires": { + "color-name": "~1.1.4" + } + }, + "color-name": { + "version": "1.1.4", + "resolved": "https://registry.npmjs.org/color-name/-/color-name-1.1.4.tgz", + "integrity": "sha512-dOy+3AuW3a2wNbZHIuMZpTcgjGuLU/uBL/ubcZF9OXbDo8ff4O8yVp5Bf0efS8uEoYo5q4Fx7dY9OgQGXgAsQA==", + "dev": true + }, + "has-flag": { + "version": "4.0.0", + "resolved": "https://registry.npmjs.org/has-flag/-/has-flag-4.0.0.tgz", + "integrity": "sha512-EykJT/Q1KjTWctppgIAgfSO0tKVuZUjhgMr17kqTumMl6Afv3EISleU7qZUzoXDFTAHTDC4NOoG/ZxU3EvlMPQ==", + "dev": true + }, + "supports-color": { + "version": "7.2.0", + "resolved": "https://registry.npmjs.org/supports-color/-/supports-color-7.2.0.tgz", + "integrity": "sha512-qpCAvRl9stuOHveKsn7HncJRvv501qIacKzQlO/+Lwxc9+0q2wLyv4Dfvt80/DPn2pqOBsJdDiogXGR9+OvwRw==", + "dev": true, + "requires": { + "has-flag": "^4.0.0" + } + }, + "wait-on": { + "version": "5.3.0", + "resolved": "https://registry.npmjs.org/wait-on/-/wait-on-5.3.0.tgz", + "integrity": "sha512-DwrHrnTK+/0QFaB9a8Ol5Lna3k7WvUR4jzSKmz0YaPBpuN2sACyiPVKVfj6ejnjcajAcvn3wlbTyMIn9AZouOg==", + "dev": true, + "requires": { + "axios": "^0.21.1", + "joi": "^17.3.0", + "lodash": "^4.17.21", + "minimist": "^1.2.5", + "rxjs": "^6.6.3" + } + } } }, "jest-regex-util": { @@ -14631,6 +18025,42 @@ } } }, + "joi": { + "version": "17.4.0", + "resolved": "https://registry.npmjs.org/joi/-/joi-17.4.0.tgz", + "integrity": "sha512-F4WiW2xaV6wc1jxete70Rw4V/VuMd6IN+a5ilZsxG4uYtUXWu2kq9W5P2dz30e7Gmw8RCbY/u/uk+dMPma9tAg==", + "dev": true, + "requires": { + "@hapi/hoek": "^9.0.0", + "@hapi/topo": "^5.0.0", + "@sideway/address": "^4.1.0", + "@sideway/formula": "^3.0.0", + "@sideway/pinpoint": "^2.0.0" + }, + "dependencies": { + "@hapi/hoek": { + "version": "9.2.0", + "resolved": "https://registry.npmjs.org/@hapi/hoek/-/hoek-9.2.0.tgz", + "integrity": "sha512-sqKVVVOe5ivCaXDWivIJYVSaEgdQK9ul7a4Kity5Iw7u9+wBAPbX1RMSnLLmp7O4Vzj0WOWwMAJsTL00xwaNug==", + "dev": true + }, + "@hapi/topo": { + "version": "5.0.0", + "resolved": "https://registry.npmjs.org/@hapi/topo/-/topo-5.0.0.tgz", + "integrity": "sha512-tFJlT47db0kMqVm3H4nQYgn6Pwg10GTZHb1pwmSiv1K4ks6drQOtfEF5ZnPjkvC+y4/bUPHK+bc87QvLcL+WMw==", + "dev": true, + "requires": { + "@hapi/hoek": "^9.0.0" + } + } + } + }, + "jpeg-js": { + "version": "0.4.3", + "resolved": "https://registry.npmjs.org/jpeg-js/-/jpeg-js-0.4.3.tgz", + "integrity": "sha512-ru1HWKek8octvUHFHvE5ZzQ1yAsJmIvRdGWvSoKV52XKyuyYA437QWDttXT8eZXDSbuMpHlLzPDZUPd6idIz+Q==", + "dev": true + }, "jquery": { "version": "3.5.1", "resolved": "https://registry.npmjs.org/jquery/-/jquery-3.5.1.tgz", @@ -14905,6 +18335,11 @@ "resolved": "https://registry.npmjs.org/kleur/-/kleur-3.0.3.tgz", "integrity": "sha512-eTIzlVOSUR+JxdDFepEYcBMtZ9Qqdef+rnzWdRZuMbOywu5tO2w2N7rqjoANZ5k9vywhL6Br1VRjUIgTQx4E8w==" }, + "klona": { + "version": "2.0.4", + "resolved": "https://registry.npmjs.org/klona/-/klona-2.0.4.tgz", + "integrity": "sha512-ZRbnvdg/NxqzC7L9Uyqzf4psi1OM4Cuc+sJAkQPjO6XkQIJTNbfK2Rsmbw8fx1p2mkZdp2FZYo2+LwXYY/uwIA==" + }, "knockout": { "version": "3.5.1", "resolved": "https://registry.npmjs.org/knockout/-/knockout-3.5.1.tgz", @@ -14915,12 +18350,6 @@ "resolved": "https://registry.npmjs.org/labella/-/labella-1.1.4.tgz", "integrity": "sha1-xsxaNA6N80DrM1YzaD6lm4KMMi0=" }, - "lazy-cache": { - "version": "1.0.4", - "resolved": "https://registry.npmjs.org/lazy-cache/-/lazy-cache-1.0.4.tgz", - "integrity": "sha1-odePw6UEdMuAhF07O24dpJpEbo4=", - "dev": true - }, "lcid": { "version": "1.0.0", "resolved": "https://registry.npmjs.org/lcid/-/lcid-1.0.0.tgz", @@ -15096,135 +18525,6 @@ "integrity": "sha1-HADHQ7QzzQpOgHWPe2SldEDZ/wA=", "dev": true }, - "list-stylesheets": { - "version": "1.2.9", - "resolved": "https://registry.npmjs.org/list-stylesheets/-/list-stylesheets-1.2.9.tgz", - "integrity": "sha512-d0Mlv8tlsstnwW8yIJLPRBoXczmQj4uh66lp8pWn1/aiyVXb3tBS8flUuYsgvKfJdKJBiHJ5m8PLDcx5EikDOg==", - "dev": true, - "requires": { - "cheerio": "^0.22.0", - "pick-util": "^1.1.3" - }, - "dependencies": { - "cheerio": { - "version": "0.22.0", - "resolved": "https://registry.npmjs.org/cheerio/-/cheerio-0.22.0.tgz", - "integrity": "sha1-qbqoYKP5tZWmuBsahocxIe06Jp4=", - "dev": true, - "requires": { - "css-select": "~1.2.0", - "dom-serializer": "~0.1.0", - "entities": "~1.1.1", - "htmlparser2": "^3.9.1", - "lodash.assignin": "^4.0.9", - "lodash.bind": "^4.1.4", - "lodash.defaults": "^4.0.1", - "lodash.filter": "^4.4.0", - "lodash.flatten": "^4.2.0", - "lodash.foreach": "^4.3.0", - "lodash.map": "^4.4.0", - "lodash.merge": "^4.4.0", - "lodash.pick": "^4.2.1", - "lodash.reduce": "^4.4.0", - "lodash.reject": "^4.4.0", - "lodash.some": "^4.4.0" - } - }, - "css-select": { - "version": "1.2.0", - "resolved": "https://registry.npmjs.org/css-select/-/css-select-1.2.0.tgz", - "integrity": "sha1-KzoRBTnFNV8c2NMUYj6HCxIeyFg=", - "dev": true, - "requires": { - "boolbase": "~1.0.0", - "css-what": "2.1", - "domutils": "1.5.1", - "nth-check": "~1.0.1" - } - }, - "css-what": { - "version": "2.1.3", - "resolved": "https://registry.npmjs.org/css-what/-/css-what-2.1.3.tgz", - "integrity": "sha512-a+EPoD+uZiNfh+5fxw2nO9QwFa6nJe2Or35fGY6Ipw1R3R4AGz1d1TEZrCegvw2YTmZ0jXirGYlzxxpYSHwpEg==", - "dev": true - }, - "dom-serializer": { - "version": "0.1.1", - "resolved": "https://registry.npmjs.org/dom-serializer/-/dom-serializer-0.1.1.tgz", - "integrity": "sha512-l0IU0pPzLWSHBcieZbpOKgkIn3ts3vAh7ZuFyXNwJxJXk/c4Gwj9xaTJwIDVQCXawWD0qb3IzMGH5rglQaO0XA==", - "dev": true, - "requires": { - "domelementtype": "^1.3.0", - "entities": "^1.1.1" - } - }, - "domelementtype": { - "version": "1.3.1", - "resolved": "https://registry.npmjs.org/domelementtype/-/domelementtype-1.3.1.tgz", - "integrity": "sha512-BSKB+TSpMpFI/HOxCNr1O8aMOTZ8hT3pM3GQ0w/mWRmkhEDSFJkkyzz4XQsBV44BChwGkrDfMyjVD0eA2aFV3w==", - "dev": true - }, - "domhandler": { - "version": "2.4.2", - "resolved": "https://registry.npmjs.org/domhandler/-/domhandler-2.4.2.tgz", - "integrity": "sha512-JiK04h0Ht5u/80fdLMCEmV4zkNh2BcoMFBmZ/91WtYZ8qVXSKjiw7fXMgFPnHcSZgOo3XdinHvmnDUeMf5R4wA==", - "dev": true, - "requires": { - "domelementtype": "1" - } - }, - "domutils": { - "version": "1.5.1", - "resolved": "https://registry.npmjs.org/domutils/-/domutils-1.5.1.tgz", - "integrity": "sha1-3NhIiib1Y9YQeeSMn3t+Mjc2gs8=", - "dev": true, - "requires": { - "dom-serializer": "0", - "domelementtype": "1" - } - }, - "entities": { - "version": "1.1.2", - "resolved": "https://registry.npmjs.org/entities/-/entities-1.1.2.tgz", - "integrity": "sha512-f2LZMYl1Fzu7YSBKg+RoROelpOaNrcGmE9AZubeDfrCEia483oW4MI4VyFd5VNHIgQ/7qm1I0wUHK1eJnn2y2w==", - "dev": true - }, - "htmlparser2": { - "version": "3.10.1", - "resolved": "https://registry.npmjs.org/htmlparser2/-/htmlparser2-3.10.1.tgz", - "integrity": "sha512-IgieNijUMbkDovyoKObU1DUhm1iwNYE/fuifEoEHfd1oZKZDaONBSkal7Y01shxsM49R4XaMdGez3WnF9UfiCQ==", - "dev": true, - "requires": { - "domelementtype": "^1.3.1", - "domhandler": "^2.3.0", - "domutils": "^1.5.1", - "entities": "^1.1.1", - "inherits": "^2.0.1", - "readable-stream": "^3.1.1" - } - }, - "nth-check": { - "version": "1.0.2", - "resolved": "https://registry.npmjs.org/nth-check/-/nth-check-1.0.2.tgz", - "integrity": "sha512-WeBOdju8SnzPN5vTUJYxYUxLeXpCaVP5i5e0LF8fg7WORF2Wd7wFX/pk0tYZk7s8T+J7VLy0Da6J1+wCT0AtHg==", - "dev": true, - "requires": { - "boolbase": "~1.0.0" - } - }, - "readable-stream": { - "version": "3.6.0", - "resolved": "https://registry.npmjs.org/readable-stream/-/readable-stream-3.6.0.tgz", - "integrity": "sha512-BViHy7LKeTz4oNnkcLJ+lVSL6vpiFeX6/d3oSH8zCW7UxP2onchk+vTGB143xuFjHS3deTgkKoXXymXqymiIdA==", - "dev": true, - "requires": { - "inherits": "^2.0.3", - "string_decoder": "^1.1.1", - "util-deprecate": "^1.0.1" - } - } - } - }, "load-json-file": { "version": "4.0.0", "resolved": "https://registry.npmjs.org/load-json-file/-/load-json-file-4.0.0.tgz", @@ -15277,27 +18577,15 @@ } }, "lodash": { - "version": "4.17.20", - "resolved": "https://registry.npmjs.org/lodash/-/lodash-4.17.20.tgz", - "integrity": "sha512-PlhdFcillOINfeV7Ni6oF1TAEayyZBoZ8bcshTHqOYJYlrqzRK5hagpagky5o4HfCzzd1TRkXPMFq6cKk9rGmA==" + "version": "4.17.21", + "resolved": "https://registry.npmjs.org/lodash/-/lodash-4.17.21.tgz", + "integrity": "sha512-v2kDEe57lecTulaDIuNTPy3Ry4gLGJ6Z1O3vE1krgXZNrsQ+LFTGHVxVjcXPs17LhbZVGedAJv8XZ1tvj5FvSg==" }, "lodash-es": { "version": "4.17.20", "resolved": "https://registry.npmjs.org/lodash-es/-/lodash-es-4.17.20.tgz", "integrity": "sha512-JD1COMZsq8maT6mnuz1UMV0jvYD0E0aUsSOdrr1/nAG3dhqQXwRRgeW0cSqH1U43INKcqxaiVIQNOUDld7gRDA==" }, - "lodash.assignin": { - "version": "4.2.0", - "resolved": "https://registry.npmjs.org/lodash.assignin/-/lodash.assignin-4.2.0.tgz", - "integrity": "sha1-uo31+4QesKPoBEIysOJjqNxqKKI=", - "dev": true - }, - "lodash.bind": { - "version": "4.2.1", - "resolved": "https://registry.npmjs.org/lodash.bind/-/lodash.bind-4.2.1.tgz", - "integrity": "sha1-euMBfpOWIqwxt9fX3LGzTbFpDTU=", - "dev": true - }, "lodash.camelcase": { "version": "4.3.0", "resolved": "https://registry.npmjs.org/lodash.camelcase/-/lodash.camelcase-4.3.0.tgz", @@ -15318,30 +18606,12 @@ "resolved": "https://registry.npmjs.org/lodash.debounce/-/lodash.debounce-4.0.8.tgz", "integrity": "sha1-gteb/zCmfEAF/9XiUVMArZyk168=" }, - "lodash.defaults": { - "version": "4.2.0", - "resolved": "https://registry.npmjs.org/lodash.defaults/-/lodash.defaults-4.2.0.tgz", - "integrity": "sha1-0JF4cW/+pN3p5ft7N/bwgCJ0WAw=", - "dev": true - }, "lodash.escape": { "version": "4.0.1", "resolved": "https://registry.npmjs.org/lodash.escape/-/lodash.escape-4.0.1.tgz", "integrity": "sha1-yQRGkMIeBClL6qUXcS/e0fqI3pg=", "dev": true }, - "lodash.filter": { - "version": "4.6.0", - "resolved": "https://registry.npmjs.org/lodash.filter/-/lodash.filter-4.6.0.tgz", - "integrity": "sha1-ZosdSYFgOuHMWm+nYBQ+SAtMSs4=", - "dev": true - }, - "lodash.flatten": { - "version": "4.4.0", - "resolved": "https://registry.npmjs.org/lodash.flatten/-/lodash.flatten-4.4.0.tgz", - "integrity": "sha1-8xwiIlqWMtK7+OSt2+8kCqdlph8=", - "dev": true - }, "lodash.flattendeep": { "version": "4.4.0", "resolved": "https://registry.npmjs.org/lodash.flattendeep/-/lodash.flattendeep-4.4.0.tgz", @@ -15353,12 +18623,6 @@ "resolved": "https://registry.npmjs.org/lodash.flow/-/lodash.flow-3.5.0.tgz", "integrity": "sha1-h79AKSuM+D5OjOGjrkIJ4gBxZ1o=" }, - "lodash.foreach": { - "version": "4.5.0", - "resolved": "https://registry.npmjs.org/lodash.foreach/-/lodash.foreach-4.5.0.tgz", - "integrity": "sha1-Gmo16s5AEoDH8G3d7DUWWrJ+PlM=", - "dev": true - }, "lodash.has": { "version": "4.5.2", "resolved": "https://registry.npmjs.org/lodash.has/-/lodash.has-4.5.2.tgz", @@ -15400,52 +18664,16 @@ "resolved": "https://registry.npmjs.org/lodash.isstring/-/lodash.isstring-4.0.1.tgz", "integrity": "sha1-1SfftUVuynzJu5XV2ur4i6VKVFE=" }, - "lodash.map": { - "version": "4.6.0", - "resolved": "https://registry.npmjs.org/lodash.map/-/lodash.map-4.6.0.tgz", - "integrity": "sha1-dx7Hg540c9nEzeKLGTlMNWL09tM=", - "dev": true - }, "lodash.memoize": { "version": "4.1.2", "resolved": "https://registry.npmjs.org/lodash.memoize/-/lodash.memoize-4.1.2.tgz", "integrity": "sha1-vMbEmkKihA7Zl/Mj6tpezRguC/4=" }, - "lodash.merge": { - "version": "4.6.2", - "resolved": "https://registry.npmjs.org/lodash.merge/-/lodash.merge-4.6.2.tgz", - "integrity": "sha512-0KpjqXRVvrYyCsX1swR/XTK0va6VQkQM6MNo7PqW77ByjAhoARA8EfrP1N4+KlKj8YS0ZUCtRT/YUuhyYDujIQ==", - "dev": true - }, "lodash.once": { "version": "4.1.1", "resolved": "https://registry.npmjs.org/lodash.once/-/lodash.once-4.1.1.tgz", "integrity": "sha1-DdOXEhPHxW34gJd9UEyI+0cal6w=" }, - "lodash.pick": { - "version": "4.4.0", - "resolved": "https://registry.npmjs.org/lodash.pick/-/lodash.pick-4.4.0.tgz", - "integrity": "sha1-UvBWEP/53tQiYRRB7R/BI6AwAbM=", - "dev": true - }, - "lodash.reduce": { - "version": "4.6.0", - "resolved": "https://registry.npmjs.org/lodash.reduce/-/lodash.reduce-4.6.0.tgz", - "integrity": "sha1-8atrg5KZrUj3hKu/R2WW8DuRTTs=", - "dev": true - }, - "lodash.reject": { - "version": "4.6.0", - "resolved": "https://registry.npmjs.org/lodash.reject/-/lodash.reject-4.6.0.tgz", - "integrity": "sha1-gNZJLcFHCGS79YNTO2UfQqn1JBU=", - "dev": true - }, - "lodash.some": { - "version": "4.6.0", - "resolved": "https://registry.npmjs.org/lodash.some/-/lodash.some-4.6.0.tgz", - "integrity": "sha1-G7nzFO9ri63tE7VJFpsqlF62jk0=", - "dev": true - }, "lodash.sortby": { "version": "4.7.0", "resolved": "https://registry.npmjs.org/lodash.sortby/-/lodash.sortby-4.7.0.tgz", @@ -15497,6 +18725,12 @@ "yallist": "^4.0.0" } }, + "lunr": { + "version": "2.3.9", + "resolved": "https://registry.npmjs.org/lunr/-/lunr-2.3.9.tgz", + "integrity": "sha512-zTU3DaZaF3Rt9rhN3uBMGQD3dD2/vFQqnvZCDv4dl5iOzq2IZQqTxu90r4E5J+nP70J3ilqVCrbho2eWaeW8Ow==", + "dev": true + }, "lz-string": { "version": "1.4.4", "resolved": "https://registry.npmjs.org/lz-string/-/lz-string-1.4.4.tgz", @@ -15571,6 +18805,12 @@ "resolved": "https://registry.npmjs.org/markdown-escapes/-/markdown-escapes-1.0.4.tgz", "integrity": "sha512-8z4efJYk43E0upd0NbVXwgSTQs6cT3T06etieCMEg7dRbzCbxUCK/GHlX8mhHRDcp+OLlHkPKsvqQTCvsRl2cg==" }, + "marked": { + "version": "2.0.6", + "resolved": "https://registry.npmjs.org/marked/-/marked-2.0.6.tgz", + "integrity": "sha512-S2mYj0FzTQa0dLddssqwRVW4EOJOVJ355Xm2Vcbm+LU7GQRGWvwbO5K87OaPSOux2AwTSgtPPaXmc8sDPrhn2A==", + "dev": true + }, "martinez-polygon-clipping": { "version": "0.1.5", "resolved": "https://registry.npmjs.org/martinez-polygon-clipping/-/martinez-polygon-clipping-0.1.5.tgz", @@ -15642,23 +18882,6 @@ "integrity": "sha1-hxDXrwqmJvj/+hzgAWhUUmMlV0g=", "dev": true }, - "mediaquery-text": { - "version": "1.1.5", - "resolved": "https://registry.npmjs.org/mediaquery-text/-/mediaquery-text-1.1.5.tgz", - "integrity": "sha512-T27sUGebV4BhxKpvBThwlZHnMR5elqw4hDSXs0ohHBRGh7k79LaR3lmJHJlIjrNa+LHTl35OWUW56dSGtMNzXQ==", - "dev": true, - "requires": { - "cssom": "^0.4.4" - }, - "dependencies": { - "cssom": { - "version": "0.4.4", - "resolved": "https://registry.npmjs.org/cssom/-/cssom-0.4.4.tgz", - "integrity": "sha512-p3pvU7r1MyyqbTk+WbNJIgJjG2VmTIaB10rI93LzVPrmDJKkzKYMtxxyAvQXR/NS6otuzveI7+7BBq3SjBS2mw==", - "dev": true - } - } - }, "mem": { "version": "4.3.0", "resolved": "https://registry.npmjs.org/mem/-/mem-4.3.0.tgz", @@ -15693,28 +18916,6 @@ "is-what": "^3.3.1" } }, - "merge-deep": { - "version": "3.0.3", - "resolved": "https://registry.npmjs.org/merge-deep/-/merge-deep-3.0.3.tgz", - "integrity": "sha512-qtmzAS6t6grwEkNrunqTBdn0qKwFgNWvlxUbAV8es9M7Ot1EbyApytCnvE0jALPa46ZpKDUo527kKiaWplmlFA==", - "dev": true, - "requires": { - "arr-union": "^3.1.0", - "clone-deep": "^0.2.4", - "kind-of": "^3.0.2" - }, - "dependencies": { - "kind-of": { - "version": "3.2.2", - "resolved": "https://registry.npmjs.org/kind-of/-/kind-of-3.2.2.tgz", - "integrity": "sha1-MeohpzS6ubuw8yRm2JOupR5KPGQ=", - "dev": true, - "requires": { - "is-buffer": "^1.1.5" - } - } - } - }, "merge-descriptors": { "version": "1.0.1", "resolved": "https://registry.npmjs.org/merge-descriptors/-/merge-descriptors-1.0.1.tgz", @@ -15737,6 +18938,12 @@ "integrity": "sha1-VSmk1nZUE07cxSZmVoNbD4Ua/O4=", "dev": true }, + "microevent.ts": { + "version": "0.1.1", + "resolved": "https://registry.npmjs.org/microevent.ts/-/microevent.ts-0.1.1.tgz", + "integrity": "sha512-jo1OfR4TaEwd5HOrt5+tAZ9mqT4jmpNAusXtyfNzqVm9uiSYFZlKM1wYL4oU7azZW/PxQW53wM0S6OR1JHNa2g==", + "dev": true + }, "micromatch": { "version": "3.1.10", "resolved": "https://registry.npmjs.org/micromatch/-/micromatch-3.1.10.tgz", @@ -15765,6 +18972,14 @@ "requires": { "bn.js": "^4.0.0", "brorand": "^1.0.1" + }, + "dependencies": { + "bn.js": { + "version": "4.12.0", + "resolved": "https://registry.npmjs.org/bn.js/-/bn.js-4.12.0.tgz", + "integrity": "sha512-c98Bf3tPniI+scsdk237ku1Dc3ujXQTSgyiPUDEOe7tRkhrqridvh8klBv0HCEso1OLOYcHuCv/cS6DNxKH+ZA==", + "dev": true + } } }, "mime": { @@ -15838,12 +19053,14 @@ "minimalistic-assert": { "version": "1.0.1", "resolved": "https://registry.npmjs.org/minimalistic-assert/-/minimalistic-assert-1.0.1.tgz", - "integrity": "sha512-UtJcAD4yEaGtjPezWuO9wC4nwUnVH/8/Im3yEHQP4b67cXlD/Qr9hdITCU1xDbSEXg2XKNaP8jsReV7vQd00/A==" + "integrity": "sha512-UtJcAD4yEaGtjPezWuO9wC4nwUnVH/8/Im3yEHQP4b67cXlD/Qr9hdITCU1xDbSEXg2XKNaP8jsReV7vQd00/A==", + "dev": true }, "minimalistic-crypto-utils": { "version": "1.0.1", "resolved": "https://registry.npmjs.org/minimalistic-crypto-utils/-/minimalistic-crypto-utils-1.0.1.tgz", - "integrity": "sha1-9sAMHAsIIkblxNmd+4x8CDsrWCo=" + "integrity": "sha1-9sAMHAsIIkblxNmd+4x8CDsrWCo=", + "dev": true }, "minimatch": { "version": "3.0.4", @@ -15917,12 +19134,6 @@ "through2": "^2.0.0" } }, - "mitt": { - "version": "2.1.0", - "resolved": "https://registry.npmjs.org/mitt/-/mitt-2.1.0.tgz", - "integrity": "sha512-ILj2TpLiysu2wkBbWjAmww7TkZb65aiQO+DkVdUTBpBXq+MHYiETENkKFMtsJZX1Lf4pe4QOrTSjIfUwN5lRdg==", - "dev": true - }, "mixin-deep": { "version": "1.3.2", "resolved": "https://registry.npmjs.org/mixin-deep/-/mixin-deep-1.3.2.tgz", @@ -15942,24 +19153,6 @@ } } }, - "mixin-object": { - "version": "2.0.1", - "resolved": "https://registry.npmjs.org/mixin-object/-/mixin-object-2.0.1.tgz", - "integrity": "sha1-T7lJRB2rGCVA8f4DW6YOGUel5X4=", - "dev": true, - "requires": { - "for-in": "^0.1.3", - "is-extendable": "^0.1.1" - }, - "dependencies": { - "for-in": { - "version": "0.1.8", - "resolved": "https://registry.npmjs.org/for-in/-/for-in-0.1.8.tgz", - "integrity": "sha1-2Hc5COMSVhCZUrH9ubP6hn0ndeE=", - "dev": true - } - } - }, "mkdirp": { "version": "1.0.4", "resolved": "https://registry.npmjs.org/mkdirp/-/mkdirp-1.0.4.tgz", @@ -15968,7 +19161,8 @@ "mkdirp-classic": { "version": "0.5.3", "resolved": "https://registry.npmjs.org/mkdirp-classic/-/mkdirp-classic-0.5.3.tgz", - "integrity": "sha512-gKLcREMhtuZRwRAfqP3RFW+TK4JqApVBtOIftVgjuABpAtpxhPGaDcfvbhNvD0B8iD1oUr/txX35NjcaY6Ns/A==" + "integrity": "sha512-gKLcREMhtuZRwRAfqP3RFW+TK4JqApVBtOIftVgjuABpAtpxhPGaDcfvbhNvD0B8iD1oUr/txX35NjcaY6Ns/A==", + "optional": true }, "moment": { "version": "2.29.1", @@ -16030,9 +19224,9 @@ } }, "ms": { - "version": "2.1.2", - "resolved": "https://registry.npmjs.org/ms/-/ms-2.1.2.tgz", - "integrity": "sha512-sGkPx+VjMtmA6MX27oA4FBFELFCZZ4S4XqeGOXCv68tT+jb3vk/RyaKWP0PTKyWtmLSM0b+adUTEvbs1PEaH2w==" + "version": "2.1.3", + "resolved": "https://registry.npmjs.org/ms/-/ms-2.1.3.tgz", + "integrity": "sha512-6FlzubTLZG3J2a/NVCAleEhjzq5oxgHyaCU9yYXvcLsvoVaHJq/s5xXI6/XXP6tz7R9xAOtHnSO/tXtF3WRTlA==" }, "msal": { "version": "1.4.4", @@ -16069,6 +19263,11 @@ "integrity": "sha512-isWHgVjnFjh2x2yuJ/tj3JbwoHu3UC2dX5G/88Cm24yB6YopVgxvBObDY7n5xW6ExmFhJpSEQqFPvq9zaXc8Jw==", "optional": true }, + "nanoid": { + "version": "3.1.22", + "resolved": "https://registry.npmjs.org/nanoid/-/nanoid-3.1.22.tgz", + "integrity": "sha512-/2ZUaJX2ANuLtTvqTlgqBQNJoQO398KyJgZloL0PZkC0dpysjncRUPsFe3DUPzz/y3h+u7C46np8RMuvF3jsSQ==" + }, "nanomatch": { "version": "1.2.13", "resolved": "https://registry.npmjs.org/nanomatch/-/nanomatch-1.2.13.tgz", @@ -16128,12 +19327,6 @@ "integrity": "sha512-Yd3UES5mWCSqR+qNT93S3UoYUkqAZ9lLg8a7g9rimsWmYGK8cVToA4/sF3RrshdyV3sAGMXVUmpMYOw+dLpOuw==", "dev": true }, - "netmask": { - "version": "1.0.6", - "resolved": "https://registry.npmjs.org/netmask/-/netmask-1.0.6.tgz", - "integrity": "sha1-ICl+idhvb2QA8lDZ9Pa0wZRfzTU=", - "dev": true - }, "next-tick": { "version": "1.0.0", "resolved": "https://registry.npmjs.org/next-tick/-/next-tick-1.0.0.tgz", @@ -16167,18 +19360,18 @@ } }, "node-abi": { - "version": "2.19.3", - "resolved": "https://registry.npmjs.org/node-abi/-/node-abi-2.19.3.tgz", - "integrity": "sha512-9xZrlyfvKhWme2EXFKQhZRp1yNWT/uI1luYPr3sFl+H4keYY4xR+1jO7mvTTijIsHf1M+QDe9uWuKeEpLInIlg==", + "version": "2.26.0", + "resolved": "https://registry.npmjs.org/node-abi/-/node-abi-2.26.0.tgz", + "integrity": "sha512-ag/Vos/mXXpWLLAYWsAoQdgS+gW7IwvgMLOgqopm/DbzAjazLltzgzpVMsFlgmo9TzG5hGXeaBZx2AI731RIsQ==", "optional": true, "requires": { "semver": "^5.4.1" } }, "node-abort-controller": { - "version": "1.1.0", - "resolved": "https://registry.npmjs.org/node-abort-controller/-/node-abort-controller-1.1.0.tgz", - "integrity": "sha512-dEYmUqjtbivotqjraOe8UvhT/poFfog1BQRNsZm/MSEDDESk2cQ1tvD8kGyuN07TM/zoW+n42odL8zTeJupYdQ==" + "version": "1.2.1", + "resolved": "https://registry.npmjs.org/node-abort-controller/-/node-abort-controller-1.2.1.tgz", + "integrity": "sha512-79PYeJuj6S9+yOHirR0JBLFOgjB6sQCir10uN6xRx25iD+ZD4ULqgRn3MwWBRaQGB0vEgReJzWwJo42T1R6YbQ==" }, "node-fetch": { "version": "2.6.1", @@ -16291,6 +19484,15 @@ } } }, + "node-preload": { + "version": "0.2.1", + "resolved": "https://registry.npmjs.org/node-preload/-/node-preload-0.2.1.tgz", + "integrity": "sha512-RM5oyBy45cLEoHqCeh+MNuFAxO0vTFBLskvQbOKnEE7YTTSN4tbN8QWDIPQ6L+WvKsB/qLEGpYe2ZZ9d4W9OIQ==", + "dev": true, + "requires": { + "process-on-spawn": "^1.0.0" + } + }, "node-releases": { "version": "1.1.70", "resolved": "https://registry.npmjs.org/node-releases/-/node-releases-1.1.70.tgz", @@ -16303,6 +19505,14 @@ "integrity": "sha1-lKKxYzxPExdVMAfYlm/Q6EG2pMI=", "optional": true }, + "nopt": { + "version": "5.0.0", + "resolved": "https://registry.npmjs.org/nopt/-/nopt-5.0.0.tgz", + "integrity": "sha512-Tbj67rffqceeLpcRXrT7vKAN8CwfPeIBgM7E6iBkmKLV7bEMwpGgYLGv0jACUsECaa/vuxP0IjEont6umdMgtQ==", + "requires": { + "abbrev": "1" + } + }, "normalize-package-data": { "version": "2.5.0", "resolved": "https://registry.npmjs.org/normalize-package-data/-/normalize-package-data-2.5.0.tgz", @@ -16371,6 +19581,302 @@ "resolved": "https://registry.npmjs.org/nwsapi/-/nwsapi-2.2.0.tgz", "integrity": "sha512-h2AatdwYH+JHiZpv7pt/gSX1XoRGb7L/qSIeuqA6GwYoF9w1vP1cw42TO0aI2pNyshRK5893hNSl+1//vHK7hQ==" }, + "nyc": { + "version": "15.1.0", + "resolved": "https://registry.npmjs.org/nyc/-/nyc-15.1.0.tgz", + "integrity": "sha512-jMW04n9SxKdKi1ZMGhvUTHBN0EICCRkHemEoE5jm6mTYcqcdas0ATzgUgejlQUHMvpnOZqGB5Xxsv9KxJW1j8A==", + "dev": true, + "requires": { + "@istanbuljs/load-nyc-config": "^1.0.0", + "@istanbuljs/schema": "^0.1.2", + "caching-transform": "^4.0.0", + "convert-source-map": "^1.7.0", + "decamelize": "^1.2.0", + "find-cache-dir": "^3.2.0", + "find-up": "^4.1.0", + "foreground-child": "^2.0.0", + "get-package-type": "^0.1.0", + "glob": "^7.1.6", + "istanbul-lib-coverage": "^3.0.0", + "istanbul-lib-hook": "^3.0.0", + "istanbul-lib-instrument": "^4.0.0", + "istanbul-lib-processinfo": "^2.0.2", + "istanbul-lib-report": "^3.0.0", + "istanbul-lib-source-maps": "^4.0.0", + "istanbul-reports": "^3.0.2", + "make-dir": "^3.0.0", + "node-preload": "^0.2.1", + "p-map": "^3.0.0", + "process-on-spawn": "^1.0.0", + "resolve-from": "^5.0.0", + "rimraf": "^3.0.0", + "signal-exit": "^3.0.2", + "spawn-wrap": "^2.0.0", + "test-exclude": "^6.0.0", + "yargs": "^15.0.2" + }, + "dependencies": { + "ansi-regex": { + "version": "5.0.0", + "resolved": "https://registry.npmjs.org/ansi-regex/-/ansi-regex-5.0.0.tgz", + "integrity": "sha512-bY6fj56OUQ0hU1KjFNDQuJFezqKdrAyFdIevADiqrWHwSlbmBNMHp5ak2f40Pm8JTFyM2mqxkG6ngkHO11f/lg==", + "dev": true + }, + "ansi-styles": { + "version": "4.3.0", + "resolved": "https://registry.npmjs.org/ansi-styles/-/ansi-styles-4.3.0.tgz", + "integrity": "sha512-zbB9rCJAT1rbjiVDb2hqKFHNYLxgtk8NURxZ3IZwD3F6NtxbXZQCnnSi1Lkx+IDohdPlFp222wVALIheZJQSEg==", + "dev": true, + "requires": { + "color-convert": "^2.0.1" + } + }, + "cliui": { + "version": "6.0.0", + "resolved": "https://registry.npmjs.org/cliui/-/cliui-6.0.0.tgz", + "integrity": "sha512-t6wbgtoCXvAzst7QgXxJYqPt0usEfbgQdftEPbLL/cvv6HPE5VgvqCuAIDR0NgU52ds6rFwqrgakNLrHEjCbrQ==", + "dev": true, + "requires": { + "string-width": "^4.2.0", + "strip-ansi": "^6.0.0", + "wrap-ansi": "^6.2.0" + } + }, + "color-convert": { + "version": "2.0.1", + "resolved": "https://registry.npmjs.org/color-convert/-/color-convert-2.0.1.tgz", + "integrity": "sha512-RRECPsj7iu/xb5oKYcsFHSppFNnsj/52OVTRKb4zP5onXwVF3zVmmToNcOfGC+CRDpfK/U584fMg38ZHCaElKQ==", + "dev": true, + "requires": { + "color-name": "~1.1.4" + } + }, + "color-name": { + "version": "1.1.4", + "resolved": "https://registry.npmjs.org/color-name/-/color-name-1.1.4.tgz", + "integrity": "sha512-dOy+3AuW3a2wNbZHIuMZpTcgjGuLU/uBL/ubcZF9OXbDo8ff4O8yVp5Bf0efS8uEoYo5q4Fx7dY9OgQGXgAsQA==", + "dev": true + }, + "emoji-regex": { + "version": "8.0.0", + "resolved": "https://registry.npmjs.org/emoji-regex/-/emoji-regex-8.0.0.tgz", + "integrity": "sha512-MSjYzcWNOA0ewAHpz0MxpYFvwg6yjy1NG3xteoqz644VCo/RPgnr1/GGt+ic3iJTzQ8Eu3TdM14SawnVUmGE6A==", + "dev": true + }, + "find-up": { + "version": "4.1.0", + "resolved": "https://registry.npmjs.org/find-up/-/find-up-4.1.0.tgz", + "integrity": "sha512-PpOwAdQ/YlXQ2vj8a3h8IipDuYRi3wceVQQGYWxNINccq40Anw7BlsEXCMbt1Zt+OLA6Fq9suIpIWD0OsnISlw==", + "dev": true, + "requires": { + "locate-path": "^5.0.0", + "path-exists": "^4.0.0" + } + }, + "has-flag": { + "version": "4.0.0", + "resolved": "https://registry.npmjs.org/has-flag/-/has-flag-4.0.0.tgz", + "integrity": "sha512-EykJT/Q1KjTWctppgIAgfSO0tKVuZUjhgMr17kqTumMl6Afv3EISleU7qZUzoXDFTAHTDC4NOoG/ZxU3EvlMPQ==", + "dev": true + }, + "is-fullwidth-code-point": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/is-fullwidth-code-point/-/is-fullwidth-code-point-3.0.0.tgz", + "integrity": "sha512-zymm5+u+sCsSWyD9qNaejV3DFvhCKclKdizYaJUuHA83RLjb7nSuGnddCHGv0hk+KY7BMAlsWeK4Ueg6EV6XQg==", + "dev": true + }, + "istanbul-lib-coverage": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/istanbul-lib-coverage/-/istanbul-lib-coverage-3.0.0.tgz", + "integrity": "sha512-UiUIqxMgRDET6eR+o5HbfRYP1l0hqkWOs7vNxC/mggutCMUIhWMm8gAHb8tHlyfD3/l6rlgNA5cKdDzEAf6hEg==", + "dev": true + }, + "istanbul-lib-instrument": { + "version": "4.0.3", + "resolved": "https://registry.npmjs.org/istanbul-lib-instrument/-/istanbul-lib-instrument-4.0.3.tgz", + "integrity": "sha512-BXgQl9kf4WTCPCCpmFGoJkz/+uhvm7h7PFKUYxh7qarQd3ER33vHG//qaE8eN25l07YqZPpHXU9I09l/RD5aGQ==", + "dev": true, + "requires": { + "@babel/core": "^7.7.5", + "@istanbuljs/schema": "^0.1.2", + "istanbul-lib-coverage": "^3.0.0", + "semver": "^6.3.0" + } + }, + "istanbul-lib-report": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/istanbul-lib-report/-/istanbul-lib-report-3.0.0.tgz", + "integrity": "sha512-wcdi+uAKzfiGT2abPpKZ0hSU1rGQjUQnLvtY5MpQ7QCTahD3VODhcu4wcfY1YtkGaDD5yuydOLINXsfbus9ROw==", + "dev": true, + "requires": { + "istanbul-lib-coverage": "^3.0.0", + "make-dir": "^3.0.0", + "supports-color": "^7.1.0" + } + }, + "istanbul-lib-source-maps": { + "version": "4.0.0", + "resolved": "https://registry.npmjs.org/istanbul-lib-source-maps/-/istanbul-lib-source-maps-4.0.0.tgz", + "integrity": "sha512-c16LpFRkR8vQXyHZ5nLpY35JZtzj1PQY1iZmesUbf1FZHbIupcWfjgOXBY9YHkLEQ6puz1u4Dgj6qmU/DisrZg==", + "dev": true, + "requires": { + "debug": "^4.1.1", + "istanbul-lib-coverage": "^3.0.0", + "source-map": "^0.6.1" + } + }, + "istanbul-reports": { + "version": "3.0.2", + "resolved": "https://registry.npmjs.org/istanbul-reports/-/istanbul-reports-3.0.2.tgz", + "integrity": "sha512-9tZvz7AiR3PEDNGiV9vIouQ/EAcqMXFmkcA1CDFTwOB98OZVDL0PH9glHotf5Ugp6GCOTypfzGWI/OqjWNCRUw==", + "dev": true, + "requires": { + "html-escaper": "^2.0.0", + "istanbul-lib-report": "^3.0.0" + } + }, + "locate-path": { + "version": "5.0.0", + "resolved": "https://registry.npmjs.org/locate-path/-/locate-path-5.0.0.tgz", + "integrity": "sha512-t7hw9pI+WvuwNJXwk5zVHpyhIqzg2qTlklJOf0mVxGSbe3Fp2VieZcduNYjaLDoy6p9uGpQEGWG87WpMKlNq8g==", + "dev": true, + "requires": { + "p-locate": "^4.1.0" + } + }, + "make-dir": { + "version": "3.1.0", + "resolved": "https://registry.npmjs.org/make-dir/-/make-dir-3.1.0.tgz", + "integrity": "sha512-g3FeP20LNwhALb/6Cz6Dd4F2ngze0jz7tbzrD2wAV+o9FeNHe4rL+yK2md0J/fiSf1sa1ADhXqi5+oVwOM/eGw==", + "dev": true, + "requires": { + "semver": "^6.0.0" + } + }, + "p-locate": { + "version": "4.1.0", + "resolved": "https://registry.npmjs.org/p-locate/-/p-locate-4.1.0.tgz", + "integrity": "sha512-R79ZZ/0wAxKGu3oYMlz8jy/kbhsNrS7SKZ7PxEHBgJ5+F2mtFW2fK2cOtBh1cHYkQsbzFV7I+EoRKe6Yt0oK7A==", + "dev": true, + "requires": { + "p-limit": "^2.2.0" + } + }, + "p-map": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/p-map/-/p-map-3.0.0.tgz", + "integrity": "sha512-d3qXVTF/s+W+CdJ5A29wywV2n8CQQYahlgz2bFiA+4eVNJbHJodPZ+/gXwPGh0bOqA+j8S+6+ckmvLGPk1QpxQ==", + "dev": true, + "requires": { + "aggregate-error": "^3.0.0" + } + }, + "path-exists": { + "version": "4.0.0", + "resolved": "https://registry.npmjs.org/path-exists/-/path-exists-4.0.0.tgz", + "integrity": "sha512-ak9Qy5Q7jYb2Wwcey5Fpvg2KoAc/ZIhLSLOSBmRmygPsGwkVVt0fZa0qrtMz+m6tJTAHfZQ8FnmB4MG4LWy7/w==", + "dev": true + }, + "resolve-from": { + "version": "5.0.0", + "resolved": "https://registry.npmjs.org/resolve-from/-/resolve-from-5.0.0.tgz", + "integrity": "sha512-qYg9KP24dD5qka9J47d0aVky0N+b4fTU89LN9iDnjB5waksiC49rvMB0PrUJQGoTmH50XPiqOvAjDfaijGxYZw==", + "dev": true + }, + "semver": { + "version": "6.3.0", + "resolved": "https://registry.npmjs.org/semver/-/semver-6.3.0.tgz", + "integrity": "sha512-b39TBaTSfV6yBrapU89p5fKekE2m/NwnDocOVruQFS1/veMgdzuPcnOM34M6CwxW8jH/lxEa5rBoDeUwu5HHTw==", + "dev": true + }, + "source-map": { + "version": "0.6.1", + "resolved": "https://registry.npmjs.org/source-map/-/source-map-0.6.1.tgz", + "integrity": "sha512-UjgapumWlbMhkBgzT7Ykc5YXUT46F0iKu8SGXq0bcwP5dz/h0Plj6enJqjz1Zbq2l5WaqYnrVbwWOWMyF3F47g==", + "dev": true + }, + "string-width": { + "version": "4.2.2", + "resolved": "https://registry.npmjs.org/string-width/-/string-width-4.2.2.tgz", + "integrity": "sha512-XBJbT3N4JhVumXE0eoLU9DCjcaF92KLNqTmFCnG1pf8duUxFGwtP6AD6nkjw9a3IdiRtL3E2w3JDiE/xi3vOeA==", + "dev": true, + "requires": { + "emoji-regex": "^8.0.0", + "is-fullwidth-code-point": "^3.0.0", + "strip-ansi": "^6.0.0" + } + }, + "strip-ansi": { + "version": "6.0.0", + "resolved": "https://registry.npmjs.org/strip-ansi/-/strip-ansi-6.0.0.tgz", + "integrity": "sha512-AuvKTrTfQNYNIctbR1K/YGTR1756GycPsg7b9bdV9Duqur4gv6aKqHXah67Z8ImS7WEz5QVcOtlfW2rZEugt6w==", + "dev": true, + "requires": { + "ansi-regex": "^5.0.0" + } + }, + "supports-color": { + "version": "7.2.0", + "resolved": "https://registry.npmjs.org/supports-color/-/supports-color-7.2.0.tgz", + "integrity": "sha512-qpCAvRl9stuOHveKsn7HncJRvv501qIacKzQlO/+Lwxc9+0q2wLyv4Dfvt80/DPn2pqOBsJdDiogXGR9+OvwRw==", + "dev": true, + "requires": { + "has-flag": "^4.0.0" + } + }, + "test-exclude": { + "version": "6.0.0", + "resolved": "https://registry.npmjs.org/test-exclude/-/test-exclude-6.0.0.tgz", + "integrity": "sha512-cAGWPIyOHU6zlmg88jwm7VRyXnMN7iV68OGAbYDk/Mh/xC/pzVPlQtY6ngoIH/5/tciuhGfvESU8GrHrcxD56w==", + "dev": true, + "requires": { + "@istanbuljs/schema": "^0.1.2", + "glob": "^7.1.4", + "minimatch": "^3.0.4" + } + }, + "wrap-ansi": { + "version": "6.2.0", + "resolved": "https://registry.npmjs.org/wrap-ansi/-/wrap-ansi-6.2.0.tgz", + "integrity": "sha512-r6lPcBGxZXlIcymEu7InxDMhdW0KDxpLgoFLcguasxCaJ/SOIZwINatK9KY/tf+ZrlywOKU0UDj3ATXUBfxJXA==", + "dev": true, + "requires": { + "ansi-styles": "^4.0.0", + "string-width": "^4.1.0", + "strip-ansi": "^6.0.0" + } + }, + "yargs": { + "version": "15.4.1", + "resolved": "https://registry.npmjs.org/yargs/-/yargs-15.4.1.tgz", + "integrity": "sha512-aePbxDmcYW++PaqBsJ+HYUFwCdv4LVvdnhBy78E57PIor8/OVvhMrADFFEDh8DHDFRv/O9i3lPhsENjO7QX0+A==", + "dev": true, + "requires": { + "cliui": "^6.0.0", + "decamelize": "^1.2.0", + "find-up": "^4.1.0", + "get-caller-file": "^2.0.1", + "require-directory": "^2.1.1", + "require-main-filename": "^2.0.0", + "set-blocking": "^2.0.0", + "string-width": "^4.2.0", + "which-module": "^2.0.0", + "y18n": "^4.0.0", + "yargs-parser": "^18.1.2" + } + }, + "yargs-parser": { + "version": "18.1.3", + "resolved": "https://registry.npmjs.org/yargs-parser/-/yargs-parser-18.1.3.tgz", + "integrity": "sha512-o50j0JeToy/4K6OZcaQmW6lyXXKhq7csREXcDwk2omFPJEwUNOVtJKvmDr9EI1fAJZUyZcRF7kxGBWmRXudrCQ==", + "dev": true, + "requires": { + "camelcase": "^5.0.0", + "decamelize": "^1.2.0" + } + } + } + }, "oauth-sign": { "version": "0.9.0", "resolved": "https://registry.npmjs.org/oauth-sign/-/oauth-sign-0.9.0.tgz", @@ -16462,6 +19968,7 @@ "version": "1.1.0", "resolved": "https://registry.npmjs.org/object.entries/-/object.entries-1.1.0.tgz", "integrity": "sha512-l+H6EQ8qzGRxbkHOd5I/aHRhHDKoQXQ8g0BYt4uSweQU1/J6dZUOyWh9a2Vky35YCKjzmgxOzta2hH6kf9HuXA==", + "dev": true, "requires": { "define-properties": "^1.1.3", "es-abstract": "^1.12.0", @@ -16473,6 +19980,7 @@ "version": "1.17.7", "resolved": "https://registry.npmjs.org/es-abstract/-/es-abstract-1.17.7.tgz", "integrity": "sha512-VBl/gnfcJ7OercKA9MVaegWsBHFjV492syMudcnQZvt/Dw8ezpcOHYZXa/J96O8vx+g4x65YKhxOwDUh63aS5g==", + "dev": true, "requires": { "es-to-primitive": "^1.2.1", "function-bind": "^1.1.1", @@ -16544,51 +20052,6 @@ "integrity": "sha512-PX1wu0AmAdPqOL1mWhqmlOd8kOIZQwGZw6rh7uby9fTc5lhaOWFLX3I6R1hrF9k3zUY40e6igsLGkDXK92LJNg==", "dev": true }, - "office-ui-fabric-react": { - "version": "7.134.1", - "resolved": "https://registry.npmjs.org/office-ui-fabric-react/-/office-ui-fabric-react-7.134.1.tgz", - "integrity": "sha512-yQhPdt5kQfzI/MQnqQMu9lf2mgdHSogEfVIYgfOjbvfMJoUzqA/hH3X2Z7RbncdJ/ca2H+GXVp5GvSgahCOs6g==", - "requires": { - "@fluentui/date-time-utilities": "^7.7.0", - "@fluentui/react-focus": "^7.15.0", - "@fluentui/react-icons": "^0.3.0", - "@fluentui/react-window-provider": "^0.3.0", - "@microsoft/load-themed-styles": "^1.10.26", - "@uifabric/foundation": "^7.9.0", - "@uifabric/icons": "^7.5.0", - "@uifabric/merge-styles": "^7.18.0", - "@uifabric/react-hooks": "^7.11.0", - "@uifabric/set-version": "^7.0.22", - "@uifabric/styling": "^7.16.0", - "@uifabric/utilities": "^7.31.0", - "prop-types": "^15.7.2", - "tslib": "^1.10.0" - }, - "dependencies": { - "@fluentui/react-window-provider": { - "version": "0.3.3", - "resolved": "https://registry.npmjs.org/@fluentui/react-window-provider/-/react-window-provider-0.3.3.tgz", - "integrity": "sha512-MVPf2hqOQ17LAZsuvGcr3oOHksAskUm+fCYdXFhbVoAgsCDVTIuH6i8XgHFd6YjBtzjZmI4+k/3NTQfDqBX8EQ==", - "requires": { - "@uifabric/set-version": "^7.0.23", - "tslib": "^1.10.0" - } - }, - "@uifabric/styling": { - "version": "7.16.19", - "resolved": "https://registry.npmjs.org/@uifabric/styling/-/styling-7.16.19.tgz", - "integrity": "sha512-T5fjUCx0LbzUC8Myw15YCaBjdGbSrihWSiPHtLVW77k59yWAW947XnH73QngE8xU7kyKPH3AhQrUEBMB2NjHag==", - "requires": { - "@fluentui/theme": "^1.7.1", - "@microsoft/load-themed-styles": "^1.10.26", - "@uifabric/merge-styles": "^7.19.1", - "@uifabric/set-version": "^7.0.23", - "@uifabric/utilities": "^7.33.2", - "tslib": "^1.10.0" - } - } - } - }, "on-finished": { "version": "2.3.0", "resolved": "https://registry.npmjs.org/on-finished/-/on-finished-2.3.0.tgz", @@ -16621,6 +20084,32 @@ "mimic-fn": "^2.1.0" } }, + "onigasm": { + "version": "2.2.5", + "resolved": "https://registry.npmjs.org/onigasm/-/onigasm-2.2.5.tgz", + "integrity": "sha512-F+th54mPc0l1lp1ZcFMyL/jTs2Tlq4SqIHKIXGZOR/VkHkF9A7Fr5rRr5+ZG/lWeRsyrClLYRq7s/yFQ/XhWCA==", + "dev": true, + "requires": { + "lru-cache": "^5.1.1" + }, + "dependencies": { + "lru-cache": { + "version": "5.1.1", + "resolved": "https://registry.npmjs.org/lru-cache/-/lru-cache-5.1.1.tgz", + "integrity": "sha512-KpNARQA3Iwv+jTA0utUVVbrh+Jlrr1Fv0e56GGzAFOXN7dk/FviaDW8LHmK52DlcH4WP2n6gI8vN1aesBFgo9w==", + "dev": true, + "requires": { + "yallist": "^3.0.2" + } + }, + "yallist": { + "version": "3.1.1", + "resolved": "https://registry.npmjs.org/yallist/-/yallist-3.1.1.tgz", + "integrity": "sha512-a4UGQaWPH59mOXUYnAG2ewncQS4i4F43Tv3JoAM+s2VDAmS9NsK8GpDMLrCHPksFT7h3K6TOoUNn2pb7RoXx4g==", + "dev": true + } + } + }, "open": { "version": "7.3.1", "resolved": "https://registry.npmjs.org/open/-/open-7.3.1.tgz", @@ -16743,6 +20232,16 @@ "integrity": "sha512-x+12w/To+4GFfgJhBEpiDcLozRJGegY+Ei7/z0tSLkMmxGZNybVMSfWj9aJn8Z5Fc7dBUNJOOVgPv2H7IwulSQ==", "requires": { "p-limit": "^2.0.0" + }, + "dependencies": { + "p-limit": { + "version": "2.3.0", + "resolved": "https://registry.npmjs.org/p-limit/-/p-limit-2.3.0.tgz", + "integrity": "sha512-//88mFWSJx8lxCzwdAABTJL2MyWB12+eIY7MDL2SqLmAkeKU9qxRvWuSyTjm3FUmpBEMuFfckAIqEaVGUDxb6w==", + "requires": { + "p-try": "^2.0.0" + } + } } }, "p-map": { @@ -16772,32 +20271,16 @@ "resolved": "https://registry.npmjs.org/p-try/-/p-try-2.2.0.tgz", "integrity": "sha512-R4nPAVTAU0B9D35/Gk3uJf/7XYbQcyohSKdvAxIRSNghFl4e71hVoGnBNQz9cWaXxO2I10KTC+3jMdvvoKw6dQ==" }, - "pac-proxy-agent": { - "version": "4.1.0", - "resolved": "https://registry.npmjs.org/pac-proxy-agent/-/pac-proxy-agent-4.1.0.tgz", - "integrity": "sha512-ejNgYm2HTXSIYX9eFlkvqFp8hyJ374uDf0Zq5YUAifiSh1D6fo+iBivQZirGvVv8dCYUsLhmLBRhlAYvBKI5+Q==", + "package-hash": { + "version": "4.0.0", + "resolved": "https://registry.npmjs.org/package-hash/-/package-hash-4.0.0.tgz", + "integrity": "sha512-whdkPIooSu/bASggZ96BWVvZTRMOFxnyUG5PnTSGKoJE2gd5mbVNmR2Nj20QFzxYYgAXpoqC+AiXzl+UMRh7zQ==", "dev": true, "requires": { - "@tootallnate/once": "1", - "agent-base": "6", - "debug": "4", - "get-uri": "3", - "http-proxy-agent": "^4.0.1", - "https-proxy-agent": "5", - "pac-resolver": "^4.1.0", - "raw-body": "^2.2.0", - "socks-proxy-agent": "5" - } - }, - "pac-resolver": { - "version": "4.1.0", - "resolved": "https://registry.npmjs.org/pac-resolver/-/pac-resolver-4.1.0.tgz", - "integrity": "sha512-d6lf2IrZJJ7ooVHr7BfwSjRO1yKSJMaiiWYSHcrxSIUtZrCa4KKGwcztdkZ/E9LFleJfjoi1yl+XLR7AX24nbQ==", - "dev": true, - "requires": { - "degenerator": "^2.2.0", - "ip": "^1.1.5", - "netmask": "^1.0.6" + "graceful-fs": "^4.1.15", + "hasha": "^5.0.0", + "lodash.flattendeep": "^4.4.0", + "release-zalgo": "^1.0.0" } }, "pako": { @@ -16940,6 +20423,43 @@ "integrity": "sha512-CiyeOxFT/JZyN5m0z9PfXw4SCBJ6Sygz1Dpl0wqjlhDEGGBP1GnsUVEL0p63hoG1fcj3fHynXi9NYO4nWOL+qQ==", "dev": true }, + "pascal-case": { + "version": "3.1.2", + "resolved": "https://registry.npmjs.org/pascal-case/-/pascal-case-3.1.2.tgz", + "integrity": "sha512-uWlGT3YSnK9x3BQJaOdcZwrnV6hPpd8jFH1/ucpiLRPh/2zCVJKS19E4GvYHvaCcACn3foXZ0cLB9Wrx1KGe5g==", + "dev": true, + "requires": { + "no-case": "^3.0.4", + "tslib": "^2.0.3" + }, + "dependencies": { + "lower-case": { + "version": "2.0.2", + "resolved": "https://registry.npmjs.org/lower-case/-/lower-case-2.0.2.tgz", + "integrity": "sha512-7fm3l3NAF9WfN6W3JOmf5drwpVqX78JtoGJ3A6W0a6ZnldM41w2fV5D490psKFTpMds8TJse/eHLFFsNHHjHgg==", + "dev": true, + "requires": { + "tslib": "^2.0.3" + } + }, + "no-case": { + "version": "3.0.4", + "resolved": "https://registry.npmjs.org/no-case/-/no-case-3.0.4.tgz", + "integrity": "sha512-fgAN3jGAh+RoxUGZHTSOLJIqUc2wmoBwGR4tbpNAKmmovFoWq0OdRkb0VkldReO2a2iBT/OEulG9XSUc10r3zg==", + "dev": true, + "requires": { + "lower-case": "^2.0.2", + "tslib": "^2.0.3" + } + }, + "tslib": { + "version": "2.2.0", + "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.2.0.tgz", + "integrity": "sha512-gS9GVHRU+RGn5KQM2rllAlR3dU6m7AcpJKdtH8gFvQiC4Otgk98XnmMU+nZenHt/+VhnBPWwgrJsyrdcw6i23w==", + "dev": true + } + } + }, "pascalcase": { "version": "0.1.1", "resolved": "https://registry.npmjs.org/pascalcase/-/pascalcase-0.1.1.tgz", @@ -17031,9 +20551,9 @@ } }, "pbkdf2": { - "version": "3.1.1", - "resolved": "https://registry.npmjs.org/pbkdf2/-/pbkdf2-3.1.1.tgz", - "integrity": "sha512-4Ejy1OPxi9f2tt1rRV7Go7zmfDQ+ZectEQz3VGUQhgq62HtIRPDyG/JtnwIxs6x3uNMwo2V7q1fMvKjb+Tnpqg==", + "version": "3.1.2", + "resolved": "https://registry.npmjs.org/pbkdf2/-/pbkdf2-3.1.2.tgz", + "integrity": "sha512-iuh7L6jA7JEGu2WxDwtQP1ddOpaJNC4KlDEFfdQajSGgGPNi4OyDc2R7QnbY2bR9QjBVGwgvTdNJZoE7RaxUMA==", "dev": true, "requires": { "create-hash": "^1.1.2", @@ -17054,15 +20574,6 @@ "resolved": "https://registry.npmjs.org/performance-now/-/performance-now-2.1.0.tgz", "integrity": "sha1-Ywn04OX6kT7BxpMHrjZLSzd8nns=" }, - "pick-util": { - "version": "1.1.3", - "resolved": "https://registry.npmjs.org/pick-util/-/pick-util-1.1.3.tgz", - "integrity": "sha512-nQnaPOPjkXCCXBiUELsJrM795/mOQAHH4TyCdiS8mXL6ihj7sfyen/2rPfT8veWnnUnyFdWZawIiKMy7CD7wBQ==", - "dev": true, - "requires": { - "@jonkemp/package-utils": "^1.0.6" - } - }, "picomatch": { "version": "2.2.2", "resolved": "https://registry.npmjs.org/picomatch/-/picomatch-2.2.2.tgz", @@ -17102,6 +20613,75 @@ "find-up": "^3.0.0" } }, + "pkg-up": { + "version": "3.1.0", + "resolved": "https://registry.npmjs.org/pkg-up/-/pkg-up-3.1.0.tgz", + "integrity": "sha512-nDywThFk1i4BQK4twPQ6TA4RT8bDY96yeuCVBWL3ePARCiEKDRSrNGbFIgUJpLp+XeIR65v8ra7WuJOFUBtkMA==", + "dev": true, + "requires": { + "find-up": "^3.0.0" + } + }, + "playwright": { + "version": "1.13.0", + "resolved": "https://registry.npmjs.org/playwright/-/playwright-1.13.0.tgz", + "integrity": "sha512-GA5OyEeKx1v/pRcANmYncCT67Y7Y4N5zLRU5E690dn/Id10sooR5hQZmCDYsjXlutZb/1q0R3sITALnvhEjCjg==", + "dev": true, + "requires": { + "commander": "^6.1.0", + "debug": "^4.1.1", + "extract-zip": "^2.0.1", + "https-proxy-agent": "^5.0.0", + "jpeg-js": "^0.4.2", + "mime": "^2.4.6", + "pngjs": "^5.0.0", + "progress": "^2.0.3", + "proper-lockfile": "^4.1.1", + "proxy-from-env": "^1.1.0", + "rimraf": "^3.0.2", + "stack-utils": "^2.0.3", + "ws": "^7.4.6", + "yazl": "^2.5.1" + }, + "dependencies": { + "commander": { + "version": "6.2.1", + "resolved": "https://registry.npmjs.org/commander/-/commander-6.2.1.tgz", + "integrity": "sha512-U7VdrJFnJgo4xjrHpTzu0yrHPGImdsmD95ZlgYSEajAn2JKzDhDTPG9kBTefmObL2w/ngeZnilk+OV9CG3d7UA==", + "dev": true + }, + "escape-string-regexp": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/escape-string-regexp/-/escape-string-regexp-2.0.0.tgz", + "integrity": "sha512-UpzcLCXolUWcNu5HtVMHYdXJjArjsF9C0aNnquZYY4uW/Vu0miy5YoWvbV345HauVvcAUnpRuhMMcqTcGOY2+w==", + "dev": true + }, + "rimraf": { + "version": "3.0.2", + "resolved": "https://registry.npmjs.org/rimraf/-/rimraf-3.0.2.tgz", + "integrity": "sha512-JZkJMZkAGFFPP2YqXZXPbMlMBgsxzE8ILs4lMIX/2o0L9UBw9O/Y3o6wFw/i9YLapcUJWwqbi3kdxIPdC62TIA==", + "dev": true, + "requires": { + "glob": "^7.1.3" + } + }, + "stack-utils": { + "version": "2.0.3", + "resolved": "https://registry.npmjs.org/stack-utils/-/stack-utils-2.0.3.tgz", + "integrity": "sha512-gL//fkxfWUsIlFL2Tl42Cl6+HFALEaB1FU76I/Fy+oZjRreP7OPMXFlGbxM7NQsI0ZpUfw76sHnv0WNYuTb7Iw==", + "dev": true, + "requires": { + "escape-string-regexp": "^2.0.0" + } + }, + "ws": { + "version": "7.5.3", + "resolved": "https://registry.npmjs.org/ws/-/ws-7.5.3.tgz", + "integrity": "sha512-kQ/dHIzuLrS6Je9+uv81ueZomEwH0qVYstcAQ4/Z93K8zeko9gtAbttJWzoC5ukqXY1PpoouV3+VSOqEAFt5wg==", + "dev": true + } + } + }, "plotly.js-cartesian-dist-min": { "version": "1.52.3", "resolved": "https://registry.npmjs.org/plotly.js-cartesian-dist-min/-/plotly.js-cartesian-dist-min-1.52.3.tgz", @@ -17117,6 +20697,12 @@ "resolved": "https://registry.npmjs.org/pn/-/pn-1.1.0.tgz", "integrity": "sha512-2qHaIQr2VLRFoxe2nASzsV6ef4yOOH+Fi9FBOVH6cqeSgUnoyySPZkxzLuzd+RYOQTRpROA0ztTMqxROKSb/nA==" }, + "pngjs": { + "version": "5.0.0", + "resolved": "https://registry.npmjs.org/pngjs/-/pngjs-5.0.0.tgz", + "integrity": "sha512-40QW5YalBNfQo5yRYmiw7Yz6TKKVr3h6970B2YE+3fQpsWcrbj1PzJgxeJ19DRQjhMbKPIuMY8rFaXc8moolVw==", + "dev": true + }, "polygon-offset": { "version": "0.3.1", "resolved": "https://registry.npmjs.org/polygon-offset/-/polygon-offset-0.3.1.tgz", @@ -17166,28 +20752,37 @@ "resolved": "https://registry.npmjs.org/posix-character-classes/-/posix-character-classes-0.1.1.tgz", "integrity": "sha1-AerA/jta9xoqbAL+q7jB/vfgDqs=" }, - "postcss": { - "version": "7.0.35", - "resolved": "https://registry.npmjs.org/postcss/-/postcss-7.0.35.tgz", - "integrity": "sha512-3QT8bBJeX/S5zKTTjTCIjRF3If4avAT6kqxcASlTWEtAFCb9NH0OUxNDfgZSWdP5fJnBYCMEWkIFfWeugjzYMg==", + "post-robot": { + "version": "10.0.42", + "resolved": "https://registry.npmjs.org/post-robot/-/post-robot-10.0.42.tgz", + "integrity": "sha512-fuIuJblIbiAUJVKvttYZ1ZABhvrtAJgxZZ/TsWzzAdQGzkXOaewwgvFiGOSZRr0DywRaQs0Wvgxa7bFCYh8pfg==", "requires": { - "chalk": "^2.4.2", - "source-map": "^0.6.1", - "supports-color": "^6.1.0" + "belter": "^1.0.41", + "cross-domain-safe-weakmap": "^1.0.1", + "cross-domain-utils": "^2.0.0", + "universal-serialize": "^1.0.4", + "zalgo-promise": "^1.0.3" + } + }, + "postcss": { + "version": "8.2.10", + "resolved": "https://registry.npmjs.org/postcss/-/postcss-8.2.10.tgz", + "integrity": "sha512-b/h7CPV7QEdrqIxtAf2j31U5ef05uBDuvoXv6L51Q4rcS1jdlXAVKJv+atCFdUXYl9dyTHGyoMzIepwowRJjFw==", + "requires": { + "colorette": "^1.2.2", + "nanoid": "^3.1.22", + "source-map": "^0.6.1" }, "dependencies": { + "colorette": { + "version": "1.2.2", + "resolved": "https://registry.npmjs.org/colorette/-/colorette-1.2.2.tgz", + "integrity": "sha512-MKGMzyfeuutC/ZJ1cba9NqcNpfeqMUcYmyF1ZFY6/Cn7CNSAKx6a+s48sqLqyAiZuaP2TcqMhoo+dlwFnVxT9w==" + }, "source-map": { "version": "0.6.1", "resolved": "https://registry.npmjs.org/source-map/-/source-map-0.6.1.tgz", "integrity": "sha512-UjgapumWlbMhkBgzT7Ykc5YXUT46F0iKu8SGXq0bcwP5dz/h0Plj6enJqjz1Zbq2l5WaqYnrVbwWOWMyF3F47g==" - }, - "supports-color": { - "version": "6.1.0", - "resolved": "https://registry.npmjs.org/supports-color/-/supports-color-6.1.0.tgz", - "integrity": "sha512-qe1jfm1Mg7Nq/NSh6XE24gPXROEVsWHxC1LIx//XNlD9iw7YZQGjZNjYN7xGaEG6iKdA8EtNFW6R0gjnVXp+wQ==", - "requires": { - "has-flag": "^3.0.0" - } } } }, @@ -17418,6 +21013,15 @@ "resolved": "https://registry.npmjs.org/process-nextick-args/-/process-nextick-args-2.0.1.tgz", "integrity": "sha512-3ouUOpQhtgrbOa17J7+uxOTpITYWaGP7/AhoR3+A+/1e9skrzelGi/dXzEYyvbxubEF6Wn2ypscTKiKJFFn1ag==" }, + "process-on-spawn": { + "version": "1.0.0", + "resolved": "https://registry.npmjs.org/process-on-spawn/-/process-on-spawn-1.0.0.tgz", + "integrity": "sha512-1WsPDsUSMmZH5LeMLegqkPDrsGgsWwk1Exipy2hvB0o/F0ASzbpIctSCcZIK1ykJvtTJULEH+20WOFjMvGnCTg==", + "dev": true, + "requires": { + "fromentries": "^1.2.0" + } + }, "progress": { "version": "2.0.3", "resolved": "https://registry.npmjs.org/progress/-/progress-2.0.3.tgz", @@ -17439,41 +21043,6 @@ "resolved": "https://registry.npmjs.org/promise-inflight/-/promise-inflight-1.0.1.tgz", "integrity": "sha1-mEcocL8igTL8vdhoEputEsPAKeM=" }, - "promise-polyfill": { - "version": "8.1.0", - "resolved": "https://registry.npmjs.org/promise-polyfill/-/promise-polyfill-8.1.0.tgz", - "integrity": "sha512-OzSf6gcCUQ01byV4BgwyUCswlaQQ6gzXc23aLQWhicvfX9kfsUiUhgt3CCQej8jDnl8/PhGF31JdHX2/MzF3WA==" - }, - "promise.prototype.finally": { - "version": "3.1.0", - "resolved": "https://registry.npmjs.org/promise.prototype.finally/-/promise.prototype.finally-3.1.0.tgz", - "integrity": "sha512-7p/K2f6dI+dM8yjRQEGrTQs5hTQixUAdOGpMEA3+pVxpX5oHKRSKAXyLw9Q9HUWDTdwtoo39dSHGQtN90HcEwQ==", - "requires": { - "define-properties": "^1.1.2", - "es-abstract": "^1.9.0", - "function-bind": "^1.1.1" - }, - "dependencies": { - "es-abstract": { - "version": "1.17.7", - "resolved": "https://registry.npmjs.org/es-abstract/-/es-abstract-1.17.7.tgz", - "integrity": "sha512-VBl/gnfcJ7OercKA9MVaegWsBHFjV492syMudcnQZvt/Dw8ezpcOHYZXa/J96O8vx+g4x65YKhxOwDUh63aS5g==", - "requires": { - "es-to-primitive": "^1.2.1", - "function-bind": "^1.1.1", - "has": "^1.0.3", - "has-symbols": "^1.0.1", - "is-callable": "^1.2.2", - "is-regex": "^1.1.1", - "object-inspect": "^1.8.0", - "object-keys": "^1.1.1", - "object.assign": "^4.1.1", - "string.prototype.trimend": "^1.0.1", - "string.prototype.trimstart": "^1.0.1" - } - } - } - }, "prompts": { "version": "2.4.0", "resolved": "https://registry.npmjs.org/prompts/-/prompts-2.4.0.tgz", @@ -17504,6 +21073,17 @@ "reflect.ownkeys": "^0.2.0" } }, + "proper-lockfile": { + "version": "4.1.2", + "resolved": "https://registry.npmjs.org/proper-lockfile/-/proper-lockfile-4.1.2.tgz", + "integrity": "sha512-TjNPblN4BwAWMXU8s9AEz4JmQxnD1NNL7bNOY/AKUzyamc379FWASUhc/K1pL2noVb+XmZKLL68cjzLsiOAMaA==", + "dev": true, + "requires": { + "graceful-fs": "^4.2.4", + "retry": "^0.12.0", + "signal-exit": "^3.0.2" + } + }, "property-information": { "version": "5.6.0", "resolved": "https://registry.npmjs.org/property-information/-/property-information-5.6.0.tgz", @@ -17522,39 +21102,6 @@ "ipaddr.js": "1.9.1" } }, - "proxy-agent": { - "version": "4.0.1", - "resolved": "https://registry.npmjs.org/proxy-agent/-/proxy-agent-4.0.1.tgz", - "integrity": "sha512-ODnQnW2jc/FUVwHHuaZEfN5otg/fMbvMxz9nMSUQfJ9JU7q2SZvSULSsjLloVgJOiv9yhc8GlNMKc4GkFmcVEA==", - "dev": true, - "requires": { - "agent-base": "^6.0.0", - "debug": "4", - "http-proxy-agent": "^4.0.0", - "https-proxy-agent": "^5.0.0", - "lru-cache": "^5.1.1", - "pac-proxy-agent": "^4.1.0", - "proxy-from-env": "^1.0.0", - "socks-proxy-agent": "^5.0.0" - }, - "dependencies": { - "lru-cache": { - "version": "5.1.1", - "resolved": "https://registry.npmjs.org/lru-cache/-/lru-cache-5.1.1.tgz", - "integrity": "sha512-KpNARQA3Iwv+jTA0utUVVbrh+Jlrr1Fv0e56GGzAFOXN7dk/FviaDW8LHmK52DlcH4WP2n6gI8vN1aesBFgo9w==", - "dev": true, - "requires": { - "yallist": "^3.0.2" - } - }, - "yallist": { - "version": "3.1.1", - "resolved": "https://registry.npmjs.org/yallist/-/yallist-3.1.1.tgz", - "integrity": "sha512-a4UGQaWPH59mOXUYnAG2ewncQS4i4F43Tv3JoAM+s2VDAmS9NsK8GpDMLrCHPksFT7h3K6TOoUNn2pb7RoXx4g==", - "dev": true - } - } - }, "proxy-from-env": { "version": "1.1.0", "resolved": "https://registry.npmjs.org/proxy-from-env/-/proxy-from-env-1.1.0.tgz", @@ -17584,6 +21131,14 @@ "parse-asn1": "^5.0.0", "randombytes": "^2.0.1", "safe-buffer": "^5.1.2" + }, + "dependencies": { + "bn.js": { + "version": "4.12.0", + "resolved": "https://registry.npmjs.org/bn.js/-/bn.js-4.12.0.tgz", + "integrity": "sha512-c98Bf3tPniI+scsdk237ku1Dc3ujXQTSgyiPUDEOe7tRkhrqridvh8klBv0HCEso1OLOYcHuCv/cS6DNxKH+ZA==", + "dev": true + } } }, "pump": { @@ -17623,77 +21178,11 @@ "resolved": "https://registry.npmjs.org/punycode/-/punycode-2.1.1.tgz", "integrity": "sha512-XRsRjdf+j5ml+y/6GKHPZbrF/8p2Yga0JPtdqTIY2Xe5ohJPD9saDJJLPvp9+NSBprVvevdXZybnj2cv8OEd0A==" }, - "puppeteer": { - "version": "4.0.0", - "resolved": "https://registry.npmjs.org/puppeteer/-/puppeteer-4.0.0.tgz", - "integrity": "sha512-yNshT0M5DWfZ8DQoduZuGYpcwqXxKOZdgt5G0IF5VEKbydaDbWP/f5pQRfzQ4e+a4w0Rge3uzcogHeUPQM8nCA==", - "dev": true, - "requires": { - "debug": "^4.1.0", - "extract-zip": "^2.0.0", - "https-proxy-agent": "^4.0.0", - "mime": "^2.0.3", - "mitt": "^2.0.1", - "progress": "^2.0.1", - "proxy-from-env": "^1.0.0", - "rimraf": "^3.0.2", - "tar-fs": "^2.0.0", - "unbzip2-stream": "^1.3.3", - "ws": "^7.2.3" - }, - "dependencies": { - "agent-base": { - "version": "5.1.1", - "resolved": "https://registry.npmjs.org/agent-base/-/agent-base-5.1.1.tgz", - "integrity": "sha512-TMeqbNl2fMW0nMjTEPOwe3J/PRFP4vqeoNuQMG0HlMrtm5QxKqdvAkZ1pRBQ/ulIyDD5Yq0nJ7YbdD8ey0TO3g==", - "dev": true - }, - "https-proxy-agent": { - "version": "4.0.0", - "resolved": "https://registry.npmjs.org/https-proxy-agent/-/https-proxy-agent-4.0.0.tgz", - "integrity": "sha512-zoDhWrkR3of1l9QAL8/scJZyLu8j/gBkcwcaQOZh7Gyh/+uJQzGVETdgT30akuwkpL8HTRfssqI3BZuV18teDg==", - "dev": true, - "requires": { - "agent-base": "5", - "debug": "4" - } - }, - "rimraf": { - "version": "3.0.2", - "resolved": "https://registry.npmjs.org/rimraf/-/rimraf-3.0.2.tgz", - "integrity": "sha512-JZkJMZkAGFFPP2YqXZXPbMlMBgsxzE8ILs4lMIX/2o0L9UBw9O/Y3o6wFw/i9YLapcUJWwqbi3kdxIPdC62TIA==", - "dev": true, - "requires": { - "glob": "^7.1.3" - } - } - } - }, "pure-color": { "version": "1.3.0", "resolved": "https://registry.npmjs.org/pure-color/-/pure-color-1.3.0.tgz", "integrity": "sha1-H+Bk+wrIUfDeYTIKi/eWg2Qi8z4=" }, - "pvtsutils": { - "version": "1.1.1", - "resolved": "https://registry.npmjs.org/pvtsutils/-/pvtsutils-1.1.1.tgz", - "integrity": "sha512-Evbhe6L4Sxwu4SPLQ4LQZhgfWDQO3qa1lju9jM5cxsQp8vE10VipcSmo7hiJW48TmiHgVLgDtC2TL6/+ND+IVg==", - "requires": { - "tslib": "^2.0.3" - }, - "dependencies": { - "tslib": { - "version": "2.1.0", - "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.1.0.tgz", - "integrity": "sha512-hcVC3wYEziELGGmEEXue7D75zbwIIVUMWAVbHItGPx0ziyXxrOMQx4rQEVEV45Ut/1IotuEvwqPopzIOkDMf0A==" - } - } - }, - "pvutils": { - "version": "1.0.17", - "resolved": "https://registry.npmjs.org/pvutils/-/pvutils-1.0.17.tgz", - "integrity": "sha512-wLHYUQxWaXVQvKnwIDWFVKDJku9XDCvyhhxoq8dc5MFdIlRenyPI9eSfEtcvgHgD7FlvCyGAlWgOzRnZD99GZQ==" - }, "q": { "version": "1.5.1", "resolved": "https://registry.npmjs.org/q/-/q-1.5.1.tgz", @@ -17774,18 +21263,6 @@ "integrity": "sha512-Hrgsx+orqoygnmhFbKaHE6c296J+HTAQXoxEF6gNupROmmGJRoyzfG3ccAveqCBrwr/2yxQ5BVd/GTl5agOwSg==", "dev": true }, - "raw-body": { - "version": "2.4.1", - "resolved": "https://registry.npmjs.org/raw-body/-/raw-body-2.4.1.tgz", - "integrity": "sha512-9WmIKF6mkvA0SLmA2Knm9+qj89e+j1zqgyn8aXGd7+nAduPoqgI9lO57SAZNn/Byzo5P7JhXTyg9PzaJbH73bA==", - "dev": true, - "requires": { - "bytes": "3.1.0", - "http-errors": "1.7.3", - "iconv-lite": "0.4.24", - "unpipe": "1.0.0" - } - }, "raw-loader": { "version": "0.5.1", "resolved": "https://registry.npmjs.org/raw-loader/-/raw-loader-0.5.1.tgz", @@ -17865,6 +21342,225 @@ "tinycolor2": "^1.4.1" } }, + "react-dev-utils": { + "version": "11.0.4", + "resolved": "https://registry.npmjs.org/react-dev-utils/-/react-dev-utils-11.0.4.tgz", + "integrity": "sha512-dx0LvIGHcOPtKbeiSUM4jqpBl3TcY7CDjZdfOIcKeznE7BWr9dg0iPG90G5yfVQ+p/rGNMXdbfStvzQZEVEi4A==", + "dev": true, + "requires": { + "@babel/code-frame": "7.10.4", + "address": "1.1.2", + "browserslist": "4.14.2", + "chalk": "2.4.2", + "cross-spawn": "7.0.3", + "detect-port-alt": "1.1.6", + "escape-string-regexp": "2.0.0", + "filesize": "6.1.0", + "find-up": "4.1.0", + "fork-ts-checker-webpack-plugin": "4.1.6", + "global-modules": "2.0.0", + "globby": "11.0.1", + "gzip-size": "5.1.1", + "immer": "8.0.1", + "is-root": "2.1.0", + "loader-utils": "2.0.0", + "open": "^7.0.2", + "pkg-up": "3.1.0", + "prompts": "2.4.0", + "react-error-overlay": "^6.0.9", + "recursive-readdir": "2.2.2", + "shell-quote": "1.7.2", + "strip-ansi": "6.0.0", + "text-table": "0.2.0" + }, + "dependencies": { + "@babel/code-frame": { + "version": "7.10.4", + "resolved": "https://registry.npmjs.org/@babel/code-frame/-/code-frame-7.10.4.tgz", + "integrity": "sha512-vG6SvB6oYEhvgisZNFRmRCUkLz11c7rp+tbNTynGqc6mS1d5ATd/sGyV6W0KZZnXRKMTzZDRgQT3Ou9jhpAfUg==", + "dev": true, + "requires": { + "@babel/highlight": "^7.10.4" + } + }, + "ansi-regex": { + "version": "5.0.0", + "resolved": "https://registry.npmjs.org/ansi-regex/-/ansi-regex-5.0.0.tgz", + "integrity": "sha512-bY6fj56OUQ0hU1KjFNDQuJFezqKdrAyFdIevADiqrWHwSlbmBNMHp5ak2f40Pm8JTFyM2mqxkG6ngkHO11f/lg==", + "dev": true + }, + "browserslist": { + "version": "4.14.2", + "resolved": "https://registry.npmjs.org/browserslist/-/browserslist-4.14.2.tgz", + "integrity": "sha512-HI4lPveGKUR0x2StIz+2FXfDk9SfVMrxn6PLh1JeGUwcuoDkdKZebWiyLRJ68iIPDpMI4JLVDf7S7XzslgWOhw==", + "dev": true, + "requires": { + "caniuse-lite": "^1.0.30001125", + "electron-to-chromium": "^1.3.564", + "escalade": "^3.0.2", + "node-releases": "^1.1.61" + } + }, + "cross-spawn": { + "version": "7.0.3", + "resolved": "https://registry.npmjs.org/cross-spawn/-/cross-spawn-7.0.3.tgz", + "integrity": "sha512-iRDPJKUPVEND7dHPO8rkbOnPpyDygcDFtWjpeWNCgy8WP2rXcxXL8TskReQl6OrB2G7+UJrags1q15Fudc7G6w==", + "dev": true, + "requires": { + "path-key": "^3.1.0", + "shebang-command": "^2.0.0", + "which": "^2.0.1" + } + }, + "escape-string-regexp": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/escape-string-regexp/-/escape-string-regexp-2.0.0.tgz", + "integrity": "sha512-UpzcLCXolUWcNu5HtVMHYdXJjArjsF9C0aNnquZYY4uW/Vu0miy5YoWvbV345HauVvcAUnpRuhMMcqTcGOY2+w==", + "dev": true + }, + "filesize": { + "version": "6.1.0", + "resolved": "https://registry.npmjs.org/filesize/-/filesize-6.1.0.tgz", + "integrity": "sha512-LpCHtPQ3sFx67z+uh2HnSyWSLLu5Jxo21795uRDuar/EOuYWXib5EmPaGIBuSnRqH2IODiKA2k5re/K9OnN/Yg==", + "dev": true + }, + "find-up": { + "version": "4.1.0", + "resolved": "https://registry.npmjs.org/find-up/-/find-up-4.1.0.tgz", + "integrity": "sha512-PpOwAdQ/YlXQ2vj8a3h8IipDuYRi3wceVQQGYWxNINccq40Anw7BlsEXCMbt1Zt+OLA6Fq9suIpIWD0OsnISlw==", + "dev": true, + "requires": { + "locate-path": "^5.0.0", + "path-exists": "^4.0.0" + } + }, + "global-modules": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/global-modules/-/global-modules-2.0.0.tgz", + "integrity": "sha512-NGbfmJBp9x8IxyJSd1P+otYK8vonoJactOogrVfFRIAEY1ukil8RSKDz2Yo7wh1oihl51l/r6W4epkeKJHqL8A==", + "dev": true, + "requires": { + "global-prefix": "^3.0.0" + } + }, + "global-prefix": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/global-prefix/-/global-prefix-3.0.0.tgz", + "integrity": "sha512-awConJSVCHVGND6x3tmMaKcQvwXLhjdkmomy2W+Goaui8YPgYgXJZewhg3fWC+DlfqqQuWg8AwqjGTD2nAPVWg==", + "dev": true, + "requires": { + "ini": "^1.3.5", + "kind-of": "^6.0.2", + "which": "^1.3.1" + }, + "dependencies": { + "which": { + "version": "1.3.1", + "resolved": "https://registry.npmjs.org/which/-/which-1.3.1.tgz", + "integrity": "sha512-HxJdYWq1MTIQbJ3nw0cqssHoTNU267KlrDuGZ1WYlxDStUtKUhOaJmh112/TZmHxxUfuJqPXSOm7tDyas0OSIQ==", + "dev": true, + "requires": { + "isexe": "^2.0.0" + } + } + } + }, + "globby": { + "version": "11.0.1", + "resolved": "https://registry.npmjs.org/globby/-/globby-11.0.1.tgz", + "integrity": "sha512-iH9RmgwCmUJHi2z5o2l3eTtGBtXek1OYlHrbcxOYugyHLmAsZrPj43OtHThd62Buh/Vv6VyCBD2bdyWcGNQqoQ==", + "dev": true, + "requires": { + "array-union": "^2.1.0", + "dir-glob": "^3.0.1", + "fast-glob": "^3.1.1", + "ignore": "^5.1.4", + "merge2": "^1.3.0", + "slash": "^3.0.0" + } + }, + "loader-utils": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/loader-utils/-/loader-utils-2.0.0.tgz", + "integrity": "sha512-rP4F0h2RaWSvPEkD7BLDFQnvSf+nK+wr3ESUjNTyAGobqrijmW92zc+SO6d4p4B1wh7+B/Jg1mkQe5NYUEHtHQ==", + "dev": true, + "requires": { + "big.js": "^5.2.2", + "emojis-list": "^3.0.0", + "json5": "^2.1.2" + } + }, + "locate-path": { + "version": "5.0.0", + "resolved": "https://registry.npmjs.org/locate-path/-/locate-path-5.0.0.tgz", + "integrity": "sha512-t7hw9pI+WvuwNJXwk5zVHpyhIqzg2qTlklJOf0mVxGSbe3Fp2VieZcduNYjaLDoy6p9uGpQEGWG87WpMKlNq8g==", + "dev": true, + "requires": { + "p-locate": "^4.1.0" + } + }, + "p-locate": { + "version": "4.1.0", + "resolved": "https://registry.npmjs.org/p-locate/-/p-locate-4.1.0.tgz", + "integrity": "sha512-R79ZZ/0wAxKGu3oYMlz8jy/kbhsNrS7SKZ7PxEHBgJ5+F2mtFW2fK2cOtBh1cHYkQsbzFV7I+EoRKe6Yt0oK7A==", + "dev": true, + "requires": { + "p-limit": "^2.2.0" + } + }, + "path-exists": { + "version": "4.0.0", + "resolved": "https://registry.npmjs.org/path-exists/-/path-exists-4.0.0.tgz", + "integrity": "sha512-ak9Qy5Q7jYb2Wwcey5Fpvg2KoAc/ZIhLSLOSBmRmygPsGwkVVt0fZa0qrtMz+m6tJTAHfZQ8FnmB4MG4LWy7/w==", + "dev": true + }, + "path-key": { + "version": "3.1.1", + "resolved": "https://registry.npmjs.org/path-key/-/path-key-3.1.1.tgz", + "integrity": "sha512-ojmeN0qd+y0jszEtoY48r0Peq5dwMEkIlCOu6Q5f41lfkswXuKtYrhgoTpLnyIcHm24Uhqx+5Tqm2InSwLhE6Q==", + "dev": true + }, + "shebang-command": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/shebang-command/-/shebang-command-2.0.0.tgz", + "integrity": "sha512-kHxr2zZpYtdmrN1qDjrrX/Z1rR1kG8Dx+gkpK1G4eXmvXswmcE1hTWBWYUzlraYw1/yZp6YuDY77YtvbN0dmDA==", + "dev": true, + "requires": { + "shebang-regex": "^3.0.0" + } + }, + "shebang-regex": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/shebang-regex/-/shebang-regex-3.0.0.tgz", + "integrity": "sha512-7++dFhtcx3353uBaq8DDR4NuxBetBzC7ZQOhmTQInHEd6bSrXdiEyzCvG07Z44UYdLShWUyXt5M/yhz8ekcb1A==", + "dev": true + }, + "slash": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/slash/-/slash-3.0.0.tgz", + "integrity": "sha512-g9Q1haeby36OSStwb4ntCGGGaKsaVSjQ68fBxoQcutl5fS1vuY18H3wSt3jFyFtrkx+Kz0V1G85A4MyAdDMi2Q==", + "dev": true + }, + "strip-ansi": { + "version": "6.0.0", + "resolved": "https://registry.npmjs.org/strip-ansi/-/strip-ansi-6.0.0.tgz", + "integrity": "sha512-AuvKTrTfQNYNIctbR1K/YGTR1756GycPsg7b9bdV9Duqur4gv6aKqHXah67Z8ImS7WEz5QVcOtlfW2rZEugt6w==", + "dev": true, + "requires": { + "ansi-regex": "^5.0.0" + } + }, + "which": { + "version": "2.0.2", + "resolved": "https://registry.npmjs.org/which/-/which-2.0.2.tgz", + "integrity": "sha512-BLI3Tl1TW3Pvl70l3yq3Y64i+awpwXqsGBYWkkqMtnbXgrMD+yj7rhW0kuEDxzJaYXGjEW5ogapKNMEKNMjibA==", + "dev": true, + "requires": { + "isexe": "^2.0.0" + } + } + } + }, "react-dnd": { "version": "9.4.0", "resolved": "https://registry.npmjs.org/react-dnd/-/react-dnd-9.4.0.tgz", @@ -17907,6 +21603,12 @@ } } }, + "react-error-overlay": { + "version": "6.0.9", + "resolved": "https://registry.npmjs.org/react-error-overlay/-/react-error-overlay-6.0.9.tgz", + "integrity": "sha512-nQTTcUu+ATDbrSD1BZHr5kgSD4oF8OFjxun8uAaL8RwPBacGBNPf/yAuVVdx17N8XNzRDMrZ9XcKZHCjPW+9ew==", + "dev": true + }, "react-hot-loader": { "version": "4.13.0", "resolved": "https://registry.npmjs.org/react-hot-loader/-/react-hot-loader-4.13.0.tgz", @@ -18018,6 +21720,11 @@ "react-is": "^16.9.0" } }, + "react-splitter-layout": { + "version": "4.0.0", + "resolved": "https://registry.npmjs.org/react-splitter-layout/-/react-splitter-layout-4.0.0.tgz", + "integrity": "sha512-SLqOjBOxRuizWUa83w6q5/u9cDWa9/yj9Iko9V9JFN8x+cqIXiDlUFWSx+icz3IIgvsN/oRIw3za5/32RjIwrA==" + }, "react-syntax-highlighter": { "version": "12.2.1", "resolved": "https://registry.npmjs.org/react-syntax-highlighter/-/react-syntax-highlighter-12.2.1.tgz", @@ -18191,6 +21898,15 @@ "resolve": "^1.1.6" } }, + "recursive-readdir": { + "version": "2.2.2", + "resolved": "https://registry.npmjs.org/recursive-readdir/-/recursive-readdir-2.2.2.tgz", + "integrity": "sha512-nRCcW9Sj7NuZwa2XvH9co8NPeXUBhZP7CRKJtU+cS6PW9FpCIFoI5ib0NT1ZrbNuPoRy0ylyCaUL8Gih4LSyFg==", + "dev": true, + "requires": { + "minimatch": "3.0.4" + } + }, "redent": { "version": "3.0.0", "resolved": "https://registry.npmjs.org/redent/-/redent-3.0.0.tgz", @@ -18359,6 +22075,15 @@ "integrity": "sha1-VNvzd+UUQKypCkzSdGANP/LYiKk=", "dev": true }, + "release-zalgo": { + "version": "1.0.0", + "resolved": "https://registry.npmjs.org/release-zalgo/-/release-zalgo-1.0.0.tgz", + "integrity": "sha1-CXALflB0Mpc5Mw5TXFqQ+2eFFzA=", + "dev": true, + "requires": { + "es6-error": "^4.0.1" + } + }, "remark-parse": { "version": "5.0.0", "resolved": "https://registry.npmjs.org/remark-parse/-/remark-parse-5.0.0.tgz", @@ -18381,17 +22106,6 @@ "xtend": "^4.0.1" } }, - "remote-content": { - "version": "1.2.3", - "resolved": "https://registry.npmjs.org/remote-content/-/remote-content-1.2.3.tgz", - "integrity": "sha512-cxyyyURneyIeUHWLdQ+G3BLT9LP4KY0lljsuUHYh9XBVOB1R+ChmgjirEQKKE4CV9VlbqvtGZ2qOafufenoT+A==", - "dev": true, - "requires": { - "proxy-from-env": "^1.0.0", - "superagent": "^5.2.1", - "superagent-proxy": "^2.0.0" - } - }, "remove-trailing-separator": { "version": "1.1.0", "resolved": "https://registry.npmjs.org/remove-trailing-separator/-/remove-trailing-separator-1.1.0.tgz", @@ -18439,9 +22153,9 @@ }, "dependencies": { "domelementtype": { - "version": "2.1.0", - "resolved": "https://registry.npmjs.org/domelementtype/-/domelementtype-2.1.0.tgz", - "integrity": "sha512-LsTgx/L5VpD+Q8lmsXSHW2WpA+eBlZ9HPf3erD1IoPF00/3JKHZ3BknUVA2QGDNu69ZNmyFmCWBSO45XjYKC5w==", + "version": "2.2.0", + "resolved": "https://registry.npmjs.org/domelementtype/-/domelementtype-2.2.0.tgz", + "integrity": "sha512-DtBMo82pv1dFtUmHyr48beiuq792Sxohr+8Hm9zoxklYPfa6n0Z3Byjj2IV7bmr2IyqClnqEQhfgHJJ5QF0R5A==", "dev": true } } @@ -18751,12 +22465,6 @@ "resolved": "https://registry.npmjs.org/rw/-/rw-1.3.3.tgz", "integrity": "sha1-P4Yt+pGrdmsUiF700BEkv9oHT7Q=" }, - "rx": { - "version": "4.1.0", - "resolved": "https://registry.npmjs.org/rx/-/rx-4.1.0.tgz", - "integrity": "sha1-pfE/957zt0D+MKqAP7CfmIBdR4I=", - "dev": true - }, "rx-jupyter": { "version": "5.5.12", "resolved": "https://registry.npmjs.org/rx-jupyter/-/rx-jupyter-5.5.12.tgz", @@ -18820,14 +22528,29 @@ } }, "sanitize-html": { - "version": "1.27.5", - "resolved": "https://registry.npmjs.org/sanitize-html/-/sanitize-html-1.27.5.tgz", - "integrity": "sha512-M4M5iXDAUEcZKLXkmk90zSYWEtk5NH3JmojQxKxV371fnMh+x9t1rqdmXaGoyEHw3z/X/8vnFhKjGL5xFGOJ3A==", + "version": "2.3.3", + "resolved": "https://registry.npmjs.org/sanitize-html/-/sanitize-html-2.3.3.tgz", + "integrity": "sha512-DCFXPt7Di0c6JUnlT90eIgrjs6TsJl/8HYU3KLdmrVclFN4O0heTcVbJiMa23OKVr6aR051XYtsgd8EWwEBwUA==", "requires": { - "htmlparser2": "^4.1.0", - "lodash": "^4.17.15", + "deepmerge": "^4.2.2", + "escape-string-regexp": "^4.0.0", + "htmlparser2": "^6.0.0", + "is-plain-object": "^5.0.0", + "klona": "^2.0.3", "parse-srcset": "^1.0.2", - "postcss": "^7.0.27" + "postcss": "^8.0.2" + }, + "dependencies": { + "escape-string-regexp": { + "version": "4.0.0", + "resolved": "https://registry.npmjs.org/escape-string-regexp/-/escape-string-regexp-4.0.0.tgz", + "integrity": "sha512-TtpcNJ3XAzx3Gq8sWRzJaVajRs0uVxA2YAkdb1jm2YkPz4G6egUFAyA3n5vtEIZefPk5Wa4UXbKuS5fKkJWdgA==" + }, + "is-plain-object": { + "version": "5.0.0", + "resolved": "https://registry.npmjs.org/is-plain-object/-/is-plain-object-5.0.0.tgz", + "integrity": "sha512-VRSzKkbMm5jMDoKLbltAkFQ5Qr7VDiTFGXxYFXXowVj387GeGNOCsOH6Msy00SGZ3Fp84b1Naa1psqgcCIEP5Q==" + } } }, "sax": { @@ -19179,35 +22902,6 @@ "safe-buffer": "^5.0.1" } }, - "shallow-clone": { - "version": "0.1.2", - "resolved": "https://registry.npmjs.org/shallow-clone/-/shallow-clone-0.1.2.tgz", - "integrity": "sha1-WQnodLp3EG1zrEFM/sH/yofZcGA=", - "dev": true, - "requires": { - "is-extendable": "^0.1.1", - "kind-of": "^2.0.1", - "lazy-cache": "^0.2.3", - "mixin-object": "^2.0.1" - }, - "dependencies": { - "kind-of": { - "version": "2.0.1", - "resolved": "https://registry.npmjs.org/kind-of/-/kind-of-2.0.1.tgz", - "integrity": "sha1-AY7HpM5+OobLkUG+UZ0kyPqpgbU=", - "dev": true, - "requires": { - "is-buffer": "^1.0.2" - } - }, - "lazy-cache": { - "version": "0.2.7", - "resolved": "https://registry.npmjs.org/lazy-cache/-/lazy-cache-0.2.7.tgz", - "integrity": "sha1-f+3fLctu23fRHvHRF6tf/fCrG2U=", - "dev": true - } - } - }, "shallowequal": { "version": "1.1.0", "resolved": "https://registry.npmjs.org/shallowequal/-/shallowequal-1.1.0.tgz", @@ -19226,11 +22920,38 @@ "resolved": "https://registry.npmjs.org/shebang-regex/-/shebang-regex-1.0.0.tgz", "integrity": "sha1-2kL0l0DAtC2yypcoVxyxkMmO/qM=" }, + "shell-quote": { + "version": "1.7.2", + "resolved": "https://registry.npmjs.org/shell-quote/-/shell-quote-1.7.2.tgz", + "integrity": "sha512-mRz/m/JVscCrkMyPqHc/bczi3OQHkLTqXHEFu0zDhK/qfv3UcOA4SVmRCLmos4bhjr9ekVQubj/R7waKapmiQg==", + "dev": true + }, + "shelljs": { + "version": "0.8.4", + "resolved": "https://registry.npmjs.org/shelljs/-/shelljs-0.8.4.tgz", + "integrity": "sha512-7gk3UZ9kOfPLIAbslLzyWeGiEqx9e3rxwZM0KE6EL8GlGwjym9Mrlx5/p33bWTu9YG6vcS4MBxYZDHYr5lr8BQ==", + "dev": true, + "requires": { + "glob": "^7.0.0", + "interpret": "^1.0.0", + "rechoir": "^0.6.2" + } + }, "shellwords": { "version": "0.1.1", "resolved": "https://registry.npmjs.org/shellwords/-/shellwords-0.1.1.tgz", "integrity": "sha512-vFwSUfQvqybiICwZY5+DAWIPLKsWO31Q91JSKl3UYv+K5c2QRPzn0qzec6QPu1Qc9eHYItiP3NdJqNVqetYAww==" }, + "shiki": { + "version": "0.9.3", + "resolved": "https://registry.npmjs.org/shiki/-/shiki-0.9.3.tgz", + "integrity": "sha512-NEjg1mVbAUrzRv2eIcUt3TG7X9svX7l3n3F5/3OdFq+/BxUdmBOeKGiH4icZJBLHy354Shnj6sfBTemea2e7XA==", + "dev": true, + "requires": { + "onigasm": "^2.2.5", + "vscode-textmate": "^5.2.0" + } + }, "shimmer": { "version": "1.2.1", "resolved": "https://registry.npmjs.org/shimmer/-/shimmer-1.2.1.tgz", @@ -19333,18 +23054,6 @@ } } }, - "slick": { - "version": "1.12.2", - "resolved": "https://registry.npmjs.org/slick/-/slick-1.12.2.tgz", - "integrity": "sha1-vQSN23TefRymkV+qSldXCzVQwtc=", - "dev": true - }, - "smart-buffer": { - "version": "4.1.0", - "resolved": "https://registry.npmjs.org/smart-buffer/-/smart-buffer-4.1.0.tgz", - "integrity": "sha512-iVICrxOzCynf/SNaBQCw34eM9jROU/s5rzIhpOvzhzuYHfJR/DhZfDkXiZSgKXfgv26HT3Yni3AV/DGw0cGnnw==", - "dev": true - }, "snapdragon": { "version": "0.8.2", "resolved": "https://registry.npmjs.org/snapdragon/-/snapdragon-0.8.2.tgz", @@ -19500,27 +23209,6 @@ } } }, - "socks": { - "version": "2.5.1", - "resolved": "https://registry.npmjs.org/socks/-/socks-2.5.1.tgz", - "integrity": "sha512-oZCsJJxapULAYJaEYBSzMcz8m3jqgGrHaGhkmU/o/PQfFWYWxkAaA0UMGImb6s6tEXfKi959X6VJjMMQ3P6TTQ==", - "dev": true, - "requires": { - "ip": "^1.1.5", - "smart-buffer": "^4.1.0" - } - }, - "socks-proxy-agent": { - "version": "5.0.0", - "resolved": "https://registry.npmjs.org/socks-proxy-agent/-/socks-proxy-agent-5.0.0.tgz", - "integrity": "sha512-lEpa1zsWCChxiynk+lCycKuC502RxDWLKJZoIhnxrWNjLSDGYRFflHA1/228VkRcnv9TIb8w98derGbpKxJRgA==", - "dev": true, - "requires": { - "agent-base": "6", - "debug": "4", - "socks": "^2.3.3" - } - }, "source-list-map": { "version": "2.0.1", "resolved": "https://registry.npmjs.org/source-list-map/-/source-list-map-2.0.1.tgz", @@ -19574,6 +23262,46 @@ "resolved": "https://registry.npmjs.org/sparkles/-/sparkles-1.0.1.tgz", "integrity": "sha512-dSO0DDYUahUt/0/pD/Is3VIm5TGJjludZ0HVymmhYF6eNA53PVLhnUk0znSYbH8IYBuJdCE+1luR22jNLMaQdw==" }, + "spawn-wrap": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/spawn-wrap/-/spawn-wrap-2.0.0.tgz", + "integrity": "sha512-EeajNjfN9zMnULLwhZZQU3GWBoFNkbngTUPfaawT4RkMiviTxcX0qfhVbGey39mfctfDHkWtuecgQ8NJcyQWHg==", + "dev": true, + "requires": { + "foreground-child": "^2.0.0", + "is-windows": "^1.0.2", + "make-dir": "^3.0.0", + "rimraf": "^3.0.0", + "signal-exit": "^3.0.2", + "which": "^2.0.1" + }, + "dependencies": { + "make-dir": { + "version": "3.1.0", + "resolved": "https://registry.npmjs.org/make-dir/-/make-dir-3.1.0.tgz", + "integrity": "sha512-g3FeP20LNwhALb/6Cz6Dd4F2ngze0jz7tbzrD2wAV+o9FeNHe4rL+yK2md0J/fiSf1sa1ADhXqi5+oVwOM/eGw==", + "dev": true, + "requires": { + "semver": "^6.0.0" + } + }, + "semver": { + "version": "6.3.0", + "resolved": "https://registry.npmjs.org/semver/-/semver-6.3.0.tgz", + "integrity": "sha512-b39TBaTSfV6yBrapU89p5fKekE2m/NwnDocOVruQFS1/veMgdzuPcnOM34M6CwxW8jH/lxEa5rBoDeUwu5HHTw==", + "dev": true + }, + "which": { + "version": "2.0.2", + "resolved": "https://registry.npmjs.org/which/-/which-2.0.2.tgz", + "integrity": "sha512-BLI3Tl1TW3Pvl70l3yq3Y64i+awpwXqsGBYWkkqMtnbXgrMD+yj7rhW0kuEDxzJaYXGjEW5ogapKNMEKNMjibA==", + "dev": true, + "requires": { + "isexe": "^2.0.0" + } + } + } + }, "spawnd": { "version": "4.4.0", "resolved": "https://registry.npmjs.org/spawnd/-/spawnd-4.4.0.tgz", @@ -19654,12 +23382,6 @@ } } }, - "specificity": { - "version": "0.3.2", - "resolved": "https://registry.npmjs.org/specificity/-/specificity-0.3.2.tgz", - "integrity": "sha512-Nc/QN/A425Qog7j9aHmwOrlwX2e7pNI47ciwxwy4jOlvbbMHkNNJchit+FX+UjF3IAdiaaV5BKeWuDUnws6G1A==", - "dev": true - }, "split-string": { "version": "3.1.0", "resolved": "https://registry.npmjs.org/split-string/-/split-string-3.1.0.tgz", @@ -19691,9 +23413,9 @@ } }, "ssri": { - "version": "8.0.0", - "resolved": "https://registry.npmjs.org/ssri/-/ssri-8.0.0.tgz", - "integrity": "sha512-aq/pz989nxVYwn16Tsbj1TqFpD5LLrQxHf5zaHuieFV+R0Bbr4y8qUsOA45hXT/N4/9UNXTarBjnjVmjSOVaAA==", + "version": "8.0.1", + "resolved": "https://registry.npmjs.org/ssri/-/ssri-8.0.1.tgz", + "integrity": "sha512-97qShzy1AiyxvPNIkLWoGua7xoQzzPjQ0HAH4B0rWKo7SZ6USuPcrUiAFrws0UH8RrbWmgq3LMTObhPIHbbBeQ==", "requires": { "minipass": "^3.1.1" } @@ -19926,136 +23648,6 @@ "resolved": "https://registry.npmjs.org/strip-json-comments/-/strip-json-comments-2.0.1.tgz", "integrity": "sha1-PFMZQukIwml8DsNEhYwobHygpgo=" }, - "style-data": { - "version": "1.4.7", - "resolved": "https://registry.npmjs.org/style-data/-/style-data-1.4.7.tgz", - "integrity": "sha512-JUm9y0IOnyaoQprqIEP7H3DtDOX8I7wfbkHPSdq2kRCXommqzvP+f+HNkM6F7gweOBRdFRcp/uoBPif02P/N/A==", - "dev": true, - "requires": { - "cheerio": "^0.22.0", - "mediaquery-text": "^1.1.5", - "pick-util": "^1.1.3" - }, - "dependencies": { - "cheerio": { - "version": "0.22.0", - "resolved": "https://registry.npmjs.org/cheerio/-/cheerio-0.22.0.tgz", - "integrity": "sha1-qbqoYKP5tZWmuBsahocxIe06Jp4=", - "dev": true, - "requires": { - "css-select": "~1.2.0", - "dom-serializer": "~0.1.0", - "entities": "~1.1.1", - "htmlparser2": "^3.9.1", - "lodash.assignin": "^4.0.9", - "lodash.bind": "^4.1.4", - "lodash.defaults": "^4.0.1", - "lodash.filter": "^4.4.0", - "lodash.flatten": "^4.2.0", - "lodash.foreach": "^4.3.0", - "lodash.map": "^4.4.0", - "lodash.merge": "^4.4.0", - "lodash.pick": "^4.2.1", - "lodash.reduce": "^4.4.0", - "lodash.reject": "^4.4.0", - "lodash.some": "^4.4.0" - } - }, - "css-select": { - "version": "1.2.0", - "resolved": "https://registry.npmjs.org/css-select/-/css-select-1.2.0.tgz", - "integrity": "sha1-KzoRBTnFNV8c2NMUYj6HCxIeyFg=", - "dev": true, - "requires": { - "boolbase": "~1.0.0", - "css-what": "2.1", - "domutils": "1.5.1", - "nth-check": "~1.0.1" - } - }, - "css-what": { - "version": "2.1.3", - "resolved": "https://registry.npmjs.org/css-what/-/css-what-2.1.3.tgz", - "integrity": "sha512-a+EPoD+uZiNfh+5fxw2nO9QwFa6nJe2Or35fGY6Ipw1R3R4AGz1d1TEZrCegvw2YTmZ0jXirGYlzxxpYSHwpEg==", - "dev": true - }, - "dom-serializer": { - "version": "0.1.1", - "resolved": "https://registry.npmjs.org/dom-serializer/-/dom-serializer-0.1.1.tgz", - "integrity": "sha512-l0IU0pPzLWSHBcieZbpOKgkIn3ts3vAh7ZuFyXNwJxJXk/c4Gwj9xaTJwIDVQCXawWD0qb3IzMGH5rglQaO0XA==", - "dev": true, - "requires": { - "domelementtype": "^1.3.0", - "entities": "^1.1.1" - } - }, - "domelementtype": { - "version": "1.3.1", - "resolved": "https://registry.npmjs.org/domelementtype/-/domelementtype-1.3.1.tgz", - "integrity": "sha512-BSKB+TSpMpFI/HOxCNr1O8aMOTZ8hT3pM3GQ0w/mWRmkhEDSFJkkyzz4XQsBV44BChwGkrDfMyjVD0eA2aFV3w==", - "dev": true - }, - "domhandler": { - "version": "2.4.2", - "resolved": "https://registry.npmjs.org/domhandler/-/domhandler-2.4.2.tgz", - "integrity": "sha512-JiK04h0Ht5u/80fdLMCEmV4zkNh2BcoMFBmZ/91WtYZ8qVXSKjiw7fXMgFPnHcSZgOo3XdinHvmnDUeMf5R4wA==", - "dev": true, - "requires": { - "domelementtype": "1" - } - }, - "domutils": { - "version": "1.5.1", - "resolved": "https://registry.npmjs.org/domutils/-/domutils-1.5.1.tgz", - "integrity": "sha1-3NhIiib1Y9YQeeSMn3t+Mjc2gs8=", - "dev": true, - "requires": { - "dom-serializer": "0", - "domelementtype": "1" - } - }, - "entities": { - "version": "1.1.2", - "resolved": "https://registry.npmjs.org/entities/-/entities-1.1.2.tgz", - "integrity": "sha512-f2LZMYl1Fzu7YSBKg+RoROelpOaNrcGmE9AZubeDfrCEia483oW4MI4VyFd5VNHIgQ/7qm1I0wUHK1eJnn2y2w==", - "dev": true - }, - "htmlparser2": { - "version": "3.10.1", - "resolved": "https://registry.npmjs.org/htmlparser2/-/htmlparser2-3.10.1.tgz", - "integrity": "sha512-IgieNijUMbkDovyoKObU1DUhm1iwNYE/fuifEoEHfd1oZKZDaONBSkal7Y01shxsM49R4XaMdGez3WnF9UfiCQ==", - "dev": true, - "requires": { - "domelementtype": "^1.3.1", - "domhandler": "^2.3.0", - "domutils": "^1.5.1", - "entities": "^1.1.1", - "inherits": "^2.0.1", - "readable-stream": "^3.1.1" - } - }, - "nth-check": { - "version": "1.0.2", - "resolved": "https://registry.npmjs.org/nth-check/-/nth-check-1.0.2.tgz", - "integrity": "sha512-WeBOdju8SnzPN5vTUJYxYUxLeXpCaVP5i5e0LF8fg7WORF2Wd7wFX/pk0tYZk7s8T+J7VLy0Da6J1+wCT0AtHg==", - "dev": true, - "requires": { - "boolbase": "~1.0.0" - } - }, - "readable-stream": { - "version": "3.6.0", - "resolved": "https://registry.npmjs.org/readable-stream/-/readable-stream-3.6.0.tgz", - "integrity": "sha512-BViHy7LKeTz4oNnkcLJ+lVSL6vpiFeX6/d3oSH8zCW7UxP2onchk+vTGB143xuFjHS3deTgkKoXXymXqymiIdA==", - "dev": true, - "requires": { - "inherits": "^2.0.3", - "string_decoder": "^1.1.1", - "util-deprecate": "^1.0.1" - } - } - } - }, "style-loader": { "version": "0.23.0", "resolved": "https://registry.npmjs.org/style-loader/-/style-loader-0.23.0.tgz", @@ -20108,79 +23700,6 @@ "resolved": "https://registry.npmjs.org/stylis-rule-sheet/-/stylis-rule-sheet-0.0.10.tgz", "integrity": "sha512-nTbZoaqoBnmK+ptANthb10ZRZOGC+EmTLLUxeYIuHNkEKcmKgXX1XWKkUBT2Ac4es3NybooPe0SmvKdhKJZAuw==" }, - "superagent": { - "version": "5.3.1", - "resolved": "https://registry.npmjs.org/superagent/-/superagent-5.3.1.tgz", - "integrity": "sha512-wjJ/MoTid2/RuGCOFtlacyGNxN9QLMgcpYLDQlWFIhhdJ93kNscFonGvrpAHSCVjRVj++DGCglocF7Aej1KHvQ==", - "dev": true, - "requires": { - "component-emitter": "^1.3.0", - "cookiejar": "^2.1.2", - "debug": "^4.1.1", - "fast-safe-stringify": "^2.0.7", - "form-data": "^3.0.0", - "formidable": "^1.2.2", - "methods": "^1.1.2", - "mime": "^2.4.6", - "qs": "^6.9.4", - "readable-stream": "^3.6.0", - "semver": "^7.3.2" - }, - "dependencies": { - "form-data": { - "version": "3.0.0", - "resolved": "https://registry.npmjs.org/form-data/-/form-data-3.0.0.tgz", - "integrity": "sha512-CKMFDglpbMi6PyN+brwB9Q/GOw0eAnsrEZDgcsH5Krhz5Od/haKHAX0NmQfha2zPPz0JpWzA7GJHGSnvCRLWsg==", - "dev": true, - "requires": { - "asynckit": "^0.4.0", - "combined-stream": "^1.0.8", - "mime-types": "^2.1.12" - } - }, - "readable-stream": { - "version": "3.6.0", - "resolved": "https://registry.npmjs.org/readable-stream/-/readable-stream-3.6.0.tgz", - "integrity": "sha512-BViHy7LKeTz4oNnkcLJ+lVSL6vpiFeX6/d3oSH8zCW7UxP2onchk+vTGB143xuFjHS3deTgkKoXXymXqymiIdA==", - "dev": true, - "requires": { - "inherits": "^2.0.3", - "string_decoder": "^1.1.1", - "util-deprecate": "^1.0.1" - } - }, - "semver": { - "version": "7.3.4", - "resolved": "https://registry.npmjs.org/semver/-/semver-7.3.4.tgz", - "integrity": "sha512-tCfb2WLjqFAtXn4KEdxIhalnRtoKFN7nAwj0B3ZXCbQloV2tq5eDbcTmT68JJD3nRJq24/XgxtQKFIpQdtvmVw==", - "dev": true, - "requires": { - "lru-cache": "^6.0.0" - } - } - } - }, - "superagent-proxy": { - "version": "2.1.0", - "resolved": "https://registry.npmjs.org/superagent-proxy/-/superagent-proxy-2.1.0.tgz", - "integrity": "sha512-DnarpKN6Xn8e3pYlFV4Yvsj9yxLY4q5FIsUe5JvN7vjzP+YCfzXv03dTkZSD2yzrSadsNYHf0IgOUJwKjX457A==", - "dev": true, - "requires": { - "debug": "^3.1.0", - "proxy-agent": "^4.0.0" - }, - "dependencies": { - "debug": { - "version": "3.2.7", - "resolved": "https://registry.npmjs.org/debug/-/debug-3.2.7.tgz", - "integrity": "sha512-CFjzYYAi4ThfiQvizrFQevTTXHtnCqWfe7x1AhgEscTz6ZbLbfoLRLPugTQyBth6f8ZERVUSyWHFD/7Wu4t1XQ==", - "dev": true, - "requires": { - "ms": "^2.1.1" - } - } - } - }, "supports-color": { "version": "5.5.0", "resolved": "https://registry.npmjs.org/supports-color/-/supports-color-5.5.0.tgz", @@ -20332,6 +23851,7 @@ "version": "2.1.1", "resolved": "https://registry.npmjs.org/tar-fs/-/tar-fs-2.1.1.tgz", "integrity": "sha512-V0r2Y9scmbDRLCNex/+hYzvp/zyYjvFbHPNgVTKfQvVrb6guiE/fxP+XblDNR011utopbkex2nM4dHNV6GDsng==", + "optional": true, "requires": { "chownr": "^1.1.1", "mkdirp-classic": "^0.5.2", @@ -20343,6 +23863,7 @@ "version": "2.2.0", "resolved": "https://registry.npmjs.org/tar-stream/-/tar-stream-2.2.0.tgz", "integrity": "sha512-ujeqbceABgwMZxEJnk2HDY2DlnUZ+9oEcb1KzTVfYHio0UE6dG71n60d8D2I4qNvleWrrXpmjpt7vZeF1LnMZQ==", + "optional": true, "requires": { "bl": "^4.0.3", "end-of-stream": "^1.4.1", @@ -20355,6 +23876,7 @@ "version": "3.6.0", "resolved": "https://registry.npmjs.org/readable-stream/-/readable-stream-3.6.0.tgz", "integrity": "sha512-BViHy7LKeTz4oNnkcLJ+lVSL6vpiFeX6/d3oSH8zCW7UxP2onchk+vTGB143xuFjHS3deTgkKoXXymXqymiIdA==", + "optional": true, "requires": { "inherits": "^2.0.3", "string_decoder": "^1.1.1", @@ -20374,18 +23896,18 @@ }, "dependencies": { "ansi-escapes": { - "version": "4.3.1", - "resolved": "https://registry.npmjs.org/ansi-escapes/-/ansi-escapes-4.3.1.tgz", - "integrity": "sha512-JWF7ocqNrp8u9oqpgV+wH5ftbt+cfvv+PTjOvKLT3AdYly/LmORARfEVT1iyjwN+4MqE5UmVKoAdIBqeoCHgLA==", + "version": "4.3.2", + "resolved": "https://registry.npmjs.org/ansi-escapes/-/ansi-escapes-4.3.2.tgz", + "integrity": "sha512-gKXj5ALrKWQLsYG9jlTRmR/xKluxHV+Z9QEwNIgCfM1/uwPMCuzVVnh5mwTd+OuBZcwSIMbqssNWRm1lE51QaQ==", "dev": true, "requires": { - "type-fest": "^0.11.0" + "type-fest": "^0.21.3" } }, "type-fest": { - "version": "0.11.0", - "resolved": "https://registry.npmjs.org/type-fest/-/type-fest-0.11.0.tgz", - "integrity": "sha512-OdjXJxnCN1AvyLSzeKIgXTXxV+99ZuXl3Hpo9XpJAv9MBcHrrJOQ5kV7ypXOuQie+AmWG25hLbiKdwYTifzcfQ==", + "version": "0.21.3", + "resolved": "https://registry.npmjs.org/type-fest/-/type-fest-0.21.3.tgz", + "integrity": "sha512-t0rzBq87m3fVcduHDUFhKmyyX+9eo6WQjZvf51Ea/M0Q7+T374Jp1aUiyUl0GKxp8M/OETVHSDvmkyPgvX+X2w==", "dev": true } } @@ -20394,7 +23916,6 @@ "version": "4.8.0", "resolved": "https://registry.npmjs.org/terser/-/terser-4.8.0.tgz", "integrity": "sha512-EAPipTNeWsb/3wLPeup1tVPaXfIaU68xMnVdPafIL1TV05OhASArYyIfFvnvJCNrR2NIOvDVNNTFRa+Re2MWyw==", - "dev": true, "requires": { "commander": "^2.20.0", "source-map": "~0.6.1", @@ -20404,39 +23925,35 @@ "source-map": { "version": "0.6.1", "resolved": "https://registry.npmjs.org/source-map/-/source-map-0.6.1.tgz", - "integrity": "sha512-UjgapumWlbMhkBgzT7Ykc5YXUT46F0iKu8SGXq0bcwP5dz/h0Plj6enJqjz1Zbq2l5WaqYnrVbwWOWMyF3F47g==", - "dev": true + "integrity": "sha512-UjgapumWlbMhkBgzT7Ykc5YXUT46F0iKu8SGXq0bcwP5dz/h0Plj6enJqjz1Zbq2l5WaqYnrVbwWOWMyF3F47g==" } } }, "terser-webpack-plugin": { - "version": "3.0.5", - "resolved": "https://registry.npmjs.org/terser-webpack-plugin/-/terser-webpack-plugin-3.0.5.tgz", - "integrity": "sha512-pyHUyfQUZB3ciYL81GgXzDh8Qb3fGED77xDjZVSFYSN1cQnWgC51OMPKj7vBWVZx0GGuYhpa9+Vz2KxkzXWhBA==", - "dev": true, + "version": "3.1.0", + "resolved": "https://registry.npmjs.org/terser-webpack-plugin/-/terser-webpack-plugin-3.1.0.tgz", + "integrity": "sha512-cjdZte66fYkZ65rQ2oJfrdCAkkhJA7YLYk5eGOcGCSGlq0ieZupRdjedSQXYknMPo2IveQL+tPdrxUkERENCFA==", "requires": { - "cacache": "^15.0.4", + "cacache": "^15.0.5", "find-cache-dir": "^3.3.1", - "jest-worker": "^26.0.0", - "p-limit": "^3.0.1", + "jest-worker": "^26.2.1", + "p-limit": "^3.0.2", "schema-utils": "^2.6.6", "serialize-javascript": "^4.0.0", "source-map": "^0.6.1", - "terser": "^4.6.13", + "terser": "^4.8.0", "webpack-sources": "^1.4.3" }, "dependencies": { "has-flag": { "version": "4.0.0", "resolved": "https://registry.npmjs.org/has-flag/-/has-flag-4.0.0.tgz", - "integrity": "sha512-EykJT/Q1KjTWctppgIAgfSO0tKVuZUjhgMr17kqTumMl6Afv3EISleU7qZUzoXDFTAHTDC4NOoG/ZxU3EvlMPQ==", - "dev": true + "integrity": "sha512-EykJT/Q1KjTWctppgIAgfSO0tKVuZUjhgMr17kqTumMl6Afv3EISleU7qZUzoXDFTAHTDC4NOoG/ZxU3EvlMPQ==" }, "jest-worker": { "version": "26.6.2", "resolved": "https://registry.npmjs.org/jest-worker/-/jest-worker-26.6.2.tgz", "integrity": "sha512-KWYVV1c4i+jbMpaBC+U++4Va0cp8OisU185o73T1vo99hqi7w8tSJfUXYswwqqrjzwxa6KpRK54WhPvwf5w6PQ==", - "dev": true, "requires": { "@types/node": "*", "merge-stream": "^2.0.0", @@ -20447,7 +23964,6 @@ "version": "3.1.0", "resolved": "https://registry.npmjs.org/p-limit/-/p-limit-3.1.0.tgz", "integrity": "sha512-TYOanM3wGwNGsZN2cVTYPArw454xnXj5qmWF1bEoAc4+cU/ol7GVh7odevjp1FNHduHc3KZMcFduxU5Xc6uJRQ==", - "dev": true, "requires": { "yocto-queue": "^0.1.0" } @@ -20456,7 +23972,6 @@ "version": "4.0.0", "resolved": "https://registry.npmjs.org/serialize-javascript/-/serialize-javascript-4.0.0.tgz", "integrity": "sha512-GaNA54380uFefWghODBWEGisLZFj00nS5ACs6yHa9nLqlLpVLO8ChDGeKRjZnV4Nh4n0Qi7nhYZD/9fCPzEqkw==", - "dev": true, "requires": { "randombytes": "^2.1.0" } @@ -20464,14 +23979,12 @@ "source-map": { "version": "0.6.1", "resolved": "https://registry.npmjs.org/source-map/-/source-map-0.6.1.tgz", - "integrity": "sha512-UjgapumWlbMhkBgzT7Ykc5YXUT46F0iKu8SGXq0bcwP5dz/h0Plj6enJqjz1Zbq2l5WaqYnrVbwWOWMyF3F47g==", - "dev": true + "integrity": "sha512-UjgapumWlbMhkBgzT7Ykc5YXUT46F0iKu8SGXq0bcwP5dz/h0Plj6enJqjz1Zbq2l5WaqYnrVbwWOWMyF3F47g==" }, "supports-color": { "version": "7.2.0", "resolved": "https://registry.npmjs.org/supports-color/-/supports-color-7.2.0.tgz", "integrity": "sha512-qpCAvRl9stuOHveKsn7HncJRvv501qIacKzQlO/+Lwxc9+0q2wLyv4Dfvt80/DPn2pqOBsJdDiogXGR9+OvwRw==", - "dev": true, "requires": { "has-flag": "^4.0.0" } @@ -20489,11 +24002,6 @@ "require-main-filename": "^2.0.0" } }, - "text-encoding": { - "version": "0.7.0", - "resolved": "https://registry.npmjs.org/text-encoding/-/text-encoding-0.7.0.tgz", - "integrity": "sha512-oJQ3f1hrOnbRLOcwKz0Liq2IcrvDeZRHXhd9RgLrsT+DjWY/nty1Hi7v3dtkaEYbPYe0mUoOfzRrMwfXXwgPUA==" - }, "text-table": { "version": "0.2.0", "resolved": "https://registry.npmjs.org/text-table/-/text-table-0.2.0.tgz", @@ -20617,12 +24125,6 @@ "integrity": "sha512-yaOH/Pk/VEhBWWTlhI+qXxDFXlejDGcQipMlyxda9nthulaxLZUNcUqFxokp0vcYnvteJln5FNQDRrxj3YcbVw==", "dev": true }, - "toposort": { - "version": "1.0.7", - "resolved": "https://registry.npmjs.org/toposort/-/toposort-1.0.7.tgz", - "integrity": "sha1-LmhELZ9k7HILjMieZEOsbKqVACk=", - "dev": true - }, "tough-cookie": { "version": "3.0.1", "resolved": "https://registry.npmjs.org/tough-cookie/-/tough-cookie-3.0.1.tgz", @@ -20914,10 +24416,65 @@ "is-typedarray": "^1.0.0" } }, + "typedoc": { + "version": "0.20.36", + "resolved": "https://registry.npmjs.org/typedoc/-/typedoc-0.20.36.tgz", + "integrity": "sha512-qFU+DWMV/hifQ9ZAlTjdFO9wbUIHuUBpNXzv68ZyURAP9pInjZiO4+jCPeAzHVcaBCHER9WL/+YzzTt6ZlN/Nw==", + "dev": true, + "requires": { + "colors": "^1.4.0", + "fs-extra": "^9.1.0", + "handlebars": "^4.7.7", + "lodash": "^4.17.21", + "lunr": "^2.3.9", + "marked": "^2.0.3", + "minimatch": "^3.0.0", + "progress": "^2.0.3", + "shelljs": "^0.8.4", + "shiki": "^0.9.3", + "typedoc-default-themes": "^0.12.10" + }, + "dependencies": { + "fs-extra": { + "version": "9.1.0", + "resolved": "https://registry.npmjs.org/fs-extra/-/fs-extra-9.1.0.tgz", + "integrity": "sha512-hcg3ZmepS30/7BSFqRvoo3DOMQu7IjqxO5nCDt+zM9XWjb33Wg7ziNT+Qvqbuc3+gWpzO02JubVyk2G4Zvo1OQ==", + "dev": true, + "requires": { + "at-least-node": "^1.0.0", + "graceful-fs": "^4.2.0", + "jsonfile": "^6.0.1", + "universalify": "^2.0.0" + } + }, + "jsonfile": { + "version": "6.1.0", + "resolved": "https://registry.npmjs.org/jsonfile/-/jsonfile-6.1.0.tgz", + "integrity": "sha512-5dgndWOriYSm5cnYaJNhalLNDKOqFwyDB/rr1E9ZsGciGvKPs8R2xYGCacuf3z6K1YKDz182fd+fY3cn3pMqXQ==", + "dev": true, + "requires": { + "graceful-fs": "^4.1.6", + "universalify": "^2.0.0" + } + }, + "universalify": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/universalify/-/universalify-2.0.0.tgz", + "integrity": "sha512-hAZsKq7Yy11Zu1DE0OzWjw7nnLZmJZYTDZZyEFHZdUhV8FkH5MCfoU1XMaxXovpyW5nq5scPqq0ZDP9Zyl04oQ==", + "dev": true + } + } + }, + "typedoc-default-themes": { + "version": "0.12.10", + "resolved": "https://registry.npmjs.org/typedoc-default-themes/-/typedoc-default-themes-0.12.10.tgz", + "integrity": "sha512-fIS001cAYHkyQPidWXmHuhs8usjP5XVJjWB8oZGqkTowZaz3v7g3KDZeeqE82FBrmkAnIBOY3jgy7lnPnqATbA==", + "dev": true + }, "typescript": { - "version": "4.0.2", - "resolved": "https://registry.npmjs.org/typescript/-/typescript-4.0.2.tgz", - "integrity": "sha512-e4ERvRV2wb+rRZ/IQeb3jm2VxBsirQLpQhdxplZ2MEzGvDkkMmPglecnNDfSUBivMjP93vRbngYYDQqQ/78bcQ==", + "version": "4.3.4", + "resolved": "https://registry.npmjs.org/typescript/-/typescript-4.3.4.tgz", + "integrity": "sha512-uauPG7XZn9F/mo+7MrsRjyvbxFpzemRjKEZXS4AK83oP2KKOJPvb+9cO/gmnv8arWZvhnjVOXz7B49m1l0e9Ew==", "dev": true }, "typestyle": { @@ -20958,28 +24515,6 @@ "resolved": "https://registry.npmjs.org/uglify-save-license/-/uglify-save-license-0.4.1.tgz", "integrity": "sha1-lXJsF8xv0XHDYX479NjYKqjEzOE=" }, - "unbzip2-stream": { - "version": "1.4.3", - "resolved": "https://registry.npmjs.org/unbzip2-stream/-/unbzip2-stream-1.4.3.tgz", - "integrity": "sha512-mlExGW4w71ebDJviH16lQLtZS32VKqsSfk80GCfUlwT/4/hNRFsoscrF/c++9xinkMzECL1uL9DDwXqFWkruPg==", - "dev": true, - "requires": { - "buffer": "^5.2.1", - "through": "^2.3.8" - }, - "dependencies": { - "buffer": { - "version": "5.7.1", - "resolved": "https://registry.npmjs.org/buffer/-/buffer-5.7.1.tgz", - "integrity": "sha512-EHcyIPBQ4BSGlvjB16k5KgAJ27CIsHY/2JBmCRReo48y9rQ3MaUzWX3KVlBa4U7MyX02HdVj0K7C3WaB3ju7FQ==", - "dev": true, - "requires": { - "base64-js": "^1.3.1", - "ieee754": "^1.1.13" - } - } - } - }, "unc-path-regex": { "version": "0.1.2", "resolved": "https://registry.npmjs.org/unc-path-regex/-/unc-path-regex-0.1.2.tgz", @@ -21113,6 +24648,11 @@ "resolved": "https://registry.npmjs.org/unist-util-visit-parents/-/unist-util-visit-parents-1.1.2.tgz", "integrity": "sha512-yvo+MMLjEwdc3RhhPYSximset7rwjMrdt9E41Smmvg25UQIenzrN83cRnF1JMzoMi9zZOQeYXHSDf7p+IQkW3Q==" }, + "universal-serialize": { + "version": "1.0.8", + "resolved": "https://registry.npmjs.org/universal-serialize/-/universal-serialize-1.0.8.tgz", + "integrity": "sha512-AhC3D26asmMkxAadYjCUJh98AUV/Fpp9uStVz4OuigpaGqIwY+i95EWE392P+4ObOPFHw8TUk/GazyiSGDtxhA==" + }, "universal-user-agent": { "version": "5.0.0", "resolved": "https://registry.npmjs.org/universal-user-agent/-/universal-user-agent-5.0.0.tgz", @@ -21247,11 +24787,6 @@ "requires-port": "^1.0.0" } }, - "url-polyfill": { - "version": "1.1.7", - "resolved": "https://registry.npmjs.org/url-polyfill/-/url-polyfill-1.1.7.tgz", - "integrity": "sha512-ZrAxYWCREjmMtL8gSbSiKKLZZticgihCvVBtrFbUVpyoETt8GQJeG2okMWA8XryDAaHMjJfhnc+rnhXRbI4DXA==" - }, "use": { "version": "3.1.1", "resolved": "https://registry.npmjs.org/use/-/use-3.1.1.tgz", @@ -21424,6 +24959,12 @@ "resolved": "https://registry.npmjs.org/void-elements/-/void-elements-2.0.1.tgz", "integrity": "sha1-wGavtYK7HLQSjWDqkjkulNXp2+w=" }, + "vscode-textmate": { + "version": "5.4.0", + "resolved": "https://registry.npmjs.org/vscode-textmate/-/vscode-textmate-5.4.0.tgz", + "integrity": "sha512-c0Q4zYZkcLizeYJ3hNyaVUM2AA8KDhNCA3JvXY8CeZSJuBdAy3bAvSbv46RClC4P3dSO9BdwhnKEx2zOo6vP/w==", + "dev": true + }, "w3c-hr-time": { "version": "1.0.2", "resolved": "https://registry.npmjs.org/w3c-hr-time/-/w3c-hr-time-1.0.2.tgz", @@ -21644,74 +25185,15 @@ "minimalistic-assert": "^1.0.0" } }, - "webcrypto-core": { - "version": "1.1.9", - "resolved": "https://registry.npmjs.org/webcrypto-core/-/webcrypto-core-1.1.9.tgz", - "integrity": "sha512-Ac7yZQpz9+oDpKgltmHUb7Czlw6fahe9AhbBOkXkaU3y7vmvrRASNmU1T0VdH4iJsNEFgYh7R49qJjru4huzmw==", - "requires": { - "@peculiar/asn1-schema": "^2.0.12", - "@peculiar/json-schema": "^1.1.12", - "asn1js": "^2.0.26", - "pvtsutils": "^1.0.11", - "tslib": "^2.0.1" - }, - "dependencies": { - "@peculiar/asn1-schema": { - "version": "2.0.27", - "resolved": "https://registry.npmjs.org/@peculiar/asn1-schema/-/asn1-schema-2.0.27.tgz", - "integrity": "sha512-1tIx7iL3Ma3HtnNS93nB7nhyI0soUJypElj9owd4tpMrRDmeJ8eZubsdq1sb0KSaCs5RqZNoABCP6m5WtnlVhQ==", - "requires": { - "@types/asn1js": "^2.0.0", - "asn1js": "^2.0.26", - "pvtsutils": "^1.1.1", - "tslib": "^2.0.3" - } - }, - "tslib": { - "version": "2.1.0", - "resolved": "https://registry.npmjs.org/tslib/-/tslib-2.1.0.tgz", - "integrity": "sha512-hcVC3wYEziELGGmEEXue7D75zbwIIVUMWAVbHItGPx0ziyXxrOMQx4rQEVEV45Ut/1IotuEvwqPopzIOkDMf0A==" - } - } - }, - "webcrypto-liner": { - "version": "1.1.4", - "resolved": "https://registry.npmjs.org/webcrypto-liner/-/webcrypto-liner-1.1.4.tgz", - "integrity": "sha512-p4ovRsS8hIyG8KnW2FyrWZG4rZY5eHow5IlNiyOXeisE4gbX3FMZzJPej1dhdxL67111yf0zW2H24qt0ny+JHQ==", - "requires": { - "@peculiar/asn1-schema": "^1.0.3", - "@peculiar/json-schema": "^1.1.9", - "asmcrypto.js": "^2.3.2", - "asn1js": "^2.0.26", - "core-js": "^3.5.0", - "des.js": "^1.0.1", - "elliptic": "^6.5.2", - "pvtsutils": "^1.0.9", - "tslib": "^1.10.0", - "webcrypto-core": "^1.0.17" - }, - "dependencies": { - "core-js": { - "version": "3.8.3", - "resolved": "https://registry.npmjs.org/core-js/-/core-js-3.8.3.tgz", - "integrity": "sha512-KPYXeVZYemC2TkNEkX/01I+7yd+nX3KddKwZ1Ww7SKWdI2wQprSgLmrTddT8nw92AjEklTsPBoSdQBhbI1bQ6Q==" - } - } - }, - "webfontloader": { - "version": "1.6.28", - "resolved": "https://registry.npmjs.org/webfontloader/-/webfontloader-1.6.28.tgz", - "integrity": "sha1-23hhKSU8tujq5UwvsF+HCvZnW64=" - }, "webidl-conversions": { "version": "4.0.2", "resolved": "https://registry.npmjs.org/webidl-conversions/-/webidl-conversions-4.0.2.tgz", "integrity": "sha512-YQ+BmxuTgd6UXZW3+ICGfyqRyHXVlD5GtQr5+qjiNW7bF0cqrzX500HVXPBOvgXb5YnzDd+h0zqyv61KUD7+Sg==" }, "webpack": { - "version": "4.43.0", - "resolved": "https://registry.npmjs.org/webpack/-/webpack-4.43.0.tgz", - "integrity": "sha512-GW1LjnPipFW2Y78OOab8NJlCflB7EFskMih2AHdvjbpKMeDJqEgSx24cXXXiPS65+WSwVyxtDsJH6jGX2czy+g==", + "version": "4.46.0", + "resolved": "https://registry.npmjs.org/webpack/-/webpack-4.46.0.tgz", + "integrity": "sha512-6jJuJjg8znb/xRItk7bkT0+Q7AHCYjjFnvKIWQPkNIOyRqoCGvkOs0ipeQzrqz4l5FtN5ZI/ukEHroeX/o1/5Q==", "dev": true, "requires": { "@webassemblyjs/ast": "1.9.0", @@ -21722,7 +25204,7 @@ "ajv": "^6.10.2", "ajv-keywords": "^3.4.1", "chrome-trace-event": "^1.0.2", - "enhanced-resolve": "^4.1.0", + "enhanced-resolve": "^4.5.0", "eslint-scope": "^4.0.3", "json-parse-better-errors": "^1.0.2", "loader-runner": "^2.4.0", @@ -21735,7 +25217,7 @@ "schema-utils": "^1.0.0", "tapable": "^1.1.3", "terser-webpack-plugin": "^1.4.3", - "watchpack": "^1.6.1", + "watchpack": "^1.7.4", "webpack-sources": "^1.4.1" }, "dependencies": { @@ -21768,6 +25250,12 @@ "y18n": "^4.0.0" } }, + "chownr": { + "version": "1.1.4", + "resolved": "https://registry.npmjs.org/chownr/-/chownr-1.1.4.tgz", + "integrity": "sha512-jJ0bqzaylmJtVnNgzTeSOs8DPavpbYgEr/b0YL8/2GO3xJEhInFmhKMUnEJQjZumK7KXGFhUy89PrsJWlakBVg==", + "dev": true + }, "eslint-scope": { "version": "4.0.3", "resolved": "https://registry.npmjs.org/eslint-scope/-/eslint-scope-4.0.3.tgz", @@ -21859,9 +25347,9 @@ "dev": true }, "ssri": { - "version": "6.0.1", - "resolved": "https://registry.npmjs.org/ssri/-/ssri-6.0.1.tgz", - "integrity": "sha512-3Wge10hNcT1Kur4PDFwEieXSCMCJs/7WvSACcrMYrNp+b8kDL1/0wJch5Ni2WrtwEa2IO8OsVfeKIciKCDx/QA==", + "version": "6.0.2", + "resolved": "https://registry.npmjs.org/ssri/-/ssri-6.0.2.tgz", + "integrity": "sha512-cepbSq/neFK7xB6A50KHN0xHDotYzq58wWCa5LeWqnPrHG8GzfEjO/4O8kpmcGW+oaxkvhEJCWgbgNk4/ZV93Q==", "dev": true, "requires": { "figgy-pudding": "^3.5.1" @@ -22382,11 +25870,6 @@ "iconv-lite": "0.4.24" } }, - "whatwg-fetch": { - "version": "3.0.0", - "resolved": "https://registry.npmjs.org/whatwg-fetch/-/whatwg-fetch-3.0.0.tgz", - "integrity": "sha512-9GSJUgz1D4MfyKU7KRqwOjXCXTqWdFNvEr7eUBYchQiVc744mqK/MzXPNR2WsPkmkOa4ywfg8C2n8h+13Bey1Q==" - }, "whatwg-mimetype": { "version": "2.3.0", "resolved": "https://registry.npmjs.org/whatwg-mimetype/-/whatwg-mimetype-2.3.0.tgz", @@ -22443,6 +25926,12 @@ "resolved": "https://registry.npmjs.org/word-wrap/-/word-wrap-1.2.3.tgz", "integrity": "sha512-Hz/mrNwitNRh/HUAtM/VT/5VH+ygD6DV7mYKZAtHOrbs8U7lvPS6xf7EJKMF0uW1KJCl0H701g3ZGus+muE5vQ==" }, + "wordwrap": { + "version": "1.0.0", + "resolved": "https://registry.npmjs.org/wordwrap/-/wordwrap-1.0.0.tgz", + "integrity": "sha1-J1hIEIkUVqQXHI0CJkQa3pDLyus=", + "dev": true + }, "worker-farm": { "version": "1.7.0", "resolved": "https://registry.npmjs.org/worker-farm/-/worker-farm-1.7.0.tgz", @@ -22452,26 +25941,13 @@ "errno": "~0.1.7" } }, - "worker-loader": { - "version": "2.0.0", - "resolved": "https://registry.npmjs.org/worker-loader/-/worker-loader-2.0.0.tgz", - "integrity": "sha512-tnvNp4K3KQOpfRnD20m8xltE3eWh89Ye+5oj7wXEEHKac1P4oZ6p9oTj8/8ExqoSBnk9nu5Pr4nKfQ1hn2APJw==", + "worker-rpc": { + "version": "0.1.1", + "resolved": "https://registry.npmjs.org/worker-rpc/-/worker-rpc-0.1.1.tgz", + "integrity": "sha512-P1WjMrUB3qgJNI9jfmpZ/htmBEjFh//6l/5y8SD9hg1Ef5zTTVVoRjTrTEzPrNBQvmhMxkoTsjOXN10GWU7aCg==", "dev": true, "requires": { - "loader-utils": "^1.0.0", - "schema-utils": "^0.4.0" - }, - "dependencies": { - "schema-utils": { - "version": "0.4.7", - "resolved": "https://registry.npmjs.org/schema-utils/-/schema-utils-0.4.7.tgz", - "integrity": "sha512-v/iwU6wvwGK8HbU9yi3/nhGzP0yGSuhQMzL6ySiec1FSrZZDkhm4noOSWzrNFo/jEc+SJY6jRTwuwbSXJPDUnQ==", - "dev": true, - "requires": { - "ajv": "^6.1.0", - "ajv-keywords": "^3.1.0" - } - } + "microevent.ts": "~0.1.1" } }, "wrap-ansi": { @@ -22584,6 +26060,16 @@ "integrity": "sha512-JZnDKK8B0RCDw84FNdDAIpZK+JuJw+s7Lz8nksI7SIuU3UXJJslUthsi+uWBUYOwPFwW7W7PRLRfUKpxjtjFCw==", "dev": true }, + "xmldom": { + "version": "0.4.0", + "resolved": "https://registry.npmjs.org/xmldom/-/xmldom-0.4.0.tgz", + "integrity": "sha512-2E93k08T30Ugs+34HBSTQLVtpi6mCddaY8uO+pMNk1pqSjV5vElzn4mmh6KLxN3hki8rNcHSYzILoh3TEWORvA==" + }, + "xpath.js": { + "version": "1.1.0", + "resolved": "https://registry.npmjs.org/xpath.js/-/xpath.js-1.1.0.tgz", + "integrity": "sha512-jg+qkfS4K8E7965sqaUl8mRngXiKb3WZGfONgE18pr03FUQiuSV6G+Ej4tS55B+rIQSFEIw3phdVAQ4pPqNWfQ==" + }, "xregexp": { "version": "4.4.1", "resolved": "https://registry.npmjs.org/xregexp/-/xregexp-4.4.1.tgz", @@ -22683,11 +26169,29 @@ "fd-slicer": "~1.1.0" } }, + "yazl": { + "version": "2.5.1", + "resolved": "https://registry.npmjs.org/yazl/-/yazl-2.5.1.tgz", + "integrity": "sha512-phENi2PLiHnHb6QBVot+dJnaAZ0xosj7p3fWl+znIjBDlnMI2PsZCJZ306BPTFOaHf5qdDEI8x5qFrSOBN5vrw==", + "dev": true, + "requires": { + "buffer-crc32": "~0.2.3" + } + }, "yocto-queue": { "version": "0.1.0", "resolved": "https://registry.npmjs.org/yocto-queue/-/yocto-queue-0.1.0.tgz", - "integrity": "sha512-rVksvsnNCdJ/ohGc6xgPwyN8eheCxsiLM8mxuE/t/mOVqJewPuO1miLpTHQiRgTKCLexL4MeAFVagts7HmNZ2Q==", - "dev": true + "integrity": "sha512-rVksvsnNCdJ/ohGc6xgPwyN8eheCxsiLM8mxuE/t/mOVqJewPuO1miLpTHQiRgTKCLexL4MeAFVagts7HmNZ2Q==" + }, + "zalgo-promise": { + "version": "1.0.46", + "resolved": "https://registry.npmjs.org/zalgo-promise/-/zalgo-promise-1.0.46.tgz", + "integrity": "sha512-tzPpQRqaQQavxl17TY98nznvmr+judUg3My7ugsUcRDbdqisYOE2z79HNNDgXnyX3eA0mf2bMOJrqHptt00npg==" + }, + "zustand": { + "version": "3.5.0", + "resolved": "https://registry.npmjs.org/zustand/-/zustand-3.5.0.tgz", + "integrity": "sha512-fwZfax2c954pWB+RYXHXG0HWyuoUj8YiNykRjZC/w6L7ay9fPQ7M90mgDVP1KJsRqxLsDILBWSNxuzw5BkCpxA==" } } } diff --git a/package.json b/package.json index 2b3dc63a1..153244680 100644 --- a/package.json +++ b/package.json @@ -5,26 +5,29 @@ "main": "index.js", "dependencies": { "@azure/arm-cosmosdb": "9.1.0", - "@azure/cosmos": "3.9.0", + "@azure/cosmos": "3.10.5", "@azure/cosmos-language-service": "0.0.5", "@azure/identity": "1.2.1", + "@azure/ms-rest-nodeauth": "3.0.7", + "@azure/msal-browser": "2.14.2", "@babel/plugin-proposal-class-properties": "7.12.1", "@babel/plugin-proposal-decorators": "7.12.12", + "@fluentui/react": "8.14.3", "@jupyterlab/services": "6.0.2", "@jupyterlab/terminal": "3.0.3", - "@microsoft/applicationinsights-web": "2.5.9", + "@microsoft/applicationinsights-web": "2.6.1", "@nteract/commutable": "7.4.2", "@nteract/connected-components": "6.8.2", "@nteract/core": "15.1.0", "@nteract/data-explorer": "8.0.3", "@nteract/directory-listing": "2.0.6", "@nteract/dropdown-menu": "1.0.1", - "@nteract/editor": "10.1.2", + "@nteract/editor": "10.1.12", "@nteract/fixtures": "2.3.0", "@nteract/iron-icons": "1.0.0", "@nteract/jupyter-widgets": "2.0.0", "@nteract/logos": "1.0.0", - "@nteract/markdown": "4.4.0", + "@nteract/markdown": "4.6.0", "@nteract/monaco-editor": "3.2.2", "@nteract/octicons": "2.0.0", "@nteract/outputs": "3.0.9", @@ -39,13 +42,10 @@ "@octokit/rest": "17.9.2", "@phosphor/widgets": "1.9.3", "@testing-library/jest-dom": "5.11.9", + "@types/lodash": "4.14.171", "@types/mkdirp": "1.0.1", "@types/node-fetch": "2.5.7", - "@uifabric/react-cards": "0.109.110", - "@uifabric/styling": "7.13.7", - "abort-controller": "3.0.0", "applicationinsights": "1.8.0", - "babel-polyfill": "6.26.0", "bootstrap": "3.4.1", "canvas": "file:./canvas", "clean-webpack-plugin": "0.1.19", @@ -58,9 +58,8 @@ "datatables.net-dt": "1.10.19", "date-fns": "1.29.0", "dayjs": "1.8.19", + "dom-to-image": "2.6.0", "dotenv": "8.2.0", - "es6-object-assign": "1.1.0", - "es6-symbol": "3.1.3", "eslint-plugin-jest": "23.13.2", "eslint-plugin-react": "7.20.0", "hasher": "1.2.0", @@ -68,6 +67,7 @@ "i18next": "19.8.4", "i18next-browser-languagedetector": "6.0.1", "i18next-http-backend": "1.0.23", + "iframe-resizer-react": "1.1.0", "immutable": "4.0.0-rc.12", "is-ci": "2.0.0", "jquery": "3.5.1", @@ -76,13 +76,10 @@ "knockout": "3.5.1", "mkdirp": "1.0.4", "monaco-editor": "0.18.1", - "msal": "1.4.4", - "object.entries": "1.1.0", - "office-ui-fabric-react": "7.134.1", + "ms": "2.1.3", "p-retry": "4.2.0", "plotly.js-cartesian-dist-min": "1.52.3", - "promise-polyfill": "8.1.0", - "promise.prototype.finally": "3.1.0", + "post-robot": "10.0.42", "q": "1.5.1", "react": "16.13.1", "react-animate-height": "2.0.8", @@ -93,19 +90,18 @@ "react-i18next": "11.8.5", "react-notification-system": "0.2.17", "react-redux": "7.1.3", + "react-splitter-layout": "4.0.0", "redux": "4.0.4", "reflect-metadata": "0.1.13", "rx-jupyter": "5.5.12", "rxjs": "6.6.3", + "sanitize-html": "2.3.3", "styled-components": "4.3.2", "swr": "0.4.0", - "text-encoding": "0.7.0", + "terser-webpack-plugin": "3.1.0", "underscore": "1.9.1", - "url-polyfill": "1.1.7", "utility-types": "3.10.0", - "webcrypto-liner": "1.1.4", - "webfontloader": "1.6.28", - "whatwg-fetch": "3.0.0" + "zustand": "3.5.0" }, "devDependencies": { "@babel/core": "7.9.0", @@ -117,30 +113,25 @@ "@types/codemirror": "0.0.56", "@types/crossroads": "0.0.30", "@types/d3": "5.9.2", + "@types/dom-to-image": "2.6.2", "@types/enzyme": "3.10.7", "@types/enzyme-adapter-react-16": "1.0.6", - "@types/expect-puppeteer": "4.4.3", "@types/hasher": "0.0.31", "@types/jest": "26.0.20", - "@types/jest-environment-puppeteer": "4.3.2", - "@types/memoize-one": "4.1.1", "@types/node": "12.11.1", - "@types/promise.prototype.finally": "2.0.3", - "@types/prop-types": "15.5.8", - "@types/puppeteer": "3.0.1", + "@types/post-robot": "10.0.1", "@types/q": "1.5.1", - "@types/react": "17.0.0", - "@types/react-dom": "17.0.0", + "@types/react": "17.0.3", + "@types/react-dom": "17.0.3", "@types/react-notification-system": "0.2.39", "@types/react-redux": "7.1.7", + "@types/react-splitter-layout": "3.0.1", + "@types/sanitize-html": "1.27.2", "@types/sinon": "2.3.3", "@types/styled-components": "5.1.1", - "@types/text-encoding": "0.0.33", "@types/underscore": "1.7.36", - "@types/webfontloader": "1.6.29", - "@typescript-eslint/eslint-plugin": "4.0.1", - "@typescript-eslint/parser": "4.0.1", - "axe-puppeteer": "1.1.0", + "@typescript-eslint/eslint-plugin": "4.22.0", + "@typescript-eslint/parser": "4.22.0", "babel-jest": "24.9.0", "babel-loader": "8.1.0", "buffer": "5.1.0", @@ -155,17 +146,17 @@ "eslint-plugin-no-null": "1.0.2", "eslint-plugin-prefer-arrow": "1.2.2", "eslint-plugin-react-hooks": "4.2.0", - "expose-loader": "0.7.5", + "expect-playwright": "0.3.3", "fast-glob": "3.2.5", "file-loader": "2.0.0", "fs-extra": "7.0.0", + "html-inline-css-webpack-plugin": "1.11.0", "html-loader": "0.5.5", "html-loader-jest": "0.2.1", - "html-webpack-plugin": "3.2.0", - "inline-css": "2.2.5", + "html-webpack-plugin": "4.5.2", "jest": "25.5.4", "jest-canvas-mock": "2.1.0", - "jest-puppeteer": "4.4.0", + "jest-playwright-preset": "1.5.1", "jest-trx-results-processor": "0.0.7", "less": "3.8.1", "less-loader": "4.1.0", @@ -173,24 +164,24 @@ "mini-css-extract-plugin": "0.4.3", "monaco-editor-webpack-plugin": "1.7.0", "node-fetch": "2.6.1", + "playwright": "1.13.0", "prettier": "2.2.1", - "puppeteer": "4.0.0", "raw-loader": "0.5.1", + "react-dev-utils": "11.0.4", "rimraf": "3.0.0", "sinon": "3.2.1", "style-loader": "0.23.0", - "terser-webpack-plugin": "3.0.5", "ts-loader": "6.2.2", "tslint": "5.11.0", "tslint-microsoft-contrib": "6.0.0", - "typescript": "4.0.2", + "typedoc": "0.20.36", + "typescript": "4.3.4", "url-loader": "1.1.1", "wait-on": "4.0.2", - "webpack": "4.43.0", + "webpack": "4.46.0", "webpack-bundle-analyzer": "3.6.1", "webpack-cli": "3.3.10", - "webpack-dev-server": "3.11.0", - "worker-loader": "2.0.0" + "webpack-dev-server": "3.11.0" }, "scripts": { "start": "node --max-old-space-size=10196 node_modules/webpack-dev-server/bin/webpack-dev-server.js", @@ -202,10 +193,11 @@ "pack:fast": "node --max_old_space_size=10196 ./node_modules/webpack/bin/webpack.js --mode development --progress", "copyToConsumers": "node copyToConsumers", "test": "rimraf coverage && jest", - "test:e2e": "jest -c ./jest.config.e2e.js --detectOpenHandles", + "test:e2e": "jest -c ./jest.config.playwright.js --detectOpenHandles", "watch": "npm run start", "wait-for-server": "wait-on -t 240000 -i 5000 -v https-get://0.0.0.0:1234/", "build:ase": "gulp build:ase", + "selfServeDocs": "typedoc", "compile": "tsc", "compile:contracts": "tsc -p ./tsconfig.contracts.json", "compile:strict": "tsc -p ./tsconfig.strict.json", @@ -213,10 +205,10 @@ "format:check": "prettier --check \"{src,test}/**/*.{ts,tsx,html}\" \"*.{js,html}\"", "lint": "tslint --project tsconfig.json && eslint \"**/*.{ts,tsx}\"", "build:contracts": "npm run compile:contracts", - "strictEligibleFiles": "node ./strict-migration-tools/index.js", - "autoAddStrictEligibleFiles": "node ./strict-migration-tools/autoAdd.js", + "strict:find": "node ./strict-null-checks/find.js", + "strict:add": "node ./strict-null-checks/auto-add.js", "compile:fullStrict": "tsc -p ./tsconfig.json --strictNullChecks", - "generateARMClients": "ts-node --compiler-options '{\"module\":\"commonjs\"}' utils/armClientGenerator/generator.ts" + "generateARMClients": "npx ts-node --compiler-options '{\"module\":\"commonjs\"}' utils/armClientGenerator/generator.ts" }, "repository": { "type": "git", diff --git a/preview/.azure/config b/preview/.azure/config new file mode 100644 index 000000000..9839f7d69 --- /dev/null +++ b/preview/.azure/config @@ -0,0 +1,7 @@ +[defaults] +group = stfaul +sku = P1v2 +appserviceplan = stfaul_asp_Linux_centralus_0 +location = centralus +web = cosmos-explorer-preview + diff --git a/preview/README.md b/preview/README.md new file mode 100644 index 000000000..868cc1afa --- /dev/null +++ b/preview/README.md @@ -0,0 +1,20 @@ +# Cosmos Explorer Preview + +Cosmos Explorer Preview makes it possible to try a working version of any commit on master or in a PR. No need to run the app locally or deploy to staging. + +Initial support is for Hosted (Connection string only) or the Azure Portal. Examples: + +Connection string URLs: https://cosmos-explorer-preview.azurewebsites.net/commit/COMMIT_SHA/hostedExplorer.html +Portal URLs: https://ms.portal.azure.com/?dataExplorerSource=https://cosmos-explorer-preview.azurewebsites.net/commit/COMMIT_SHA/explorer.html#home + +In both cases replace `COMMIT_SHA` with the commit you want to view. It must have already completed its build on GitHub Actions. + +### Architechture + +- This folder contains a NodeJS app deployed to Azure App Service that powers preview URLs: + - Paths starting with `/commit/` are proxied to an Azure Storage account containing build artifacts + - Paths starting with `/proxy/` are proxied dynamically to Cosmos account endpoints. Required otherwise CORS would need to be configured for every account accessed. + - Paths starting with `/api/` are proxied to Portal APIs that do not support CORS. +- On GitHub Actions build completion: + - All files in dist are uploaded to an Azure Storage account namespaced by the SHA of the commit + - `/preview/config.json` is uploaded to the same folder with preview specific configuration diff --git a/preview/config.json b/preview/config.json new file mode 100644 index 000000000..7e6044988 --- /dev/null +++ b/preview/config.json @@ -0,0 +1,4 @@ +{ + "PROXY_PATH": "/proxy", + "msalRedirectURI": "https://cosmos-explorer-preview.azurewebsites.net/" +} diff --git a/preview/index.js b/preview/index.js new file mode 100644 index 000000000..c205600a9 --- /dev/null +++ b/preview/index.js @@ -0,0 +1,79 @@ +const express = require("express"); +const { createProxyMiddleware } = require("http-proxy-middleware"); +const port = process.env.PORT || 3000; +const fetch = require("node-fetch"); + +const api = createProxyMiddleware("/api", { + target: "https://main.documentdb.ext.azure.com", + changeOrigin: true, + logLevel: "debug", + bypass: (req, res) => { + if (req.method === "OPTIONS") { + res.statusCode = 200; + res.send(); + } + }, +}); + +const proxy = createProxyMiddleware("/proxy", { + target: "https://main.documentdb.ext.azure.com", + changeOrigin: true, + secure: false, + logLevel: "debug", + pathRewrite: { "^/proxy": "" }, + router: (req) => { + let newTarget = req.headers["x-ms-proxy-target"]; + return newTarget; + }, +}); + +const commit = createProxyMiddleware("/commit", { + target: "https://cosmosexplorerpreview.blob.core.windows.net", + changeOrigin: true, + secure: false, + logLevel: "debug", + pathRewrite: { "^/commit": "$web/" }, +}); + +const app = express(); + +app.use(api); +app.use(proxy); +app.use(commit); +app.get("/pull/:pr(\\d+)", (req, res) => { + const pr = req.params.pr; + const [, query] = req.originalUrl.split("?"); + const search = new URLSearchParams(query); + + fetch("https://api.github.com/repos/Azure/cosmos-explorer/pulls/" + pr) + .then((response) => response.json()) + .then(({ head: { ref, sha } }) => { + const prUrl = new URL("https://github.com/Azure/cosmos-explorer/pull/" + pr); + prUrl.hash = ref; + search.set("feature.pr", prUrl.href); + + const explorer = new URL("https://cosmos-explorer-preview.azurewebsites.net/commit/" + sha + "/explorer.html"); + explorer.search = search.toString(); + + const portal = new URL("https://ms.portal.azure.com/"); + portal.searchParams.set("dataExplorerSource", explorer.href); + + return res.redirect(portal.href); + }) + .catch(() => res.sendStatus(500)); +}); +app.get("/", (req, res) => { + fetch("https://api.github.com/repos/Azure/cosmos-explorer/branches/master") + .then((response) => response.json()) + .then(({ commit: { sha } }) => { + const explorer = new URL( + "https://cosmos-explorer-preview.azurewebsites.net/commit/" + sha + "/hostedExplorer.html" + ); + return res.redirect(explorer.href); + }) + .catch(() => res.sendStatus(500)); +}); + +app.listen(port, () => { + console.log(`Example app listening on port: ${port}`); +}); diff --git a/preview/package-lock.json b/preview/package-lock.json new file mode 100644 index 000000000..58a7075b0 --- /dev/null +++ b/preview/package-lock.json @@ -0,0 +1,1146 @@ +{ + "name": "cosmos-explorer-preview", + "version": "1.0.0", + "lockfileVersion": 2, + "requires": true, + "packages": { + "": { + "name": "cosmos-explorer-preview", + "version": "1.0.0", + "dependencies": { + "express": "^4.17.1", + "http-proxy-middleware": "^1.1.0", + "node-fetch": "^2.6.1" + } + }, + "node_modules/@types/http-proxy": { + "version": "1.17.5", + "resolved": "https://registry.npmjs.org/@types/http-proxy/-/http-proxy-1.17.5.tgz", + "integrity": "sha512-GNkDE7bTv6Sf8JbV2GksknKOsk7OznNYHSdrtvPJXO0qJ9odZig6IZKUi5RFGi6d1bf6dgIAe4uXi3DBc7069Q==", + "dependencies": { + "@types/node": "*" + } + }, + "node_modules/@types/node": { + "version": "14.14.37", + "resolved": "https://registry.npmjs.org/@types/node/-/node-14.14.37.tgz", + "integrity": "sha512-XYmBiy+ohOR4Lh5jE379fV2IU+6Jn4g5qASinhitfyO71b/sCo6MKsMLF5tc7Zf2CE8hViVQyYSobJNke8OvUw==" + }, + "node_modules/accepts": { + "version": "1.3.7", + "resolved": "https://registry.npmjs.org/accepts/-/accepts-1.3.7.tgz", + "integrity": "sha512-Il80Qs2WjYlJIBNzNkK6KYqlVMTbZLXgHx2oT0pU/fjRHyEp+PEfEPY0R3WCwAGVOtauxh1hOxNgIf5bv7dQpA==", + "dependencies": { + "mime-types": "~2.1.24", + "negotiator": "0.6.2" + }, + "engines": { + "node": ">= 0.6" + } + }, + "node_modules/array-flatten": { + "version": "1.1.1", + "resolved": "https://registry.npmjs.org/array-flatten/-/array-flatten-1.1.1.tgz", + "integrity": "sha1-ml9pkFGx5wczKPKgCJaLZOopVdI=" + }, + "node_modules/body-parser": { + "version": "1.19.0", + "resolved": "https://registry.npmjs.org/body-parser/-/body-parser-1.19.0.tgz", + "integrity": "sha512-dhEPs72UPbDnAQJ9ZKMNTP6ptJaionhP5cBb541nXPlW60Jepo9RV/a4fX4XWW9CuFNK22krhrj1+rgzifNCsw==", + "dependencies": { + "bytes": "3.1.0", + "content-type": "~1.0.4", + "debug": "2.6.9", + "depd": "~1.1.2", + "http-errors": "1.7.2", + "iconv-lite": "0.4.24", + "on-finished": "~2.3.0", + "qs": "6.7.0", + "raw-body": "2.4.0", + "type-is": "~1.6.17" + }, + "engines": { + "node": ">= 0.8" + } + }, + "node_modules/braces": { + "version": "3.0.2", + "resolved": "https://registry.npmjs.org/braces/-/braces-3.0.2.tgz", + "integrity": "sha512-b8um+L1RzM3WDSzvhm6gIz1yfTbBt6YTlcEKAvsmqCZZFw46z626lVj9j1yEPW33H5H+lBQpZMP1k8l+78Ha0A==", + "dependencies": { + "fill-range": "^7.0.1" + }, + "engines": { + "node": ">=8" + } + }, + "node_modules/bytes": { + "version": "3.1.0", + "resolved": "https://registry.npmjs.org/bytes/-/bytes-3.1.0.tgz", + "integrity": "sha512-zauLjrfCG+xvoyaqLoV8bLVXXNGC4JqlxFCutSDWA6fJrTo2ZuvLYTqZ7aHBLZSMOopbzwv8f+wZcVzfVTI2Dg==", + "engines": { + "node": ">= 0.8" + } + }, + "node_modules/camelcase": { + "version": "6.2.0", + "resolved": "https://registry.npmjs.org/camelcase/-/camelcase-6.2.0.tgz", + "integrity": "sha512-c7wVvbw3f37nuobQNtgsgG9POC9qMbNuMQmTCqZv23b6MIz0fcYpBiOlv9gEN/hdLdnZTDQhg6e9Dq5M1vKvfg==", + "engines": { + "node": ">=10" + } + }, + "node_modules/content-disposition": { + "version": "0.5.3", + "resolved": "https://registry.npmjs.org/content-disposition/-/content-disposition-0.5.3.tgz", + "integrity": "sha512-ExO0774ikEObIAEV9kDo50o+79VCUdEB6n6lzKgGwupcVeRlhrj3qGAfwq8G6uBJjkqLrhT0qEYFcWng8z1z0g==", + "dependencies": { + "safe-buffer": "5.1.2" + }, + "engines": { + "node": ">= 0.6" + } + }, + "node_modules/content-type": { + "version": "1.0.4", + "resolved": "https://registry.npmjs.org/content-type/-/content-type-1.0.4.tgz", + "integrity": "sha512-hIP3EEPs8tB9AT1L+NUqtwOAps4mk2Zob89MWXMHjHWg9milF/j4osnnQLXBCBFBk/tvIG/tUc9mOUJiPBhPXA==", + "engines": { + "node": ">= 0.6" + } + }, + "node_modules/cookie": { + "version": "0.4.0", + "resolved": "https://registry.npmjs.org/cookie/-/cookie-0.4.0.tgz", + "integrity": "sha512-+Hp8fLp57wnUSt0tY0tHEXh4voZRDnoIrZPqlo3DPiI4y9lwg/jqx+1Om94/W6ZaPDOUbnjOt/99w66zk+l1Xg==", + "engines": { + "node": ">= 0.6" + } + }, + "node_modules/cookie-signature": { + "version": "1.0.6", + "resolved": "https://registry.npmjs.org/cookie-signature/-/cookie-signature-1.0.6.tgz", + "integrity": "sha1-4wOogrNCzD7oylE6eZmXNNqzriw=" + }, + "node_modules/debug": { + "version": "2.6.9", + "resolved": "https://registry.npmjs.org/debug/-/debug-2.6.9.tgz", + "integrity": "sha512-bC7ElrdJaJnPbAP+1EotYvqZsb3ecl5wi6Bfi6BJTUcNowp6cvspg0jXznRTKDjm/E7AdgFBVeAPVMNcKGsHMA==", + "dependencies": { + "ms": "2.0.0" + } + }, + "node_modules/depd": { + "version": "1.1.2", + "resolved": "https://registry.npmjs.org/depd/-/depd-1.1.2.tgz", + "integrity": "sha1-m81S4UwJd2PnSbJ0xDRu0uVgtak=", + "engines": { + "node": ">= 0.6" + } + }, + "node_modules/destroy": { + "version": "1.0.4", + "resolved": "https://registry.npmjs.org/destroy/-/destroy-1.0.4.tgz", + "integrity": "sha1-l4hXRCxEdJ5CBmE+N5RiBYJqvYA=" + }, + "node_modules/ee-first": { + "version": "1.1.1", + "resolved": "https://registry.npmjs.org/ee-first/-/ee-first-1.1.1.tgz", + "integrity": "sha1-WQxhFWsK4vTwJVcyoViyZrxWsh0=" + }, + "node_modules/encodeurl": { + "version": "1.0.2", + "resolved": "https://registry.npmjs.org/encodeurl/-/encodeurl-1.0.2.tgz", + "integrity": "sha1-rT/0yG7C0CkyL1oCw6mmBslbP1k=", + "engines": { + "node": ">= 0.8" + } + }, + "node_modules/escape-html": { + "version": "1.0.3", + "resolved": "https://registry.npmjs.org/escape-html/-/escape-html-1.0.3.tgz", + "integrity": "sha1-Aljq5NPQwJdN4cFpGI7wBR0dGYg=" + }, + "node_modules/etag": { + "version": "1.8.1", + "resolved": "https://registry.npmjs.org/etag/-/etag-1.8.1.tgz", + "integrity": "sha1-Qa4u62XvpiJorr/qg6x9eSmbCIc=", + "engines": { + "node": ">= 0.6" + } + }, + "node_modules/eventemitter3": { + "version": "4.0.7", + "resolved": "https://registry.npmjs.org/eventemitter3/-/eventemitter3-4.0.7.tgz", + "integrity": "sha512-8guHBZCwKnFhYdHr2ysuRWErTwhoN2X8XELRlrRwpmfeY2jjuUN4taQMsULKUVo1K4DvZl+0pgfyoysHxvmvEw==" + }, + "node_modules/express": { + "version": "4.17.1", + "resolved": "https://registry.npmjs.org/express/-/express-4.17.1.tgz", + "integrity": "sha512-mHJ9O79RqluphRrcw2X/GTh3k9tVv8YcoyY4Kkh4WDMUYKRZUq0h1o0w2rrrxBqM7VoeUVqgb27xlEMXTnYt4g==", + "dependencies": { + "accepts": "~1.3.7", + "array-flatten": "1.1.1", + "body-parser": "1.19.0", + "content-disposition": "0.5.3", + "content-type": "~1.0.4", + "cookie": "0.4.0", + "cookie-signature": "1.0.6", + "debug": "2.6.9", + "depd": "~1.1.2", + "encodeurl": "~1.0.2", + "escape-html": "~1.0.3", + "etag": "~1.8.1", + "finalhandler": "~1.1.2", + "fresh": "0.5.2", + "merge-descriptors": "1.0.1", + "methods": "~1.1.2", + "on-finished": "~2.3.0", + "parseurl": "~1.3.3", + "path-to-regexp": "0.1.7", + "proxy-addr": "~2.0.5", + "qs": "6.7.0", + "range-parser": "~1.2.1", + "safe-buffer": "5.1.2", + "send": "0.17.1", + "serve-static": "1.14.1", + "setprototypeof": "1.1.1", + "statuses": "~1.5.0", + "type-is": "~1.6.18", + "utils-merge": "1.0.1", + "vary": "~1.1.2" + }, + "engines": { + "node": ">= 0.10.0" + } + }, + "node_modules/fill-range": { + "version": "7.0.1", + "resolved": "https://registry.npmjs.org/fill-range/-/fill-range-7.0.1.tgz", + "integrity": "sha512-qOo9F+dMUmC2Lcb4BbVvnKJxTPjCm+RRpe4gDuGrzkL7mEVl/djYSu2OdQ2Pa302N4oqkSg9ir6jaLWJ2USVpQ==", + "dependencies": { + "to-regex-range": "^5.0.1" + }, + "engines": { + "node": ">=8" + } + }, + "node_modules/finalhandler": { + "version": "1.1.2", + "resolved": "https://registry.npmjs.org/finalhandler/-/finalhandler-1.1.2.tgz", + "integrity": "sha512-aAWcW57uxVNrQZqFXjITpW3sIUQmHGG3qSb9mUah9MgMC4NeWhNOlNjXEYq3HjRAvL6arUviZGGJsBg6z0zsWA==", + "dependencies": { + "debug": "2.6.9", + "encodeurl": "~1.0.2", + "escape-html": "~1.0.3", + "on-finished": "~2.3.0", + "parseurl": "~1.3.3", + "statuses": "~1.5.0", + "unpipe": "~1.0.0" + }, + "engines": { + "node": ">= 0.8" + } + }, + "node_modules/follow-redirects": { + "version": "1.13.3", + "resolved": "https://registry.npmjs.org/follow-redirects/-/follow-redirects-1.13.3.tgz", + "integrity": "sha512-DUgl6+HDzB0iEptNQEXLx/KhTmDb8tZUHSeLqpnjpknR70H0nC2t9N73BK6fN4hOvJ84pKlIQVQ4k5FFlBedKA==", + "engines": { + "node": ">=4.0" + } + }, + "node_modules/forwarded": { + "version": "0.1.2", + "resolved": "https://registry.npmjs.org/forwarded/-/forwarded-0.1.2.tgz", + "integrity": "sha1-mMI9qxF1ZXuMBXPozszZGw/xjIQ=", + "engines": { + "node": ">= 0.6" + } + }, + "node_modules/fresh": { + "version": "0.5.2", + "resolved": "https://registry.npmjs.org/fresh/-/fresh-0.5.2.tgz", + "integrity": "sha1-PYyt2Q2XZWn6g1qx+OSyOhBWBac=", + "engines": { + "node": ">= 0.6" + } + }, + "node_modules/http-errors": { + "version": "1.7.2", + "resolved": "https://registry.npmjs.org/http-errors/-/http-errors-1.7.2.tgz", + "integrity": "sha512-uUQBt3H/cSIVfch6i1EuPNy/YsRSOUBXTVfZ+yR7Zjez3qjBz6i9+i4zjNaoqcoFVI4lQJ5plg63TvGfRSDCRg==", + "dependencies": { + "depd": "~1.1.2", + "inherits": "2.0.3", + "setprototypeof": "1.1.1", + "statuses": ">= 1.5.0 < 2", + "toidentifier": "1.0.0" + }, + "engines": { + "node": ">= 0.6" + } + }, + "node_modules/http-proxy": { + "version": "1.18.1", + "resolved": "https://registry.npmjs.org/http-proxy/-/http-proxy-1.18.1.tgz", + "integrity": "sha512-7mz/721AbnJwIVbnaSv1Cz3Am0ZLT/UBwkC92VlxhXv/k/BBQfM2fXElQNC27BVGr0uwUpplYPQM9LnaBMR5NQ==", + "dependencies": { + "eventemitter3": "^4.0.0", + "follow-redirects": "^1.0.0", + "requires-port": "^1.0.0" + }, + "engines": { + "node": ">=8.0.0" + } + }, + "node_modules/http-proxy-middleware": { + "version": "1.1.0", + "resolved": "https://registry.npmjs.org/http-proxy-middleware/-/http-proxy-middleware-1.1.0.tgz", + "integrity": "sha512-OnjU5vyVgcZVe2AjLJyMrk8YLNOC2lspCHirB5ldM+B/dwEfZ5bgVTrFyzE9R7xRWAP/i/FXtvIqKjTNEZBhBg==", + "dependencies": { + "@types/http-proxy": "^1.17.5", + "camelcase": "^6.2.0", + "http-proxy": "^1.18.1", + "is-glob": "^4.0.1", + "is-plain-obj": "^3.0.0", + "micromatch": "^4.0.2" + }, + "engines": { + "node": ">=8.0.0" + } + }, + "node_modules/iconv-lite": { + "version": "0.4.24", + "resolved": "https://registry.npmjs.org/iconv-lite/-/iconv-lite-0.4.24.tgz", + "integrity": "sha512-v3MXnZAcvnywkTUEZomIActle7RXXeedOR31wwl7VlyoXO4Qi9arvSenNQWne1TcRwhCL1HwLI21bEqdpj8/rA==", + "dependencies": { + "safer-buffer": ">= 2.1.2 < 3" + }, + "engines": { + "node": ">=0.10.0" + } + }, + "node_modules/inherits": { + "version": "2.0.3", + "resolved": "https://registry.npmjs.org/inherits/-/inherits-2.0.3.tgz", + "integrity": "sha1-Yzwsg+PaQqUC9SRmAiSA9CCCYd4=" + }, + "node_modules/ipaddr.js": { + "version": "1.9.1", + "resolved": "https://registry.npmjs.org/ipaddr.js/-/ipaddr.js-1.9.1.tgz", + "integrity": "sha512-0KI/607xoxSToH7GjN1FfSbLoU0+btTicjsQSWQlh/hZykN8KpmMf7uYwPW3R+akZ6R/w18ZlXSHBYXiYUPO3g==", + "engines": { + "node": ">= 0.10" + } + }, + "node_modules/is-extglob": { + "version": "2.1.1", + "resolved": "https://registry.npmjs.org/is-extglob/-/is-extglob-2.1.1.tgz", + "integrity": "sha1-qIwCU1eR8C7TfHahueqXc8gz+MI=", + "engines": { + "node": ">=0.10.0" + } + }, + "node_modules/is-glob": { + "version": "4.0.1", + "resolved": "https://registry.npmjs.org/is-glob/-/is-glob-4.0.1.tgz", + "integrity": "sha512-5G0tKtBTFImOqDnLB2hG6Bp2qcKEFduo4tZu9MT/H6NQv/ghhy30o55ufafxJ/LdH79LLs2Kfrn85TLKyA7BUg==", + "dependencies": { + "is-extglob": "^2.1.1" + }, + "engines": { + "node": ">=0.10.0" + } + }, + "node_modules/is-number": { + "version": "7.0.0", + "resolved": "https://registry.npmjs.org/is-number/-/is-number-7.0.0.tgz", + "integrity": "sha512-41Cifkg6e8TylSpdtTpeLVMqvSBEVzTttHvERD741+pnZ8ANv0004MRL43QKPDlK9cGvNp6NZWZUBlbGXYxxng==", + "engines": { + "node": ">=0.12.0" + } + }, + "node_modules/is-plain-obj": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/is-plain-obj/-/is-plain-obj-3.0.0.tgz", + "integrity": "sha512-gwsOE28k+23GP1B6vFl1oVh/WOzmawBrKwo5Ev6wMKzPkaXaCDIQKzLnvsA42DRlbVTWorkgTKIviAKCWkfUwA==", + "engines": { + "node": ">=10" + } + }, + "node_modules/media-typer": { + "version": "0.3.0", + "resolved": "https://registry.npmjs.org/media-typer/-/media-typer-0.3.0.tgz", + "integrity": "sha1-hxDXrwqmJvj/+hzgAWhUUmMlV0g=", + "engines": { + "node": ">= 0.6" + } + }, + "node_modules/merge-descriptors": { + "version": "1.0.1", + "resolved": "https://registry.npmjs.org/merge-descriptors/-/merge-descriptors-1.0.1.tgz", + "integrity": "sha1-sAqqVW3YtEVoFQ7J0blT8/kMu2E=" + }, + "node_modules/methods": { + "version": "1.1.2", + "resolved": "https://registry.npmjs.org/methods/-/methods-1.1.2.tgz", + "integrity": "sha1-VSmk1nZUE07cxSZmVoNbD4Ua/O4=", + "engines": { + "node": ">= 0.6" + } + }, + "node_modules/micromatch": { + "version": "4.0.2", + "resolved": "https://registry.npmjs.org/micromatch/-/micromatch-4.0.2.tgz", + "integrity": "sha512-y7FpHSbMUMoyPbYUSzO6PaZ6FyRnQOpHuKwbo1G+Knck95XVU4QAiKdGEnj5wwoS7PlOgthX/09u5iFJ+aYf5Q==", + "dependencies": { + "braces": "^3.0.1", + "picomatch": "^2.0.5" + }, + "engines": { + "node": ">=8" + } + }, + "node_modules/mime": { + "version": "1.6.0", + "resolved": "https://registry.npmjs.org/mime/-/mime-1.6.0.tgz", + "integrity": "sha512-x0Vn8spI+wuJ1O6S7gnbaQg8Pxh4NNHb7KSINmEWKiPE4RKOplvijn+NkmYmmRgP68mc70j2EbeTFRsrswaQeg==", + "bin": { + "mime": "cli.js" + }, + "engines": { + "node": ">=4" + } + }, + "node_modules/mime-db": { + "version": "1.46.0", + "resolved": "https://registry.npmjs.org/mime-db/-/mime-db-1.46.0.tgz", + "integrity": "sha512-svXaP8UQRZ5K7or+ZmfNhg2xX3yKDMUzqadsSqi4NCH/KomcH75MAMYAGVlvXn4+b/xOPhS3I2uHKRUzvjY7BQ==", + "engines": { + "node": ">= 0.6" + } + }, + "node_modules/mime-types": { + "version": "2.1.29", + "resolved": "https://registry.npmjs.org/mime-types/-/mime-types-2.1.29.tgz", + "integrity": "sha512-Y/jMt/S5sR9OaqteJtslsFZKWOIIqMACsJSiHghlCAyhf7jfVYjKBmLiX8OgpWeW+fjJ2b+Az69aPFPkUOY6xQ==", + "dependencies": { + "mime-db": "1.46.0" + }, + "engines": { + "node": ">= 0.6" + } + }, + "node_modules/ms": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/ms/-/ms-2.0.0.tgz", + "integrity": "sha1-VgiurfwAvmwpAd9fmGF4jeDVl8g=" + }, + "node_modules/negotiator": { + "version": "0.6.2", + "resolved": "https://registry.npmjs.org/negotiator/-/negotiator-0.6.2.tgz", + "integrity": "sha512-hZXc7K2e+PgeI1eDBe/10Ard4ekbfrrqG8Ep+8Jmf4JID2bNg7NvCPOZN+kfF574pFQI7mum2AUqDidoKqcTOw==", + "engines": { + "node": ">= 0.6" + } + }, + "node_modules/node-fetch": { + "version": "2.6.1", + "resolved": "https://registry.npmjs.org/node-fetch/-/node-fetch-2.6.1.tgz", + "integrity": "sha512-V4aYg89jEoVRxRb2fJdAg8FHvI7cEyYdVAh94HH0UIK8oJxUfkjlDQN9RbMx+bEjP7+ggMiFRprSti032Oipxw==", + "engines": { + "node": "4.x || >=6.0.0" + } + }, + "node_modules/on-finished": { + "version": "2.3.0", + "resolved": "https://registry.npmjs.org/on-finished/-/on-finished-2.3.0.tgz", + "integrity": "sha1-IPEzZIGwg811M3mSoWlxqi2QaUc=", + "dependencies": { + "ee-first": "1.1.1" + }, + "engines": { + "node": ">= 0.8" + } + }, + "node_modules/parseurl": { + "version": "1.3.3", + "resolved": "https://registry.npmjs.org/parseurl/-/parseurl-1.3.3.tgz", + "integrity": "sha512-CiyeOxFT/JZyN5m0z9PfXw4SCBJ6Sygz1Dpl0wqjlhDEGGBP1GnsUVEL0p63hoG1fcj3fHynXi9NYO4nWOL+qQ==", + "engines": { + "node": ">= 0.8" + } + }, + "node_modules/path-to-regexp": { + "version": "0.1.7", + "resolved": "https://registry.npmjs.org/path-to-regexp/-/path-to-regexp-0.1.7.tgz", + "integrity": "sha1-32BBeABfUi8V60SQ5yR6G/qmf4w=" + }, + "node_modules/picomatch": { + "version": "2.2.2", + "resolved": "https://registry.npmjs.org/picomatch/-/picomatch-2.2.2.tgz", + "integrity": "sha512-q0M/9eZHzmr0AulXyPwNfZjtwZ/RBZlbN3K3CErVrk50T2ASYI7Bye0EvekFY3IP1Nt2DHu0re+V2ZHIpMkuWg==", + "engines": { + "node": ">=8.6" + } + }, + "node_modules/proxy-addr": { + "version": "2.0.6", + "resolved": "https://registry.npmjs.org/proxy-addr/-/proxy-addr-2.0.6.tgz", + "integrity": "sha512-dh/frvCBVmSsDYzw6n926jv974gddhkFPfiN8hPOi30Wax25QZyZEGveluCgliBnqmuM+UJmBErbAUFIoDbjOw==", + "dependencies": { + "forwarded": "~0.1.2", + "ipaddr.js": "1.9.1" + }, + "engines": { + "node": ">= 0.10" + } + }, + "node_modules/qs": { + "version": "6.7.0", + "resolved": "https://registry.npmjs.org/qs/-/qs-6.7.0.tgz", + "integrity": "sha512-VCdBRNFTX1fyE7Nb6FYoURo/SPe62QCaAyzJvUjwRaIsc+NePBEniHlvxFmmX56+HZphIGtV0XeCirBtpDrTyQ==", + "engines": { + "node": ">=0.6" + } + }, + "node_modules/range-parser": { + "version": "1.2.1", + "resolved": "https://registry.npmjs.org/range-parser/-/range-parser-1.2.1.tgz", + "integrity": "sha512-Hrgsx+orqoygnmhFbKaHE6c296J+HTAQXoxEF6gNupROmmGJRoyzfG3ccAveqCBrwr/2yxQ5BVd/GTl5agOwSg==", + "engines": { + "node": ">= 0.6" + } + }, + "node_modules/raw-body": { + "version": "2.4.0", + "resolved": "https://registry.npmjs.org/raw-body/-/raw-body-2.4.0.tgz", + "integrity": "sha512-4Oz8DUIwdvoa5qMJelxipzi/iJIi40O5cGV1wNYp5hvZP8ZN0T+jiNkL0QepXs+EsQ9XJ8ipEDoiH70ySUJP3Q==", + "dependencies": { + "bytes": "3.1.0", + "http-errors": "1.7.2", + "iconv-lite": "0.4.24", + "unpipe": "1.0.0" + }, + "engines": { + "node": ">= 0.8" + } + }, + "node_modules/requires-port": { + "version": "1.0.0", + "resolved": "https://registry.npmjs.org/requires-port/-/requires-port-1.0.0.tgz", + "integrity": "sha1-kl0mAdOaxIXgkc8NpcbmlNw9yv8=" + }, + "node_modules/safe-buffer": { + "version": "5.1.2", + "resolved": "https://registry.npmjs.org/safe-buffer/-/safe-buffer-5.1.2.tgz", + "integrity": "sha512-Gd2UZBJDkXlY7GbJxfsE8/nvKkUEU1G38c1siN6QP6a9PT9MmHB8GnpscSmMJSoF8LOIrt8ud/wPtojys4G6+g==" + }, + "node_modules/safer-buffer": { + "version": "2.1.2", + "resolved": "https://registry.npmjs.org/safer-buffer/-/safer-buffer-2.1.2.tgz", + "integrity": "sha512-YZo3K82SD7Riyi0E1EQPojLz7kpepnSQI9IyPbHHg1XXXevb5dJI7tpyN2ADxGcQbHG7vcyRHk0cbwqcQriUtg==" + }, + "node_modules/send": { + "version": "0.17.1", + "resolved": "https://registry.npmjs.org/send/-/send-0.17.1.tgz", + "integrity": "sha512-BsVKsiGcQMFwT8UxypobUKyv7irCNRHk1T0G680vk88yf6LBByGcZJOTJCrTP2xVN6yI+XjPJcNuE3V4fT9sAg==", + "dependencies": { + "debug": "2.6.9", + "depd": "~1.1.2", + "destroy": "~1.0.4", + "encodeurl": "~1.0.2", + "escape-html": "~1.0.3", + "etag": "~1.8.1", + "fresh": "0.5.2", + "http-errors": "~1.7.2", + "mime": "1.6.0", + "ms": "2.1.1", + "on-finished": "~2.3.0", + "range-parser": "~1.2.1", + "statuses": "~1.5.0" + }, + "engines": { + "node": ">= 0.8.0" + } + }, + "node_modules/send/node_modules/ms": { + "version": "2.1.1", + "resolved": "https://registry.npmjs.org/ms/-/ms-2.1.1.tgz", + "integrity": "sha512-tgp+dl5cGk28utYktBsrFqA7HKgrhgPsg6Z/EfhWI4gl1Hwq8B/GmY/0oXZ6nF8hDVesS/FpnYaD/kOWhYQvyg==" + }, + "node_modules/serve-static": { + "version": "1.14.1", + "resolved": "https://registry.npmjs.org/serve-static/-/serve-static-1.14.1.tgz", + "integrity": "sha512-JMrvUwE54emCYWlTI+hGrGv5I8dEwmco/00EvkzIIsR7MqrHonbD9pO2MOfFnpFntl7ecpZs+3mW+XbQZu9QCg==", + "dependencies": { + "encodeurl": "~1.0.2", + "escape-html": "~1.0.3", + "parseurl": "~1.3.3", + "send": "0.17.1" + }, + "engines": { + "node": ">= 0.8.0" + } + }, + "node_modules/setprototypeof": { + "version": "1.1.1", + "resolved": "https://registry.npmjs.org/setprototypeof/-/setprototypeof-1.1.1.tgz", + "integrity": "sha512-JvdAWfbXeIGaZ9cILp38HntZSFSo3mWg6xGcJJsd+d4aRMOqauag1C63dJfDw7OaMYwEbHMOxEZ1lqVRYP2OAw==" + }, + "node_modules/statuses": { + "version": "1.5.0", + "resolved": "https://registry.npmjs.org/statuses/-/statuses-1.5.0.tgz", + "integrity": "sha1-Fhx9rBd2Wf2YEfQ3cfqZOBR4Yow=", + "engines": { + "node": ">= 0.6" + } + }, + "node_modules/to-regex-range": { + "version": "5.0.1", + "resolved": "https://registry.npmjs.org/to-regex-range/-/to-regex-range-5.0.1.tgz", + "integrity": "sha512-65P7iz6X5yEr1cwcgvQxbbIw7Uk3gOy5dIdtZ4rDveLqhrdJP+Li/Hx6tyK0NEb+2GCyneCMJiGqrADCSNk8sQ==", + "dependencies": { + "is-number": "^7.0.0" + }, + "engines": { + "node": ">=8.0" + } + }, + "node_modules/toidentifier": { + "version": "1.0.0", + "resolved": "https://registry.npmjs.org/toidentifier/-/toidentifier-1.0.0.tgz", + "integrity": "sha512-yaOH/Pk/VEhBWWTlhI+qXxDFXlejDGcQipMlyxda9nthulaxLZUNcUqFxokp0vcYnvteJln5FNQDRrxj3YcbVw==", + "engines": { + "node": ">=0.6" + } + }, + "node_modules/type-is": { + "version": "1.6.18", + "resolved": "https://registry.npmjs.org/type-is/-/type-is-1.6.18.tgz", + "integrity": "sha512-TkRKr9sUTxEH8MdfuCSP7VizJyzRNMjj2J2do2Jr3Kym598JVdEksuzPQCnlFPW4ky9Q+iA+ma9BGm06XQBy8g==", + "dependencies": { + "media-typer": "0.3.0", + "mime-types": "~2.1.24" + }, + "engines": { + "node": ">= 0.6" + } + }, + "node_modules/unpipe": { + "version": "1.0.0", + "resolved": "https://registry.npmjs.org/unpipe/-/unpipe-1.0.0.tgz", + "integrity": "sha1-sr9O6FFKrmFltIF4KdIbLvSZBOw=", + "engines": { + "node": ">= 0.8" + } + }, + "node_modules/utils-merge": { + "version": "1.0.1", + "resolved": "https://registry.npmjs.org/utils-merge/-/utils-merge-1.0.1.tgz", + "integrity": "sha1-n5VxD1CiZ5R7LMwSR0HBAoQn5xM=", + "engines": { + "node": ">= 0.4.0" + } + }, + "node_modules/vary": { + "version": "1.1.2", + "resolved": "https://registry.npmjs.org/vary/-/vary-1.1.2.tgz", + "integrity": "sha1-IpnwLG3tMNSllhsLn3RSShj2NPw=", + "engines": { + "node": ">= 0.8" + } + } + }, + "dependencies": { + "@types/http-proxy": { + "version": "1.17.5", + "resolved": "https://registry.npmjs.org/@types/http-proxy/-/http-proxy-1.17.5.tgz", + "integrity": "sha512-GNkDE7bTv6Sf8JbV2GksknKOsk7OznNYHSdrtvPJXO0qJ9odZig6IZKUi5RFGi6d1bf6dgIAe4uXi3DBc7069Q==", + "requires": { + "@types/node": "*" + } + }, + "@types/node": { + "version": "14.14.37", + "resolved": "https://registry.npmjs.org/@types/node/-/node-14.14.37.tgz", + "integrity": "sha512-XYmBiy+ohOR4Lh5jE379fV2IU+6Jn4g5qASinhitfyO71b/sCo6MKsMLF5tc7Zf2CE8hViVQyYSobJNke8OvUw==" + }, + "accepts": { + "version": "1.3.7", + "resolved": "https://registry.npmjs.org/accepts/-/accepts-1.3.7.tgz", + "integrity": "sha512-Il80Qs2WjYlJIBNzNkK6KYqlVMTbZLXgHx2oT0pU/fjRHyEp+PEfEPY0R3WCwAGVOtauxh1hOxNgIf5bv7dQpA==", + "requires": { + "mime-types": "~2.1.24", + "negotiator": "0.6.2" + } + }, + "array-flatten": { + "version": "1.1.1", + "resolved": "https://registry.npmjs.org/array-flatten/-/array-flatten-1.1.1.tgz", + "integrity": "sha1-ml9pkFGx5wczKPKgCJaLZOopVdI=" + }, + "body-parser": { + "version": "1.19.0", + "resolved": "https://registry.npmjs.org/body-parser/-/body-parser-1.19.0.tgz", + "integrity": "sha512-dhEPs72UPbDnAQJ9ZKMNTP6ptJaionhP5cBb541nXPlW60Jepo9RV/a4fX4XWW9CuFNK22krhrj1+rgzifNCsw==", + "requires": { + "bytes": "3.1.0", + "content-type": "~1.0.4", + "debug": "2.6.9", + "depd": "~1.1.2", + "http-errors": "1.7.2", + "iconv-lite": "0.4.24", + "on-finished": "~2.3.0", + "qs": "6.7.0", + "raw-body": "2.4.0", + "type-is": "~1.6.17" + } + }, + "braces": { + "version": "3.0.2", + "resolved": "https://registry.npmjs.org/braces/-/braces-3.0.2.tgz", + "integrity": "sha512-b8um+L1RzM3WDSzvhm6gIz1yfTbBt6YTlcEKAvsmqCZZFw46z626lVj9j1yEPW33H5H+lBQpZMP1k8l+78Ha0A==", + "requires": { + "fill-range": "^7.0.1" + } + }, + "bytes": { + "version": "3.1.0", + "resolved": "https://registry.npmjs.org/bytes/-/bytes-3.1.0.tgz", + "integrity": "sha512-zauLjrfCG+xvoyaqLoV8bLVXXNGC4JqlxFCutSDWA6fJrTo2ZuvLYTqZ7aHBLZSMOopbzwv8f+wZcVzfVTI2Dg==" + }, + "camelcase": { + "version": "6.2.0", + "resolved": "https://registry.npmjs.org/camelcase/-/camelcase-6.2.0.tgz", + "integrity": "sha512-c7wVvbw3f37nuobQNtgsgG9POC9qMbNuMQmTCqZv23b6MIz0fcYpBiOlv9gEN/hdLdnZTDQhg6e9Dq5M1vKvfg==" + }, + "content-disposition": { + "version": "0.5.3", + "resolved": "https://registry.npmjs.org/content-disposition/-/content-disposition-0.5.3.tgz", + "integrity": "sha512-ExO0774ikEObIAEV9kDo50o+79VCUdEB6n6lzKgGwupcVeRlhrj3qGAfwq8G6uBJjkqLrhT0qEYFcWng8z1z0g==", + "requires": { + "safe-buffer": "5.1.2" + } + }, + "content-type": { + "version": "1.0.4", + "resolved": "https://registry.npmjs.org/content-type/-/content-type-1.0.4.tgz", + "integrity": "sha512-hIP3EEPs8tB9AT1L+NUqtwOAps4mk2Zob89MWXMHjHWg9milF/j4osnnQLXBCBFBk/tvIG/tUc9mOUJiPBhPXA==" + }, + "cookie": { + "version": "0.4.0", + "resolved": "https://registry.npmjs.org/cookie/-/cookie-0.4.0.tgz", + "integrity": "sha512-+Hp8fLp57wnUSt0tY0tHEXh4voZRDnoIrZPqlo3DPiI4y9lwg/jqx+1Om94/W6ZaPDOUbnjOt/99w66zk+l1Xg==" + }, + "cookie-signature": { + "version": "1.0.6", + "resolved": "https://registry.npmjs.org/cookie-signature/-/cookie-signature-1.0.6.tgz", + "integrity": "sha1-4wOogrNCzD7oylE6eZmXNNqzriw=" + }, + "debug": { + "version": "2.6.9", + "resolved": "https://registry.npmjs.org/debug/-/debug-2.6.9.tgz", + "integrity": "sha512-bC7ElrdJaJnPbAP+1EotYvqZsb3ecl5wi6Bfi6BJTUcNowp6cvspg0jXznRTKDjm/E7AdgFBVeAPVMNcKGsHMA==", + "requires": { + "ms": "2.0.0" + } + }, + "depd": { + "version": "1.1.2", + "resolved": "https://registry.npmjs.org/depd/-/depd-1.1.2.tgz", + "integrity": "sha1-m81S4UwJd2PnSbJ0xDRu0uVgtak=" + }, + "destroy": { + "version": "1.0.4", + "resolved": "https://registry.npmjs.org/destroy/-/destroy-1.0.4.tgz", + "integrity": "sha1-l4hXRCxEdJ5CBmE+N5RiBYJqvYA=" + }, + "ee-first": { + "version": "1.1.1", + "resolved": "https://registry.npmjs.org/ee-first/-/ee-first-1.1.1.tgz", + "integrity": "sha1-WQxhFWsK4vTwJVcyoViyZrxWsh0=" + }, + "encodeurl": { + "version": "1.0.2", + "resolved": "https://registry.npmjs.org/encodeurl/-/encodeurl-1.0.2.tgz", + "integrity": "sha1-rT/0yG7C0CkyL1oCw6mmBslbP1k=" + }, + "escape-html": { + "version": "1.0.3", + "resolved": "https://registry.npmjs.org/escape-html/-/escape-html-1.0.3.tgz", + "integrity": "sha1-Aljq5NPQwJdN4cFpGI7wBR0dGYg=" + }, + "etag": { + "version": "1.8.1", + "resolved": "https://registry.npmjs.org/etag/-/etag-1.8.1.tgz", + "integrity": "sha1-Qa4u62XvpiJorr/qg6x9eSmbCIc=" + }, + "eventemitter3": { + "version": "4.0.7", + "resolved": "https://registry.npmjs.org/eventemitter3/-/eventemitter3-4.0.7.tgz", + "integrity": "sha512-8guHBZCwKnFhYdHr2ysuRWErTwhoN2X8XELRlrRwpmfeY2jjuUN4taQMsULKUVo1K4DvZl+0pgfyoysHxvmvEw==" + }, + "express": { + "version": "4.17.1", + "resolved": "https://registry.npmjs.org/express/-/express-4.17.1.tgz", + "integrity": "sha512-mHJ9O79RqluphRrcw2X/GTh3k9tVv8YcoyY4Kkh4WDMUYKRZUq0h1o0w2rrrxBqM7VoeUVqgb27xlEMXTnYt4g==", + "requires": { + "accepts": "~1.3.7", + "array-flatten": "1.1.1", + "body-parser": "1.19.0", + "content-disposition": "0.5.3", + "content-type": "~1.0.4", + "cookie": "0.4.0", + "cookie-signature": "1.0.6", + "debug": "2.6.9", + "depd": "~1.1.2", + "encodeurl": "~1.0.2", + "escape-html": "~1.0.3", + "etag": "~1.8.1", + "finalhandler": "~1.1.2", + "fresh": "0.5.2", + "merge-descriptors": "1.0.1", + "methods": "~1.1.2", + "on-finished": "~2.3.0", + "parseurl": "~1.3.3", + "path-to-regexp": "0.1.7", + "proxy-addr": "~2.0.5", + "qs": "6.7.0", + "range-parser": "~1.2.1", + "safe-buffer": "5.1.2", + "send": "0.17.1", + "serve-static": "1.14.1", + "setprototypeof": "1.1.1", + "statuses": "~1.5.0", + "type-is": "~1.6.18", + "utils-merge": "1.0.1", + "vary": "~1.1.2" + } + }, + "fill-range": { + "version": "7.0.1", + "resolved": "https://registry.npmjs.org/fill-range/-/fill-range-7.0.1.tgz", + "integrity": "sha512-qOo9F+dMUmC2Lcb4BbVvnKJxTPjCm+RRpe4gDuGrzkL7mEVl/djYSu2OdQ2Pa302N4oqkSg9ir6jaLWJ2USVpQ==", + "requires": { + "to-regex-range": "^5.0.1" + } + }, + "finalhandler": { + "version": "1.1.2", + "resolved": "https://registry.npmjs.org/finalhandler/-/finalhandler-1.1.2.tgz", + "integrity": "sha512-aAWcW57uxVNrQZqFXjITpW3sIUQmHGG3qSb9mUah9MgMC4NeWhNOlNjXEYq3HjRAvL6arUviZGGJsBg6z0zsWA==", + "requires": { + "debug": "2.6.9", + "encodeurl": "~1.0.2", + "escape-html": "~1.0.3", + "on-finished": "~2.3.0", + "parseurl": "~1.3.3", + "statuses": "~1.5.0", + "unpipe": "~1.0.0" + } + }, + "follow-redirects": { + "version": "1.13.3", + "resolved": "https://registry.npmjs.org/follow-redirects/-/follow-redirects-1.13.3.tgz", + "integrity": "sha512-DUgl6+HDzB0iEptNQEXLx/KhTmDb8tZUHSeLqpnjpknR70H0nC2t9N73BK6fN4hOvJ84pKlIQVQ4k5FFlBedKA==" + }, + "forwarded": { + "version": "0.1.2", + "resolved": "https://registry.npmjs.org/forwarded/-/forwarded-0.1.2.tgz", + "integrity": "sha1-mMI9qxF1ZXuMBXPozszZGw/xjIQ=" + }, + "fresh": { + "version": "0.5.2", + "resolved": "https://registry.npmjs.org/fresh/-/fresh-0.5.2.tgz", + "integrity": "sha1-PYyt2Q2XZWn6g1qx+OSyOhBWBac=" + }, + "http-errors": { + "version": "1.7.2", + "resolved": "https://registry.npmjs.org/http-errors/-/http-errors-1.7.2.tgz", + "integrity": "sha512-uUQBt3H/cSIVfch6i1EuPNy/YsRSOUBXTVfZ+yR7Zjez3qjBz6i9+i4zjNaoqcoFVI4lQJ5plg63TvGfRSDCRg==", + "requires": { + "depd": "~1.1.2", + "inherits": "2.0.3", + "setprototypeof": "1.1.1", + "statuses": ">= 1.5.0 < 2", + "toidentifier": "1.0.0" + } + }, + "http-proxy": { + "version": "1.18.1", + "resolved": "https://registry.npmjs.org/http-proxy/-/http-proxy-1.18.1.tgz", + "integrity": "sha512-7mz/721AbnJwIVbnaSv1Cz3Am0ZLT/UBwkC92VlxhXv/k/BBQfM2fXElQNC27BVGr0uwUpplYPQM9LnaBMR5NQ==", + "requires": { + "eventemitter3": "^4.0.0", + "follow-redirects": "^1.0.0", + "requires-port": "^1.0.0" + } + }, + "http-proxy-middleware": { + "version": "1.1.0", + "resolved": "https://registry.npmjs.org/http-proxy-middleware/-/http-proxy-middleware-1.1.0.tgz", + "integrity": "sha512-OnjU5vyVgcZVe2AjLJyMrk8YLNOC2lspCHirB5ldM+B/dwEfZ5bgVTrFyzE9R7xRWAP/i/FXtvIqKjTNEZBhBg==", + "requires": { + "@types/http-proxy": "^1.17.5", + "camelcase": "^6.2.0", + "http-proxy": "^1.18.1", + "is-glob": "^4.0.1", + "is-plain-obj": "^3.0.0", + "micromatch": "^4.0.2" + } + }, + "iconv-lite": { + "version": "0.4.24", + "resolved": "https://registry.npmjs.org/iconv-lite/-/iconv-lite-0.4.24.tgz", + "integrity": "sha512-v3MXnZAcvnywkTUEZomIActle7RXXeedOR31wwl7VlyoXO4Qi9arvSenNQWne1TcRwhCL1HwLI21bEqdpj8/rA==", + "requires": { + "safer-buffer": ">= 2.1.2 < 3" + } + }, + "inherits": { + "version": "2.0.3", + "resolved": "https://registry.npmjs.org/inherits/-/inherits-2.0.3.tgz", + "integrity": "sha1-Yzwsg+PaQqUC9SRmAiSA9CCCYd4=" + }, + "ipaddr.js": { + "version": "1.9.1", + "resolved": "https://registry.npmjs.org/ipaddr.js/-/ipaddr.js-1.9.1.tgz", + "integrity": "sha512-0KI/607xoxSToH7GjN1FfSbLoU0+btTicjsQSWQlh/hZykN8KpmMf7uYwPW3R+akZ6R/w18ZlXSHBYXiYUPO3g==" + }, + "is-extglob": { + "version": "2.1.1", + "resolved": "https://registry.npmjs.org/is-extglob/-/is-extglob-2.1.1.tgz", + "integrity": "sha1-qIwCU1eR8C7TfHahueqXc8gz+MI=" + }, + "is-glob": { + "version": "4.0.1", + "resolved": "https://registry.npmjs.org/is-glob/-/is-glob-4.0.1.tgz", + "integrity": "sha512-5G0tKtBTFImOqDnLB2hG6Bp2qcKEFduo4tZu9MT/H6NQv/ghhy30o55ufafxJ/LdH79LLs2Kfrn85TLKyA7BUg==", + "requires": { + "is-extglob": "^2.1.1" + } + }, + "is-number": { + "version": "7.0.0", + "resolved": "https://registry.npmjs.org/is-number/-/is-number-7.0.0.tgz", + "integrity": "sha512-41Cifkg6e8TylSpdtTpeLVMqvSBEVzTttHvERD741+pnZ8ANv0004MRL43QKPDlK9cGvNp6NZWZUBlbGXYxxng==" + }, + "is-plain-obj": { + "version": "3.0.0", + "resolved": "https://registry.npmjs.org/is-plain-obj/-/is-plain-obj-3.0.0.tgz", + "integrity": "sha512-gwsOE28k+23GP1B6vFl1oVh/WOzmawBrKwo5Ev6wMKzPkaXaCDIQKzLnvsA42DRlbVTWorkgTKIviAKCWkfUwA==" + }, + "media-typer": { + "version": "0.3.0", + "resolved": "https://registry.npmjs.org/media-typer/-/media-typer-0.3.0.tgz", + "integrity": "sha1-hxDXrwqmJvj/+hzgAWhUUmMlV0g=" + }, + "merge-descriptors": { + "version": "1.0.1", + "resolved": "https://registry.npmjs.org/merge-descriptors/-/merge-descriptors-1.0.1.tgz", + "integrity": "sha1-sAqqVW3YtEVoFQ7J0blT8/kMu2E=" + }, + "methods": { + "version": "1.1.2", + "resolved": "https://registry.npmjs.org/methods/-/methods-1.1.2.tgz", + "integrity": "sha1-VSmk1nZUE07cxSZmVoNbD4Ua/O4=" + }, + "micromatch": { + "version": "4.0.2", + "resolved": "https://registry.npmjs.org/micromatch/-/micromatch-4.0.2.tgz", + "integrity": "sha512-y7FpHSbMUMoyPbYUSzO6PaZ6FyRnQOpHuKwbo1G+Knck95XVU4QAiKdGEnj5wwoS7PlOgthX/09u5iFJ+aYf5Q==", + "requires": { + "braces": "^3.0.1", + "picomatch": "^2.0.5" + } + }, + "mime": { + "version": "1.6.0", + "resolved": "https://registry.npmjs.org/mime/-/mime-1.6.0.tgz", + "integrity": "sha512-x0Vn8spI+wuJ1O6S7gnbaQg8Pxh4NNHb7KSINmEWKiPE4RKOplvijn+NkmYmmRgP68mc70j2EbeTFRsrswaQeg==" + }, + "mime-db": { + "version": "1.46.0", + "resolved": "https://registry.npmjs.org/mime-db/-/mime-db-1.46.0.tgz", + "integrity": "sha512-svXaP8UQRZ5K7or+ZmfNhg2xX3yKDMUzqadsSqi4NCH/KomcH75MAMYAGVlvXn4+b/xOPhS3I2uHKRUzvjY7BQ==" + }, + "mime-types": { + "version": "2.1.29", + "resolved": "https://registry.npmjs.org/mime-types/-/mime-types-2.1.29.tgz", + "integrity": "sha512-Y/jMt/S5sR9OaqteJtslsFZKWOIIqMACsJSiHghlCAyhf7jfVYjKBmLiX8OgpWeW+fjJ2b+Az69aPFPkUOY6xQ==", + "requires": { + "mime-db": "1.46.0" + } + }, + "ms": { + "version": "2.0.0", + "resolved": "https://registry.npmjs.org/ms/-/ms-2.0.0.tgz", + "integrity": "sha1-VgiurfwAvmwpAd9fmGF4jeDVl8g=" + }, + "negotiator": { + "version": "0.6.2", + "resolved": "https://registry.npmjs.org/negotiator/-/negotiator-0.6.2.tgz", + "integrity": "sha512-hZXc7K2e+PgeI1eDBe/10Ard4ekbfrrqG8Ep+8Jmf4JID2bNg7NvCPOZN+kfF574pFQI7mum2AUqDidoKqcTOw==" + }, + "node-fetch": { + "version": "2.6.1", + "resolved": "https://registry.npmjs.org/node-fetch/-/node-fetch-2.6.1.tgz", + "integrity": "sha512-V4aYg89jEoVRxRb2fJdAg8FHvI7cEyYdVAh94HH0UIK8oJxUfkjlDQN9RbMx+bEjP7+ggMiFRprSti032Oipxw==" + }, + "on-finished": { + "version": "2.3.0", + "resolved": "https://registry.npmjs.org/on-finished/-/on-finished-2.3.0.tgz", + "integrity": "sha1-IPEzZIGwg811M3mSoWlxqi2QaUc=", + "requires": { + "ee-first": "1.1.1" + } + }, + "parseurl": { + "version": "1.3.3", + "resolved": "https://registry.npmjs.org/parseurl/-/parseurl-1.3.3.tgz", + "integrity": "sha512-CiyeOxFT/JZyN5m0z9PfXw4SCBJ6Sygz1Dpl0wqjlhDEGGBP1GnsUVEL0p63hoG1fcj3fHynXi9NYO4nWOL+qQ==" + }, + "path-to-regexp": { + "version": "0.1.7", + "resolved": "https://registry.npmjs.org/path-to-regexp/-/path-to-regexp-0.1.7.tgz", + "integrity": "sha1-32BBeABfUi8V60SQ5yR6G/qmf4w=" + }, + "picomatch": { + "version": "2.2.2", + "resolved": "https://registry.npmjs.org/picomatch/-/picomatch-2.2.2.tgz", + "integrity": "sha512-q0M/9eZHzmr0AulXyPwNfZjtwZ/RBZlbN3K3CErVrk50T2ASYI7Bye0EvekFY3IP1Nt2DHu0re+V2ZHIpMkuWg==" + }, + "proxy-addr": { + "version": "2.0.6", + "resolved": "https://registry.npmjs.org/proxy-addr/-/proxy-addr-2.0.6.tgz", + "integrity": "sha512-dh/frvCBVmSsDYzw6n926jv974gddhkFPfiN8hPOi30Wax25QZyZEGveluCgliBnqmuM+UJmBErbAUFIoDbjOw==", + "requires": { + "forwarded": "~0.1.2", + "ipaddr.js": "1.9.1" + } + }, + "qs": { + "version": "6.7.0", + "resolved": "https://registry.npmjs.org/qs/-/qs-6.7.0.tgz", + "integrity": "sha512-VCdBRNFTX1fyE7Nb6FYoURo/SPe62QCaAyzJvUjwRaIsc+NePBEniHlvxFmmX56+HZphIGtV0XeCirBtpDrTyQ==" + }, + "range-parser": { + "version": "1.2.1", + "resolved": "https://registry.npmjs.org/range-parser/-/range-parser-1.2.1.tgz", + "integrity": "sha512-Hrgsx+orqoygnmhFbKaHE6c296J+HTAQXoxEF6gNupROmmGJRoyzfG3ccAveqCBrwr/2yxQ5BVd/GTl5agOwSg==" + }, + "raw-body": { + "version": "2.4.0", + "resolved": "https://registry.npmjs.org/raw-body/-/raw-body-2.4.0.tgz", + "integrity": "sha512-4Oz8DUIwdvoa5qMJelxipzi/iJIi40O5cGV1wNYp5hvZP8ZN0T+jiNkL0QepXs+EsQ9XJ8ipEDoiH70ySUJP3Q==", + "requires": { + "bytes": "3.1.0", + "http-errors": "1.7.2", + "iconv-lite": "0.4.24", + "unpipe": "1.0.0" + } + }, + "requires-port": { + "version": "1.0.0", + "resolved": "https://registry.npmjs.org/requires-port/-/requires-port-1.0.0.tgz", + "integrity": "sha1-kl0mAdOaxIXgkc8NpcbmlNw9yv8=" + }, + "safe-buffer": { + "version": "5.1.2", + "resolved": "https://registry.npmjs.org/safe-buffer/-/safe-buffer-5.1.2.tgz", + "integrity": "sha512-Gd2UZBJDkXlY7GbJxfsE8/nvKkUEU1G38c1siN6QP6a9PT9MmHB8GnpscSmMJSoF8LOIrt8ud/wPtojys4G6+g==" + }, + "safer-buffer": { + "version": "2.1.2", + "resolved": "https://registry.npmjs.org/safer-buffer/-/safer-buffer-2.1.2.tgz", + "integrity": "sha512-YZo3K82SD7Riyi0E1EQPojLz7kpepnSQI9IyPbHHg1XXXevb5dJI7tpyN2ADxGcQbHG7vcyRHk0cbwqcQriUtg==" + }, + "send": { + "version": "0.17.1", + "resolved": "https://registry.npmjs.org/send/-/send-0.17.1.tgz", + "integrity": "sha512-BsVKsiGcQMFwT8UxypobUKyv7irCNRHk1T0G680vk88yf6LBByGcZJOTJCrTP2xVN6yI+XjPJcNuE3V4fT9sAg==", + "requires": { + "debug": "2.6.9", + "depd": "~1.1.2", + "destroy": "~1.0.4", + "encodeurl": "~1.0.2", + "escape-html": "~1.0.3", + "etag": "~1.8.1", + "fresh": "0.5.2", + "http-errors": "~1.7.2", + "mime": "1.6.0", + "ms": "2.1.1", + "on-finished": "~2.3.0", + "range-parser": "~1.2.1", + "statuses": "~1.5.0" + }, + "dependencies": { + "ms": { + "version": "2.1.1", + "resolved": "https://registry.npmjs.org/ms/-/ms-2.1.1.tgz", + "integrity": "sha512-tgp+dl5cGk28utYktBsrFqA7HKgrhgPsg6Z/EfhWI4gl1Hwq8B/GmY/0oXZ6nF8hDVesS/FpnYaD/kOWhYQvyg==" + } + } + }, + "serve-static": { + "version": "1.14.1", + "resolved": "https://registry.npmjs.org/serve-static/-/serve-static-1.14.1.tgz", + "integrity": "sha512-JMrvUwE54emCYWlTI+hGrGv5I8dEwmco/00EvkzIIsR7MqrHonbD9pO2MOfFnpFntl7ecpZs+3mW+XbQZu9QCg==", + "requires": { + "encodeurl": "~1.0.2", + "escape-html": "~1.0.3", + "parseurl": "~1.3.3", + "send": "0.17.1" + } + }, + "setprototypeof": { + "version": "1.1.1", + "resolved": "https://registry.npmjs.org/setprototypeof/-/setprototypeof-1.1.1.tgz", + "integrity": "sha512-JvdAWfbXeIGaZ9cILp38HntZSFSo3mWg6xGcJJsd+d4aRMOqauag1C63dJfDw7OaMYwEbHMOxEZ1lqVRYP2OAw==" + }, + "statuses": { + "version": "1.5.0", + "resolved": "https://registry.npmjs.org/statuses/-/statuses-1.5.0.tgz", + "integrity": "sha1-Fhx9rBd2Wf2YEfQ3cfqZOBR4Yow=" + }, + "to-regex-range": { + "version": "5.0.1", + "resolved": "https://registry.npmjs.org/to-regex-range/-/to-regex-range-5.0.1.tgz", + "integrity": "sha512-65P7iz6X5yEr1cwcgvQxbbIw7Uk3gOy5dIdtZ4rDveLqhrdJP+Li/Hx6tyK0NEb+2GCyneCMJiGqrADCSNk8sQ==", + "requires": { + "is-number": "^7.0.0" + } + }, + "toidentifier": { + "version": "1.0.0", + "resolved": "https://registry.npmjs.org/toidentifier/-/toidentifier-1.0.0.tgz", + "integrity": "sha512-yaOH/Pk/VEhBWWTlhI+qXxDFXlejDGcQipMlyxda9nthulaxLZUNcUqFxokp0vcYnvteJln5FNQDRrxj3YcbVw==" + }, + "type-is": { + "version": "1.6.18", + "resolved": "https://registry.npmjs.org/type-is/-/type-is-1.6.18.tgz", + "integrity": "sha512-TkRKr9sUTxEH8MdfuCSP7VizJyzRNMjj2J2do2Jr3Kym598JVdEksuzPQCnlFPW4ky9Q+iA+ma9BGm06XQBy8g==", + "requires": { + "media-typer": "0.3.0", + "mime-types": "~2.1.24" + } + }, + "unpipe": { + "version": "1.0.0", + "resolved": "https://registry.npmjs.org/unpipe/-/unpipe-1.0.0.tgz", + "integrity": "sha1-sr9O6FFKrmFltIF4KdIbLvSZBOw=" + }, + "utils-merge": { + "version": "1.0.1", + "resolved": "https://registry.npmjs.org/utils-merge/-/utils-merge-1.0.1.tgz", + "integrity": "sha1-n5VxD1CiZ5R7LMwSR0HBAoQn5xM=" + }, + "vary": { + "version": "1.1.2", + "resolved": "https://registry.npmjs.org/vary/-/vary-1.1.2.tgz", + "integrity": "sha1-IpnwLG3tMNSllhsLn3RSShj2NPw=" + } + } +} diff --git a/preview/package.json b/preview/package.json new file mode 100644 index 000000000..8118ce77a --- /dev/null +++ b/preview/package.json @@ -0,0 +1,18 @@ +{ + "name": "cosmos-explorer-preview", + "version": "1.0.0", + "description": "", + "main": "index.js", + "scripts": { + "deploy": "az webapp up -n cosmos-explorer-preview --subscription cosmosdb-portalteam-generaldemo -g stfaul", + "start": "node index.js", + "test": "echo \"Error: no test specified\" && exit 1" + }, + "keywords": [], + "author": "Microsoft Corporation", + "dependencies": { + "express": "^4.17.1", + "http-proxy-middleware": "^1.1.0", + "node-fetch": "^2.6.1" + } +} diff --git a/src/Bindings/ReactBindingHandler.ts b/src/Bindings/ReactBindingHandler.ts index bbd6c5b76..297b8a242 100644 --- a/src/Bindings/ReactBindingHandler.ts +++ b/src/Bindings/ReactBindingHandler.ts @@ -22,13 +22,7 @@ export interface ReactAdapter { export class Registerer { public static register(): void { ko.bindingHandlers.react = { - init: ( - element: any, - wrappedValueAccessor: () => any, - allBindings?: ko.AllBindings, - viewModel?: any, - bindingContext?: ko.BindingContext - ) => { + init: (element: any, wrappedValueAccessor: () => any) => { const adapter: ReactAdapter = wrappedValueAccessor(); if (adapter.setElement) { diff --git a/src/CellOutputViewer/CellOutputViewer.less b/src/CellOutputViewer/CellOutputViewer.less new file mode 100644 index 000000000..0be451c1a --- /dev/null +++ b/src/CellOutputViewer/CellOutputViewer.less @@ -0,0 +1,15 @@ +.schema-analyzer-cell-outputs { + padding: 10px 2px; +} + +// Mimic FluentUI8's DocumentCard style +.schema-analyzer-cell-output { + margin-bottom: 20px; + padding: 14px 20px; + border: 1px solid rgb(237, 235, 233); +} + +.schema-analyzer-cell-output:hover { + border-color: rgb(200, 198, 196); + box-shadow: inset 0 0 0 1px rgb(200, 198, 196) +} \ No newline at end of file diff --git a/src/CellOutputViewer/CellOutputViewer.tsx b/src/CellOutputViewer/CellOutputViewer.tsx new file mode 100644 index 000000000..40563d304 --- /dev/null +++ b/src/CellOutputViewer/CellOutputViewer.tsx @@ -0,0 +1,104 @@ +import { createImmutableOutput, JSONObject, OnDiskOutput } from "@nteract/commutable"; +// import outputs individually to avoid increasing the bundle size +import { KernelOutputError } from "@nteract/outputs/lib/components/kernel-output-error"; +import { Output } from "@nteract/outputs/lib/components/output"; +import { StreamText } from "@nteract/outputs/lib/components/stream-text"; +import { ContentRef } from "@nteract/types"; +import "bootstrap/dist/css/bootstrap.css"; +import postRobot from "post-robot"; +import * as React from "react"; +import * as ReactDOM from "react-dom"; +import "../../externals/iframeResizer.contentWindow.min.js"; // Required for iFrameResizer to work +import { SnapshotRequest } from "../Explorer/Notebook/NotebookComponent/types"; +import "../Explorer/Notebook/NotebookRenderer/base.css"; +import "../Explorer/Notebook/NotebookRenderer/default.css"; +import { NotebookUtil } from "../Explorer/Notebook/NotebookUtil"; +import "./CellOutputViewer.less"; +import { TransformMedia } from "./TransformMedia"; + +export interface SnapshotResponse { + imageSrc: string; + requestId: string; +} +export interface CellOutputViewerProps { + id: string; + contentRef: ContentRef; + outputsContainerClassName: string; + outputClassName: string; + outputs: OnDiskOutput[]; + onMetadataChange: (metadata: JSONObject, mediaType: string, index?: number) => void; +} + +const onInit = async () => { + postRobot.on( + "props", + { + window: window.parent, + domain: window.location.origin, + }, + (event) => { + // Typescript definition for event is wrong. So read props by casting to + // eslint-disable-next-line @typescript-eslint/no-explicit-any + const props = (event as any).data as CellOutputViewerProps; + const outputs = ( +
+ {props.outputs?.map((output, index) => ( +
+ + props.onMetadataChange(metadata, mediaType, index)} + /> + props.onMetadataChange(metadata, mediaType, index)} + /> + + + +
+ ))} +
+ ); + + ReactDOM.render(outputs, document.getElementById("cellOutput")); + } + ); + + postRobot.on( + "snapshotRequest", + { + window: window.parent, + domain: window.location.origin, + }, + async (event): Promise => { + const topNode = document.getElementById("cellOutput"); + if (!topNode) { + const errorMsg = "No top node to snapshot"; + return Promise.reject(new Error(errorMsg)); + } + + // Typescript definition for event is wrong. So read props by casting to + // eslint-disable-next-line @typescript-eslint/no-explicit-any + const snapshotRequest = (event as any).data as SnapshotRequest; + const result = await NotebookUtil.takeScreenshotDomToImage( + topNode, + snapshotRequest.aspectRatio, + undefined, + snapshotRequest.downloadFilename + ); + + return { + imageSrc: result.imageSrc, + requestId: snapshotRequest.requestId, + }; + } + ); +}; + +// Entry point +window.addEventListener("load", onInit); diff --git a/src/CellOutputViewer/TransformMedia.tsx b/src/CellOutputViewer/TransformMedia.tsx new file mode 100644 index 000000000..b38922042 --- /dev/null +++ b/src/CellOutputViewer/TransformMedia.tsx @@ -0,0 +1,138 @@ +import { ImmutableDisplayData, ImmutableExecuteResult, JSONObject } from "@nteract/commutable"; +// import outputs individually to avoid increasing the bundle size +import { HTML } from "@nteract/outputs/lib/components/media/html"; +import { Image } from "@nteract/outputs/lib/components/media/image"; +import { JavaScript } from "@nteract/outputs/lib/components/media/javascript"; +import { Json } from "@nteract/outputs/lib/components/media/json"; +import { LaTeX } from "@nteract/outputs/lib/components/media/latex"; +import { Plain } from "@nteract/outputs/lib/components/media/plain"; +import { SVG } from "@nteract/outputs/lib/components/media/svg"; +import { ContentRef } from "@nteract/types"; +import React, { Suspense } from "react"; + +const EmptyTransform = (): JSX.Element => <>; + +const displayOrder = [ + "application/vnd.jupyter.widget-view+json", + "application/vnd.vega.v5+json", + "application/vnd.vega.v4+json", + "application/vnd.vega.v3+json", + "application/vnd.vega.v2+json", + "application/vnd.vegalite.v4+json", + "application/vnd.vegalite.v3+json", + "application/vnd.vegalite.v2+json", + "application/vnd.vegalite.v1+json", + "application/geo+json", + "application/vnd.plotly.v1+json", + "text/vnd.plotly.v1+html", + "application/x-nteract-model-debug+json", + "application/vnd.dataresource+json", + "application/vdom.v1+json", + "application/json", + "application/javascript", + "text/html", + "text/markdown", + "text/latex", + "image/svg+xml", + "image/gif", + "image/png", + "image/jpeg", + "text/plain", +]; + +// eslint-disable-next-line @typescript-eslint/no-explicit-any +const transformsById = new Map>([ + ["text/vnd.plotly.v1+html", React.lazy(() => import("@nteract/transform-plotly"))], + ["application/vnd.plotly.v1+json", React.lazy(() => import("@nteract/transform-plotly"))], + ["application/geo+json", EmptyTransform], // TODO: The geojson transform will likely need some work because of the basemap URL(s) + ["application/x-nteract-model-debug+json", React.lazy(() => import("@nteract/transform-model-debug"))], + ["application/vnd.dataresource+json", React.lazy(() => import("@nteract/data-explorer"))], + ["application/vnd.jupyter.widget-view+json", React.lazy(() => import("./transforms/WidgetDisplay"))], + ["application/vnd.vegalite.v1+json", React.lazy(() => import("./transforms/VegaLite1"))], + ["application/vnd.vegalite.v2+json", React.lazy(() => import("./transforms/VegaLite2"))], + ["application/vnd.vegalite.v3+json", React.lazy(() => import("./transforms/VegaLite3"))], + ["application/vnd.vegalite.v4+json", React.lazy(() => import("./transforms/VegaLite4"))], + ["application/vnd.vega.v2+json", React.lazy(() => import("./transforms/Vega2"))], + ["application/vnd.vega.v3+json", React.lazy(() => import("./transforms/Vega3"))], + ["application/vnd.vega.v4+json", React.lazy(() => import("./transforms/Vega4"))], + ["application/vnd.vega.v5+json", React.lazy(() => import("./transforms/Vega5"))], + ["application/vdom.v1+json", React.lazy(() => import("@nteract/transform-vdom"))], + ["application/json", Json], + ["application/javascript", JavaScript], + ["text/html", HTML], + ["text/markdown", React.lazy(() => import("@nteract/outputs/lib/components/media/markdown"))], // Markdown increases the bundle size so lazy load it + ["text/latex", LaTeX], + ["image/svg+xml", SVG], + ["image/gif", Image], + ["image/png", Image], + ["image/jpeg", Image], + ["text/plain", Plain], +]); + +interface TransformMediaProps { + output_type: string; + id: string; + contentRef: ContentRef; + output?: ImmutableDisplayData | ImmutableExecuteResult; + onMetadataChange: (metadata: JSONObject, mediaType: string) => void; +} + +export const TransformMedia = (props: TransformMediaProps): JSX.Element => { + const { Media, mediaType, data, metadata } = getMediaInfo(props); + + // If we had no valid result, return an empty output + if (!mediaType || !data) { + return <>; + } + + return ( + Loading...}> + + + ); +}; + +const getMediaInfo = (props: TransformMediaProps) => { + const { output, output_type } = props; + // This component should only be used with display data and execute result + if (!output || !(output_type === "display_data" || output_type === "execute_result")) { + console.warn("connected transform media managed to get a non media bundle output"); + return { + Media: EmptyTransform, + }; + } + + // Find the first mediaType in the output data that we support with a handler + const mediaType = displayOrder.find( + (key) => + Object.prototype.hasOwnProperty.call(output.data, key) && + (Object.prototype.hasOwnProperty.call(transformsById, key) || transformsById.get(key)) + ); + + if (mediaType) { + const metadata = output.metadata.get(mediaType); + const data = output.data[mediaType]; + + const Media = transformsById.get(mediaType); + return { + Media, + mediaType, + data, + metadata, + }; + } + + return { + Media: EmptyTransform, + mediaType, + output, + }; +}; + +export default TransformMedia; diff --git a/src/CellOutputViewer/cellOutputViewer.html b/src/CellOutputViewer/cellOutputViewer.html new file mode 100644 index 000000000..7db8c5958 --- /dev/null +++ b/src/CellOutputViewer/cellOutputViewer.html @@ -0,0 +1,12 @@ + + + + + + Cell Output Viewer + + + +
+ + diff --git a/src/CellOutputViewer/transforms/Vega2.ts b/src/CellOutputViewer/transforms/Vega2.ts new file mode 100644 index 000000000..08a358f54 --- /dev/null +++ b/src/CellOutputViewer/transforms/Vega2.ts @@ -0,0 +1 @@ +export { Vega2 as default } from "@nteract/transform-vega"; diff --git a/src/CellOutputViewer/transforms/Vega3.ts b/src/CellOutputViewer/transforms/Vega3.ts new file mode 100644 index 000000000..87289b52f --- /dev/null +++ b/src/CellOutputViewer/transforms/Vega3.ts @@ -0,0 +1 @@ +export { Vega3 as default } from "@nteract/transform-vega"; diff --git a/src/CellOutputViewer/transforms/Vega4.ts b/src/CellOutputViewer/transforms/Vega4.ts new file mode 100644 index 000000000..a95100d63 --- /dev/null +++ b/src/CellOutputViewer/transforms/Vega4.ts @@ -0,0 +1 @@ +export { Vega4 as default } from "@nteract/transform-vega"; diff --git a/src/CellOutputViewer/transforms/Vega5.ts b/src/CellOutputViewer/transforms/Vega5.ts new file mode 100644 index 000000000..6fa20b452 --- /dev/null +++ b/src/CellOutputViewer/transforms/Vega5.ts @@ -0,0 +1 @@ +export { Vega5 as default } from "@nteract/transform-vega"; diff --git a/src/CellOutputViewer/transforms/VegaLite1.ts b/src/CellOutputViewer/transforms/VegaLite1.ts new file mode 100644 index 000000000..fb615d92c --- /dev/null +++ b/src/CellOutputViewer/transforms/VegaLite1.ts @@ -0,0 +1 @@ +export { VegaLite1 as default } from "@nteract/transform-vega"; diff --git a/src/CellOutputViewer/transforms/VegaLite2.ts b/src/CellOutputViewer/transforms/VegaLite2.ts new file mode 100644 index 000000000..f664e0bda --- /dev/null +++ b/src/CellOutputViewer/transforms/VegaLite2.ts @@ -0,0 +1 @@ +export { VegaLite2 as default } from "@nteract/transform-vega"; diff --git a/src/CellOutputViewer/transforms/VegaLite3.ts b/src/CellOutputViewer/transforms/VegaLite3.ts new file mode 100644 index 000000000..8a57abbc4 --- /dev/null +++ b/src/CellOutputViewer/transforms/VegaLite3.ts @@ -0,0 +1 @@ +export { VegaLite3 as default } from "@nteract/transform-vega"; diff --git a/src/CellOutputViewer/transforms/VegaLite4.ts b/src/CellOutputViewer/transforms/VegaLite4.ts new file mode 100644 index 000000000..fca92c80f --- /dev/null +++ b/src/CellOutputViewer/transforms/VegaLite4.ts @@ -0,0 +1 @@ +export { VegaLite4 as default } from "@nteract/transform-vega"; diff --git a/src/CellOutputViewer/transforms/WidgetDisplay.ts b/src/CellOutputViewer/transforms/WidgetDisplay.ts new file mode 100644 index 000000000..4387a4f5d --- /dev/null +++ b/src/CellOutputViewer/transforms/WidgetDisplay.ts @@ -0,0 +1 @@ +export { WidgetDisplay as default } from "@nteract/jupyter-widgets"; diff --git a/src/Common/ArrayHashMap.ts b/src/Common/ArrayHashMap.ts index eef791373..8b1600d6c 100644 --- a/src/Common/ArrayHashMap.ts +++ b/src/Common/ArrayHashMap.ts @@ -1,49 +1,9 @@ -import { HashMap } from "./HashMap"; - /** * Hash map of arrays which allows to: * - push an item by key: add to array and create array if needed * - remove item by key: remove from array and delete array if needed */ - -export class ArrayHashMap { - private store: HashMap; - - constructor() { - this.store = new HashMap(); - } - - public has(key: string): boolean { - return this.store.has(key); - } - - public get(key: string): T[] { - return this.store.get(key); - } - - public size(): number { - return this.store.size(); - } - - public clear(): void { - this.store.clear(); - } - - public keys(): string[] { - return this.store.keys(); - } - - public delete(key: string): boolean { - return this.store.delete(key); - } - - public forEach(key: string, iteratorFct: (value: T) => void) { - const values = this.store.get(key); - if (values) { - values.forEach((value) => iteratorFct(value)); - } - } - +export class ArrayHashMap extends Map { /** * Insert item into array. * If no array, create one. @@ -52,16 +12,8 @@ export class ArrayHashMap { * @param item */ public push(key: string, item: T): void { - let itemsArray: T[] = this.store.get(key); - if (!itemsArray) { - itemsArray = [item]; - this.store.set(key, itemsArray); - return; - } - - if (itemsArray.indexOf(item) === -1) { - itemsArray.push(item); - } + const array = this.get(key); + array ? array.includes(item) || array.push(item) : this.set(key, [item]); } /** @@ -70,18 +22,11 @@ export class ArrayHashMap { * @param key * @param itemToRemove */ - public remove(key: string, itemToRemove: T) { - if (!this.store.has(key)) { - return; - } - - const itemsArray = this.store.get(key); - const index = itemsArray.indexOf(itemToRemove); - if (index >= 0) { - itemsArray.splice(index, 1); - if (itemsArray.length === 0) { - this.store.delete(key); - } + public remove(key: string, itemToRemove: T): void { + const array = this.get(key); + if (array) { + const remaining = array.filter((item) => item !== itemToRemove); + remaining.length ? this.set(key, remaining) : this.delete(key); } } } diff --git a/src/Common/CollapsedResourceTree.tsx b/src/Common/CollapsedResourceTree.tsx new file mode 100644 index 000000000..8a91fd5d3 --- /dev/null +++ b/src/Common/CollapsedResourceTree.tsx @@ -0,0 +1,36 @@ +import React, { FunctionComponent } from "react"; +import arrowLeftImg from "../../images/imgarrowlefticon.svg"; +import { userContext } from "../UserContext"; + +export interface CollapsedResourceTreeProps { + toggleLeftPaneExpanded: () => void; + isLeftPaneExpanded: boolean; +} + +export const CollapsedResourceTree: FunctionComponent = ({ + toggleLeftPaneExpanded, + isLeftPaneExpanded, +}: CollapsedResourceTreeProps): JSX.Element => { + return ( +
+
+
    +
  • + + Expand + + + {userContext.apiType} API + +
    • +
+
+
+ ); +}; diff --git a/src/Common/Constants.ts b/src/Common/Constants.ts index 2f831b77e..fc97d559d 100644 --- a/src/Common/Constants.ts +++ b/src/Common/Constants.ts @@ -44,7 +44,7 @@ export class ArmResourceTypes { } export class BackendDefaults { - public static partitionKeyKind: string = "Hash"; + public static partitionKeyKind = "Hash"; public static singlePartitionStorageInGb: string = "10"; public static multiPartitionStorageInGb: string = "100"; public static maxChangeFeedRetentionDuration: number = 10; @@ -65,28 +65,18 @@ export class ClientDefaults { public static readonly arcadiaTokenRefreshIntervalPaddingMs: number = 2000; } -export class AccountKind { - public static DocumentDB: string = "DocumentDB"; - public static MongoDB: string = "MongoDB"; - public static Parse: string = "Parse"; - public static GlobalDocumentDB: string = "GlobalDocumentDB"; - public static Default: string = AccountKind.DocumentDB; +export enum AccountKind { + DocumentDB = "DocumentDB", + MongoDB = "MongoDB", + Parse = "Parse", + GlobalDocumentDB = "GlobalDocumentDB", + Default = "DocumentDB", } export class CorrelationBackend { public static Url: string = "https://aka.ms/cosmosdbanalytics"; } -export class DefaultAccountExperience { - public static DocumentDB: string = "DocumentDB"; - public static Graph: string = "Graph"; - public static MongoDB: string = "MongoDB"; - public static ApiForMongoDB: string = "Azure Cosmos DB for MongoDB API"; - public static Table: string = "Table"; - public static Cassandra: string = "Cassandra"; - public static Default: string = DefaultAccountExperience.DocumentDB; -} - export class CapabilityNames { public static EnableTable: string = "EnableTable"; public static EnableGremlin: string = "EnableGremlin"; @@ -98,36 +88,13 @@ export class CapabilityNames { public static readonly EnableServerless: string = "EnableServerless"; } -export class Features { - public static readonly cosmosdb = "cosmosdb"; - public static readonly enableChangeFeedPolicy = "enablechangefeedpolicy"; - public static readonly executeSproc = "dataexplorerexecutesproc"; - public static readonly hostedDataExplorer = "hosteddataexplorerenabled"; - public static readonly enableTtl = "enablettl"; - public static readonly enableNotebooks = "enablenotebooks"; - public static readonly enableSpark = "enablespark"; - public static readonly livyEndpoint = "livyendpoint"; - public static readonly notebookServerUrl = "notebookserverurl"; - public static readonly notebookServerToken = "notebookservertoken"; - public static readonly notebookBasePath = "notebookbasepath"; - public static readonly canExceedMaximumValue = "canexceedmaximumvalue"; - public static readonly enableFixedCollectionWithSharedThroughput = "enablefixedcollectionwithsharedthroughput"; - public static readonly ttl90Days = "ttl90days"; - public static readonly enableRightPanelV2 = "enablerightpanelv2"; - public static readonly enableSchema = "enableschema"; - public static readonly enableSDKoperations = "enablesdkoperations"; - public static readonly showMinRUSurvey = "showminrusurvey"; - public static readonly enableDatabaseSettingsTabV1 = "enabledbsettingsv1"; - public static readonly selfServeType = "selfservetype"; - public static readonly enableKOPanel = "enablekopanel"; -} - // flight names returned from the portal are always lowercase export class Flights { public static readonly SettingsV2 = "settingsv2"; public static readonly MongoIndexEditor = "mongoindexeditor"; public static readonly MongoIndexing = "mongoindexing"; public static readonly AutoscaleTest = "autoscaletest"; + public static readonly PartitionKeyTest = "partitionkeytest"; } export class AfecFeatures { @@ -191,16 +158,6 @@ export class DocumentsGridMetrics { public static DocumentEditorMaxWidthRatio: number = 0.4; } -export class ExplorerMetrics { - public static SplitterMinWidth: number = 240; - public static SplitterMaxWidth: number = 400; - public static CollapsedResourceTreeWidth: number = 36; -} - -export class SplitterMetrics { - public static CollapsedPositionLeft: number = ExplorerMetrics.CollapsedResourceTreeWidth; -} - export class Areas { public static ResourceTree: string = "Resource Tree"; public static ContextualPane: string = "Contextual Pane"; diff --git a/src/Common/CosmosClient.test.ts b/src/Common/CosmosClient.test.ts index ea91efa53..96505f208 100644 --- a/src/Common/CosmosClient.test.ts +++ b/src/Common/CosmosClient.test.ts @@ -1,5 +1,5 @@ import { ResourceType } from "@azure/cosmos/dist-esm/common/constants"; -import { configContext, Platform, updateConfigContext, resetConfigContext } from "../ConfigContext"; +import { Platform, resetConfigContext, updateConfigContext } from "../ConfigContext"; import { updateUserContext } from "../UserContext"; import { endpoint, getTokenFromAuthService, requestPlugin, tokenProvider } from "./CosmosClient"; @@ -91,7 +91,6 @@ describe("endpoint", () => { location: "foo", type: "foo", kind: "foo", - tags: [], properties: { documentEndpoint: "bar", gremlinEndpoint: "foo", diff --git a/src/Common/CosmosClient.ts b/src/Common/CosmosClient.ts index 7c23b3388..14aa882fa 100644 --- a/src/Common/CosmosClient.ts +++ b/src/Common/CosmosClient.ts @@ -1,15 +1,22 @@ import * as Cosmos from "@azure/cosmos"; import { RequestInfo, setAuthorizationTokenHeaderUsingMasterKey } from "@azure/cosmos"; import { configContext, Platform } from "../ConfigContext"; -import { getErrorMessage } from "./ErrorHandlingUtils"; +import { userContext } from "../UserContext"; import { logConsoleError } from "../Utils/NotificationConsoleUtils"; import { EmulatorMasterKey, HttpHeaders } from "./Constants"; -import { userContext } from "../UserContext"; +import { getErrorMessage } from "./ErrorHandlingUtils"; const _global = typeof self === "undefined" ? window : self; export const tokenProvider = async (requestInfo: RequestInfo) => { const { verb, resourceId, resourceType, headers } = requestInfo; + + if (userContext.features.enableAadDataPlane && userContext.aadToken) { + const AUTH_PREFIX = `type=aad&ver=1.0&sig=`; + const authorizationToken = `${AUTH_PREFIX}${userContext.aadToken}`; + return authorizationToken; + } + if (configContext.platform === Platform.Emulator) { // TODO This SDK method mutates the headers object. Find a better one or fix the SDK. await setAuthorizationTokenHeaderUsingMasterKey(verb, resourceId, resourceType, headers, EmulatorMasterKey); @@ -32,7 +39,7 @@ export const tokenProvider = async (requestInfo: RequestInfo) => { }; export const requestPlugin: Cosmos.Plugin = async (requestContext, next) => { - requestContext.endpoint = configContext.PROXY_PATH; + requestContext.endpoint = new URL(configContext.PROXY_PATH, window.location.href).href; requestContext.headers["x-ms-proxy-target"] = endpoint(); return next(requestContext); }; @@ -43,12 +50,7 @@ export const endpoint = () => { const location = _global.parent ? _global.parent.location : _global.location; return configContext.EMULATOR_ENDPOINT || location.origin; } - return ( - userContext.endpoint || - (userContext.databaseAccount && - userContext.databaseAccount.properties && - userContext.databaseAccount.properties.documentEndpoint) - ); + return userContext.endpoint || userContext?.databaseAccount?.properties?.documentEndpoint; }; export async function getTokenFromAuthService(verb: string, resourceType: string, resourceId?: string): Promise { @@ -75,7 +77,10 @@ export async function getTokenFromAuthService(verb: string, resourceType: string } } +let _client: Cosmos.CosmosClient; + export function client(): Cosmos.CosmosClient { + if (_client) return _client; const options: Cosmos.CosmosClientOptions = { endpoint: endpoint() || "https://cosmos.azure.com", // CosmosClient gets upset if we pass a bad URL. This should never actually get called key: userContext.masterKey, @@ -89,5 +94,6 @@ export function client(): Cosmos.CosmosClient { if (configContext.PROXY_PATH !== undefined) { (options as any).plugins = [{ on: "request", plugin: requestPlugin }]; } - return new Cosmos.CosmosClient(options); + _client = new Cosmos.CosmosClient(options); + return _client; } diff --git a/src/Common/DatabaseAccountUtility.ts b/src/Common/DatabaseAccountUtility.ts new file mode 100644 index 000000000..693f581f8 --- /dev/null +++ b/src/Common/DatabaseAccountUtility.ts @@ -0,0 +1,17 @@ +import { userContext } from "../UserContext"; + +function isVirtualNetworkFilterEnabled() { + return userContext.databaseAccount?.properties?.isVirtualNetworkFilterEnabled; +} + +function isIpRulesEnabled() { + return userContext.databaseAccount?.properties?.ipRules?.length > 0; +} + +function isPrivateEndpointConnectionsEnabled() { + return userContext.databaseAccount?.properties?.privateEndpointConnections?.length > 0; +} + +export function isPublicInternetAccessAllowed(): boolean { + return !isVirtualNetworkFilterEnabled() && !isIpRulesEnabled() && !isPrivateEndpointConnectionsEnabled(); +} diff --git a/src/Common/DocumentUtility.ts b/src/Common/DocumentUtility.ts index b552ba495..99cdefc5a 100644 --- a/src/Common/DocumentUtility.ts +++ b/src/Common/DocumentUtility.ts @@ -1,8 +1,7 @@ -import { DefaultAccountExperienceType } from "../DefaultAccountExperienceType"; import { userContext } from "../UserContext"; export const getEntityName = (): string => { - if (userContext.defaultExperience === DefaultAccountExperienceType.MongoDB) { + if (userContext.apiType === "Mongo") { return "document"; } diff --git a/src/Common/EntityValue.tsx b/src/Common/EntityValue.tsx new file mode 100644 index 000000000..788e08f85 --- /dev/null +++ b/src/Common/EntityValue.tsx @@ -0,0 +1,66 @@ +import { DatePicker, TextField } from "@fluentui/react"; +import React, { FunctionComponent } from "react"; + +export interface TableEntityProps { + entityValueLabel?: string; + entityValuePlaceholder: string; + entityValue: string | Date; + isEntityTypeDate: boolean; + isEntityValueDisable?: boolean; + entityTimeValue: string; + entityValueType: string; + onEntityValueChange: (event: React.FormEvent, newInput?: string) => void; + onSelectDate: (date: Date | null | undefined) => void; + onEntityTimeValueChange: (event: React.FormEvent, newInput?: string) => void; +} + +export const EntityValue: FunctionComponent = ({ + entityValueLabel, + entityValuePlaceholder, + entityValue, + isEntityTypeDate, + entityTimeValue, + entityValueType, + onEntityValueChange, + onSelectDate, + isEntityValueDisable, + onEntityTimeValueChange, +}: TableEntityProps): JSX.Element => { + if (isEntityTypeDate) { + return ( + <> + + + + ); + } + + return ( + + ); +}; diff --git a/src/Common/ErrorHandlingUtils.ts b/src/Common/ErrorHandlingUtils.ts index c303e1f74..8a86bdf32 100644 --- a/src/Common/ErrorHandlingUtils.ts +++ b/src/Common/ErrorHandlingUtils.ts @@ -1,8 +1,9 @@ -import { ARMError } from "../Utils/arm/request"; -import { HttpStatusCodes } from "./Constants"; import { MessageTypes } from "../Contracts/ExplorerContracts"; import { SubscriptionType } from "../Contracts/SubscriptionType"; +import { userContext } from "../UserContext"; +import { ARMError } from "../Utils/arm/request"; import { logConsoleError } from "../Utils/NotificationConsoleUtils"; +import { HttpStatusCodes } from "./Constants"; import { logError } from "./Logger"; import { sendMessage } from "./MessageHandler"; @@ -44,7 +45,7 @@ const sendNotificationForError = (errorMessage: string, errorCode: number | stri const replaceKnownError = (errorMessage: string): string => { if ( - window.dataExplorer?.subscriptionType() === SubscriptionType.Internal && + userContext.subscriptionType === SubscriptionType.Internal && errorMessage?.indexOf("SharedOffer is Disabled for your account") >= 0 ) { return "Database throughput is not supported for internal subscriptions."; diff --git a/src/Common/HashMap.test.ts b/src/Common/HashMap.test.ts deleted file mode 100644 index b3bdaa225..000000000 --- a/src/Common/HashMap.test.ts +++ /dev/null @@ -1,70 +0,0 @@ -import { HashMap } from "./HashMap"; - -describe("HashMap", () => { - it("should test if key/val exists", () => { - const map = new HashMap(); - map.set("a", 123); - - expect(map.has("a")).toBe(true); - expect(map.has("b")).toBe(false); - }); - - it("should get object back", () => { - const map = new HashMap(); - map.set("a", "123"); - map.set("a", "456"); - - expect(map.get("a")).toBe("456"); - expect(map.get("a")).not.toBe("123"); - }); - - it("should return the right size", () => { - const map = new HashMap(); - map.set("a", "123"); - map.set("b", "456"); - - expect(map.size()).toBe(2); - }); - - it("should be iterable", () => { - const map = new HashMap(); - map.set("a", 1); - map.set("b", 10); - map.set("c", 100); - map.set("d", 1000); - - let i = 0; - map.forEach((key: string, value: number) => { - i += value; - }); - expect(i).toBe(1111); - }); - - it("should be deleted", () => { - const map = new HashMap(); - map.set("a", 1); - map.set("b", 10); - - expect(map.delete("a")).toBe(true); - expect(map.delete("c")).toBe(false); - expect(map.has("a")).toBe(false); - expect(map.has("b")).toBe(true); - }); - - it("should clear", () => { - const map = new HashMap(); - map.set("a", 1); - map.clear(); - expect(map.size()).toBe(0); - expect(map.has("a")).toBe(false); - }); - - it("should return all keys", () => { - const map = new HashMap(); - map.set("a", 1); - map.set("b", 1); - expect(map.keys()).toEqual(["a", "b"]); - map.clear(); - expect(map.keys().length).toBe(0); - }); -}); diff --git a/src/Common/HashMap.ts b/src/Common/HashMap.ts deleted file mode 100644 index 0a55b08c5..000000000 --- a/src/Common/HashMap.ts +++ /dev/null @@ -1,45 +0,0 @@ -/** - * Simple hashmap implementation that doesn't rely on ES6 Map nor polyfills - */ -export class HashMap { - constructor(private container: { [key: string]: T } = {}) {} - - public has(key: string): boolean { - return this.container.hasOwnProperty(key); - } - - public set(key: string, value: T): void { - this.container[key] = value; - } - - public get(key: string): T { - return this.container[key]; - } - - public size(): number { - return Object.keys(this.container).length; - } - - public delete(key: string): boolean { - if (this.has(key)) { - delete this.container[key]; - return true; - } - - return false; - } - - public clear(): void { - this.container = {}; - } - - public keys(): string[] { - return Object.keys(this.container); - } - - public forEach(iteratorFct: (key: string, value: T) => void) { - for (const k in this.container) { - iteratorFct(k, this.container[k]); - } - } -} diff --git a/src/Common/HeadersUtility.test.ts b/src/Common/HeadersUtility.test.ts index 5f46c420f..5432227fa 100644 --- a/src/Common/HeadersUtility.test.ts +++ b/src/Common/HeadersUtility.test.ts @@ -1,6 +1,6 @@ -import * as HeadersUtility from "./HeadersUtility"; -import { ExplorerSettings } from "../Shared/ExplorerSettings"; +import * as ExplorerSettings from "../Shared/ExplorerSettings"; import { LocalStorageUtility, StorageKey } from "../Shared/StorageUtility"; +import * as HeadersUtility from "./HeadersUtility"; describe("Headers Utility", () => { describe("shouldEnableCrossPartitionKeyForResourceWithPartitionKey()", () => { diff --git a/src/Common/HeadersUtility.ts b/src/Common/HeadersUtility.ts index 0579c1776..7fd7238a8 100644 --- a/src/Common/HeadersUtility.ts +++ b/src/Common/HeadersUtility.ts @@ -1,28 +1,5 @@ -import * as Constants from "./Constants"; - import { LocalStorageUtility, StorageKey } from "../Shared/StorageUtility"; -// x-ms-resource-quota: databases = 100; collections = 5000; users = 500000; permissions = 2000000; -export function getQuota(responseHeaders: any): any { - return responseHeaders && responseHeaders[Constants.HttpHeaders.resourceQuota] - ? parseStringIntoObject(responseHeaders[Constants.HttpHeaders.resourceQuota]) - : null; -} - export function shouldEnableCrossPartitionKey(): boolean { return LocalStorageUtility.getEntryString(StorageKey.IsCrossPartitionQueryEnabled) === "true"; } - -function parseStringIntoObject(resourceString: string) { - var entityObject: any = {}; - - if (resourceString) { - var entitiesArray: string[] = resourceString.split(";"); - for (var i: any = 0; i < entitiesArray.length; i++) { - var entity: string[] = entitiesArray[i].split("="); - entityObject[entity[0]] = entity[1]; - } - } - - return entityObject; -} diff --git a/src/Common/IteratorUtilities.ts b/src/Common/IteratorUtilities.ts index 62249c1ed..f85ad7fb2 100644 --- a/src/Common/IteratorUtilities.ts +++ b/src/Common/IteratorUtilities.ts @@ -1,6 +1,8 @@ import { QueryResults } from "../Contracts/ViewModels"; interface QueryResponse { + // [Todo] remove any + // eslint-disable-next-line @typescript-eslint/no-explicit-any resources: any[]; hasMoreResults: boolean; activityId: string; @@ -16,6 +18,7 @@ export interface MinimalQueryIterator { export function nextPage(documentsIterator: MinimalQueryIterator, firstItemIndex: number): Promise { return documentsIterator.fetchNext().then((response) => { const documents = response.resources; + // eslint-disable-next-line @typescript-eslint/no-explicit-any const headers = (response as any).headers || {}; // TODO this is a private key. Remove any const itemCount = (documents && documents.length) || 0; return { diff --git a/src/Common/Logger.ts b/src/Common/Logger.ts index 1e34609df..b53226d6a 100644 --- a/src/Common/Logger.ts +++ b/src/Common/Logger.ts @@ -1,7 +1,7 @@ -import { sendMessage } from "./MessageHandler"; -import { Diagnostics, MessageTypes } from "../Contracts/ExplorerContracts"; -import { appInsights } from "../Shared/appInsights"; import { SeverityLevel } from "@microsoft/applicationinsights-web"; +import { Diagnostics, MessageTypes } from "../Contracts/ExplorerContracts"; +import { trackTrace } from "../Shared/appInsights"; +import { sendMessage } from "./MessageHandler"; // TODO: Move to a separate Diagnostics folder // eslint-disable-next-line @typescript-eslint/no-explicit-any @@ -46,7 +46,7 @@ function _logEntry(entry: Diagnostics.LogEntry): void { return SeverityLevel.Information; } })(entry.level); - appInsights.trackTrace({ message: entry.message, severityLevel }, { area: entry.area }); + trackTrace({ message: entry.message, severityLevel }, { area: entry.area }); } function _generateLogEntry( diff --git a/src/Common/MessageHandler.ts b/src/Common/MessageHandler.ts index e5bee34ed..97201b8b2 100644 --- a/src/Common/MessageHandler.ts +++ b/src/Common/MessageHandler.ts @@ -1,8 +1,8 @@ -import { MessageTypes } from "../Contracts/ExplorerContracts"; import Q from "q"; import * as _ from "underscore"; -import * as Constants from "./Constants"; +import { MessageTypes } from "../Contracts/ExplorerContracts"; import { getDataExplorerWindow } from "../Utils/WindowUtils"; +import * as Constants from "./Constants"; export interface CachedDataPromise { deferred: Q.Deferred; @@ -48,17 +48,18 @@ export function sendCachedDataMessage( } export function sendMessage(data: any): void { - if (canSendMessage()) { - // We try to find data explorer window first, then fallback to current window - const portalChildWindow = getDataExplorerWindow(window) || window; - portalChildWindow.parent.postMessage( - { - signature: "pcIframe", - data: data, - }, - portalChildWindow.document.referrer - ); - } + _sendMessage({ + signature: "pcIframe", + data: data, + }); +} + +export function sendReadyMessage(): void { + _sendMessage({ + signature: "pcIframe", + kind: "ready", + data: "ready", + }); } export function canSendMessage(): boolean { @@ -74,3 +75,17 @@ export function runGarbageCollector() { } }); } + +const _sendMessage = (message: any): void => { + if (canSendMessage()) { + // Portal window can receive messages from only child windows + const portalChildWindow = getDataExplorerWindow(window) || window; + if (portalChildWindow === window) { + // Current window is a child of portal, send message to portal window + portalChildWindow.parent.postMessage(message, portalChildWindow.document.referrer || "*"); + } else { + // Current window is not a child of portal, send message to the child window instead (which is data explorer) + portalChildWindow.postMessage(message, portalChildWindow.location.origin || "*"); + } + } +}; diff --git a/src/Common/MongoProxyClient.test.ts b/src/Common/MongoProxyClient.test.ts index 8f7e033f9..3a5a02365 100644 --- a/src/Common/MongoProxyClient.test.ts +++ b/src/Common/MongoProxyClient.test.ts @@ -5,7 +5,6 @@ import { Collection } from "../Contracts/ViewModels"; import DocumentId from "../Explorer/Tree/DocumentId"; import { updateUserContext } from "../UserContext"; import { deleteDocument, getEndpoint, queryDocuments, readDocument, updateDocument } from "./MongoProxyClient"; -jest.mock("../ResourceProvider/ResourceProviderClient.ts"); const databaseId = "testDB"; diff --git a/src/Common/MongoProxyClient.ts b/src/Common/MongoProxyClient.ts index 0680a26c2..2945f1288 100644 --- a/src/Common/MongoProxyClient.ts +++ b/src/Common/MongoProxyClient.ts @@ -5,11 +5,10 @@ import { configContext } from "../ConfigContext"; import * as DataModels from "../Contracts/DataModels"; import { MessageTypes } from "../Contracts/ExplorerContracts"; import { Collection } from "../Contracts/ViewModels"; -import { ConsoleDataType } from "../Explorer/Menus/NotificationConsole/NotificationConsoleComponent"; import DocumentId from "../Explorer/Tree/DocumentId"; -import * as NotificationConsoleUtils from "../Utils/NotificationConsoleUtils"; -import { ApiType, HttpHeaders, HttpStatusCodes } from "./Constants"; import { userContext } from "../UserContext"; +import { logConsoleError } from "../Utils/NotificationConsoleUtils"; +import { ApiType, HttpHeaders, HttpStatusCodes } from "./Constants"; import { MinimalQueryIterator } from "./IteratorUtilities"; import { sendMessage } from "./MessageHandler"; @@ -62,7 +61,7 @@ export function queryDocuments( query: string, continuationToken?: string ): Promise { - const databaseAccount = userContext.databaseAccount; + const { databaseAccount } = userContext; const resourceEndpoint = databaseAccount.properties.mongoEndpoint || databaseAccount.properties.documentEndpoint; const params = { db: databaseId, @@ -112,7 +111,7 @@ export function queryDocuments( headers: response.headers, }; } - errorHandling(response, "querying documents", params); + await errorHandling(response, "querying documents", params); return undefined; }); } @@ -122,7 +121,7 @@ export function readDocument( collection: Collection, documentId: DocumentId ): Promise { - const databaseAccount = userContext.databaseAccount; + const { databaseAccount } = userContext; const resourceEndpoint = databaseAccount.properties.mongoEndpoint || databaseAccount.properties.documentEndpoint; const idComponents = documentId.self.split("/"); const path = idComponents.slice(0, 4).join("/"); @@ -154,11 +153,11 @@ export function readDocument( ), }, }) - .then((response) => { + .then(async (response) => { if (response.ok) { return response.json(); } - return errorHandling(response, "reading document", params); + return await errorHandling(response, "reading document", params); }); } @@ -168,7 +167,7 @@ export function createDocument( partitionKeyProperty: string, documentContent: unknown ): Promise { - const databaseAccount = userContext.databaseAccount; + const { databaseAccount } = userContext; const resourceEndpoint = databaseAccount.properties.mongoEndpoint || databaseAccount.properties.documentEndpoint; const params = { db: databaseId, @@ -193,11 +192,11 @@ export function createDocument( ...authHeaders(), }, }) - .then((response) => { + .then(async (response) => { if (response.ok) { return response.json(); } - return errorHandling(response, "creating document", params); + return await errorHandling(response, "creating document", params); }); } @@ -207,7 +206,7 @@ export function updateDocument( documentId: DocumentId, documentContent: string ): Promise { - const databaseAccount = userContext.databaseAccount; + const { databaseAccount } = userContext; const resourceEndpoint = databaseAccount.properties.mongoEndpoint || databaseAccount.properties.documentEndpoint; const idComponents = documentId.self.split("/"); const path = idComponents.slice(0, 5).join("/"); @@ -239,16 +238,16 @@ export function updateDocument( [CosmosSDKConstants.HttpHeaders.PartitionKey]: JSON.stringify(documentId.partitionKeyHeader()), }, }) - .then((response) => { + .then(async (response) => { if (response.ok) { return response.json(); } - return errorHandling(response, "updating document", params); + return await errorHandling(response, "updating document", params); }); } export function deleteDocument(databaseId: string, collection: Collection, documentId: DocumentId): Promise { - const databaseAccount = userContext.databaseAccount; + const { databaseAccount } = userContext; const resourceEndpoint = databaseAccount.properties.mongoEndpoint || databaseAccount.properties.documentEndpoint; const idComponents = documentId.self.split("/"); const path = idComponents.slice(0, 5).join("/"); @@ -279,18 +278,18 @@ export function deleteDocument(databaseId: string, collection: Collection, docum [CosmosSDKConstants.HttpHeaders.PartitionKey]: JSON.stringify(documentId.partitionKeyHeader()), }, }) - .then((response) => { + .then(async (response) => { if (response.ok) { return undefined; } - return errorHandling(response, "deleting document", params); + return await errorHandling(response, "deleting document", params); }); } export function createMongoCollectionWithProxy( params: DataModels.CreateCollectionParams ): Promise { - const databaseAccount = userContext.databaseAccount; + const { databaseAccount } = userContext; const shardKey: string = params.partitionKey?.paths[0]; const mongoParams: DataModels.MongoParameters = { resourceUrl: databaseAccount.properties.mongoEndpoint || databaseAccount.properties.documentEndpoint, @@ -326,11 +325,11 @@ export function createMongoCollectionWithProxy( }, } ) - .then((response) => { + .then(async (response) => { if (response.ok) { return response.json(); } - return errorHandling(response, "creating collection", mongoParams); + return await errorHandling(response, "creating collection", mongoParams); }); } @@ -348,10 +347,7 @@ export function getEndpoint(): string { async function errorHandling(response: Response, action: string, params: unknown): Promise { const errorMessage = await response.text(); // Log the error where the user can see it - NotificationConsoleUtils.logConsoleMessage( - ConsoleDataType.Error, - `Error ${action}: ${errorMessage}, Payload: ${JSON.stringify(params)}` - ); + logConsoleError(`Error ${action}: ${errorMessage}, Payload: ${JSON.stringify(params)}`); if (response.status === HttpStatusCodes.Forbidden) { sendMessage({ type: MessageTypes.ForbiddenError, reason: errorMessage }); return; diff --git a/src/Common/ObjectCache.test.ts b/src/Common/ObjectCache.test.ts index 3a9f8f17a..7f6b5f7a7 100644 --- a/src/Common/ObjectCache.test.ts +++ b/src/Common/ObjectCache.test.ts @@ -7,7 +7,7 @@ describe("Object cache", () => { cache.set("b", 2); cache.set("c", 3); cache.set("d", 4); - expect(cache.size()).toBe(2); + expect(cache.size).toBe(2); }); it("should remove first added element to keep size at limit", () => { diff --git a/src/Common/ObjectCache.ts b/src/Common/ObjectCache.ts index 9149aba9b..0c6326087 100644 --- a/src/Common/ObjectCache.ts +++ b/src/Common/ObjectCache.ts @@ -1,56 +1,27 @@ -import { HashMap } from "./HashMap"; - -export class ObjectCache extends HashMap { - private keyQueue: string[]; // Last touched key FIFO to purge cache if too big. - private maxNbElements: number; - - public constructor(maxNbElements: number) { +export class ObjectCache extends Map { + constructor(private limit: number) { super(); - this.keyQueue = []; - this.maxNbElements = maxNbElements; - this.clear(); } - public clear(): void { - super.clear(); - this.keyQueue = []; + public get(key: string): T | undefined { + return this.touch(key); } - public get(key: string): T { - this.markKeyAsTouched(key); - return super.get(key); - } - - public set(key: string, value: T): void { - super.set(key, value); - - this.markKeyAsTouched(key); - - if (super.size() > this.maxNbElements && key !== this.keyQueue[0]) { - this.reduceCacheSize(); + public set(key: string, value: T): this { + if (this.size === this.limit) { + this.delete(this.keys().next().value); } + + return this.touch(key, value), this; } - /** - * Invalidate elements to keep the total number below the limit - */ - private reduceCacheSize(): void { - // remove a key - const oldKey = this.keyQueue.shift(); - if (oldKey) { - super.delete(oldKey); + private touch(key: string, value = super.get(key)) { + // Map keeps (re) insertion order according to ES6 spec + if (value) { + this.delete(key); + super.set(key, value); } - } - /** - * Bubble up this key as new. - * @param key - */ - private markKeyAsTouched(key: string) { - const n = this.keyQueue.indexOf(key); - if (n > -1) { - this.keyQueue.splice(n, 1); - } - this.keyQueue.push(key); + return value; } } diff --git a/src/Common/PortalNotifications.ts b/src/Common/PortalNotifications.ts index 4298b0b8f..774c37cad 100644 --- a/src/Common/PortalNotifications.ts +++ b/src/Common/PortalNotifications.ts @@ -1,8 +1,8 @@ +import { configContext, Platform } from "../ConfigContext"; import * as DataModels from "../Contracts/DataModels"; import * as ViewModels from "../Contracts/ViewModels"; -import { getAuthorizationHeader } from "../Utils/AuthorizationUtils"; import { userContext } from "../UserContext"; -import { configContext, Platform } from "../ConfigContext"; +import { getAuthorizationHeader } from "../Utils/AuthorizationUtils"; const notificationsPath = () => { switch (configContext.platform) { @@ -20,9 +20,7 @@ export const fetchPortalNotifications = async (): Promise = queryDocuments( + const results = await queryDocuments( SavedQueries.DatabaseName, SavedQueries.CollectionName, this.fetchQueriesQuery(), options - ); - const fetchQueries = async (firstItemIndex: number): Promise => - await queryDocumentsPage(queriesCollection.id(), queryIterator, firstItemIndex); - return QueryUtils.queryAllPages(fetchQueries) - .then( - (results: ViewModels.QueryResults) => { - let queries: DataModels.Query[] = _.map(results.documents, (document: DataModels.Query) => { - if (!document) { - return undefined; - } - const { id, resourceId, query, queryName } = document; - const parsedQuery: DataModels.Query = { - resourceId: resourceId, - queryName: queryName, - query: query, - id: id, - }; - try { - this.validateQuery(parsedQuery); - return parsedQuery; - } catch (error) { - return undefined; - } - }); - queries = _.reject(queries, (parsedQuery: DataModels.Query) => !parsedQuery); - NotificationConsoleUtils.logConsoleInfo("Successfully fetched saved queries"); - return Promise.resolve(queries); - }, - (error: any) => { - handleError(error, "getSavedQueries", "Failed to fetch saved queries"); - return Promise.reject(error); - } - ) - .finally(() => clearMessage()); + ).fetchAll(); + + let queries: DataModels.Query[] = _.map(results.resources, (document: DataModels.Query) => { + if (!document) { + return undefined; + } + const { id, resourceId, query, queryName } = document; + const parsedQuery: DataModels.Query = { + resourceId: resourceId, + queryName: queryName, + query: query, + id: id, + }; + try { + this.validateQuery(parsedQuery); + return parsedQuery; + } catch (error) { + return undefined; + } + }); + queries = _.reject(queries, (parsedQuery: DataModels.Query) => !parsedQuery); + NotificationConsoleUtils.logConsoleInfo("Successfully fetched saved queries"); + clearMessage(); + return queries; } public async deleteQuery(query: DataModels.Query): Promise { @@ -182,17 +170,14 @@ export class QueriesClient { } public getResourceId(): string { - const databaseAccount = userContext.databaseAccount; - const databaseAccountName = (databaseAccount && databaseAccount.name) || ""; - const subscriptionId = userContext.subscriptionId || ""; - const resourceGroup = userContext.resourceGroup || ""; - + const { databaseAccount, subscriptionId = "", resourceGroup = "" } = userContext; + const databaseAccountName = databaseAccount?.name || ""; return `/subscriptions/${subscriptionId}/resourceGroups/${resourceGroup}/providers/Microsoft.DocumentDb/databaseAccounts/${databaseAccountName}`; } private findQueriesCollection(): ViewModels.Collection { const queriesDatabase: ViewModels.Database = _.find( - this.container.databases(), + useDatabases.getState().databases, (database: ViewModels.Database) => database.id() === SavedQueries.DatabaseName ); if (!queriesDatabase) { @@ -211,7 +196,7 @@ export class QueriesClient { } private fetchQueriesQuery(): string { - if (this.container.isPreferredApiMongoDB()) { + if (userContext.apiType === "Mongo") { return QueriesClient.FetchMongoQuery; } return QueriesClient.FetchQuery; diff --git a/src/Common/ResourceTreeContainer.tsx b/src/Common/ResourceTreeContainer.tsx new file mode 100644 index 000000000..fe04f9e04 --- /dev/null +++ b/src/Common/ResourceTreeContainer.tsx @@ -0,0 +1,66 @@ +import React, { FunctionComponent } from "react"; +import arrowLeftImg from "../../images/imgarrowlefticon.svg"; +import refreshImg from "../../images/refresh-cosmos.svg"; +import { AuthType } from "../AuthType"; +import Explorer from "../Explorer/Explorer"; +import { ResourceTokenTree } from "../Explorer/Tree/ResourceTokenTree"; +import { ResourceTree } from "../Explorer/Tree/ResourceTree"; +import { userContext } from "../UserContext"; + +export interface ResourceTreeContainerProps { + toggleLeftPaneExpanded: () => void; + isLeftPaneExpanded: boolean; + container: Explorer; +} + +export const ResourceTreeContainer: FunctionComponent = ({ + toggleLeftPaneExpanded, + isLeftPaneExpanded, + container, +}: ResourceTreeContainerProps): JSX.Element => { + return ( +
+ {/* Collections Window - - Start */} +
+ {/* Collections Window Title/Command Bar - Start */} +
+
+ {userContext.apiType} API +
+ + Refresh Tree + + + Hide + +
+
+
+ {userContext.authType === AuthType.ResourceToken ? ( + + ) : userContext.features.enableKOResourceTree ? ( +
+ ) : ( + + )} +
+ {/* Collections Window - End */} +
+ ); +}; diff --git a/src/Common/Splitter.ts b/src/Common/Splitter.ts index 5785aa8ec..1db6d3ba5 100644 --- a/src/Common/Splitter.ts +++ b/src/Common/Splitter.ts @@ -1,7 +1,3 @@ -import * as ko from "knockout"; - -import { SplitterMetrics } from "./Constants"; - export enum SplitterDirection { Horizontal = "horizontal", Vertical = "vertical", @@ -28,14 +24,12 @@ export class Splitter { public lastX!: number; public lastWidth!: number; - private isCollapsed: ko.Observable; private bounds: SplitterBounds; private direction: SplitterDirection; constructor(options: SplitterOptions) { this.splitterId = options.splitterId; this.leftSideId = options.leftId; - this.isCollapsed = ko.observable(false); this.bounds = options.bounds; this.direction = options.direction; this.initialize(); @@ -73,7 +67,7 @@ export class Splitter { $(this.leftSide).resizable(splitterOptions); } - private onResizeStart: JQueryUI.ResizableEvent = (e: Event, ui: JQueryUI.ResizableUIParams) => { + private onResizeStart: JQueryUI.ResizableEvent = () => { if (this.direction === SplitterDirection.Vertical) { $(".ui-resizable-helper").height("100%"); } else { @@ -82,26 +76,5 @@ export class Splitter { $("iframe").css("pointer-events", "none"); }; - private onResizeStop: JQueryUI.ResizableEvent = (e: Event, ui: JQueryUI.ResizableUIParams) => { - $("iframe").css("pointer-events", "auto"); - }; - - public collapseLeft() { - this.lastX = $(this.splitter).position().left; - this.lastWidth = $(this.leftSide).width(); - $(this.splitter).css("left", SplitterMetrics.CollapsedPositionLeft); - $(this.leftSide).css("width", ""); - $(this.leftSide).resizable("option", "disabled", true).removeClass("ui-resizable-disabled"); // remove class so splitter is visible - $(this.splitter).removeClass("ui-resizable-e"); - this.isCollapsed(true); - } - - public expandLeft() { - $(this.splitter).addClass("ui-resizable-e"); - $(this.leftSide).css("width", this.lastWidth); - $(this.splitter).css("left", this.lastX); - $(this.splitter).css("left", ""); // this ensures the splitter's position is not fixed and enables movement during resizing - $(this.leftSide).resizable("enable"); - this.isCollapsed(false); - } + private onResizeStop: JQueryUI.ResizableEvent = () => $("iframe").css("pointer-events", "auto"); } diff --git a/src/Common/TableEntity.tsx b/src/Common/TableEntity.tsx new file mode 100644 index 000000000..3a38f275e --- /dev/null +++ b/src/Common/TableEntity.tsx @@ -0,0 +1,140 @@ +import { + Dropdown, + IDropdownOption, + IDropdownStyles, + IImageProps, + Image, + IStackTokens, + Stack, + TextField, + TooltipHost, +} from "@fluentui/react"; +import React, { FunctionComponent } from "react"; +import DeleteIcon from "../../images/delete.svg"; +import EditIcon from "../../images/Edit_entity.svg"; +import { CassandraType, TableType } from "../Explorer/Tables/Constants"; +import { userContext } from "../UserContext"; +import { EntityValue } from "./EntityValue"; + +const dropdownStyles: Partial = { dropdown: { width: 100 } }; + +export interface TableEntityProps { + entityTypeLabel?: string; + entityPropertyLabel?: string; + entityValueLabel?: string; + isDeleteOptionVisible: boolean; + entityProperty: string; + entityPropertyPlaceHolder: string; + selectedKey: string | number; + entityValuePlaceholder: string; + entityValue: string | Date; + isEntityTypeDate: boolean; + options: { key: string; text: string }[]; + isPropertyTypeDisable: boolean; + entityTimeValue: string; + isEntityValueDisable?: boolean; + onDeleteEntity?: () => void; + onEditEntity?: () => void; + onEntityPropertyChange: (event: React.FormEvent, newInput?: string) => void; + onEntityTypeChange: (event: React.FormEvent, selectedParam: IDropdownOption) => void; + onEntityValueChange: (event: React.FormEvent, newInput?: string) => void; + onSelectDate: (date: Date | null | undefined) => void; + onEntityTimeValueChange: (event: React.FormEvent, newInput?: string) => void; +} + +export const TableEntity: FunctionComponent = ({ + entityTypeLabel, + entityPropertyLabel, + isDeleteOptionVisible, + entityProperty, + selectedKey, + entityPropertyPlaceHolder, + entityValueLabel, + entityValuePlaceholder, + entityValue, + options, + isPropertyTypeDisable, + isEntityTypeDate, + entityTimeValue, + isEntityValueDisable, + onEditEntity, + onDeleteEntity, + onEntityPropertyChange, + onEntityTypeChange, + onEntityValueChange, + onSelectDate, + onEntityTimeValueChange, +}: TableEntityProps): JSX.Element => { + const imageProps: IImageProps = { + width: 16, + height: 30, + className: entityPropertyLabel ? "addRemoveIconLabel" : "addRemoveIcon", + }; + + const sectionStackTokens: IStackTokens = { childrenGap: 12 }; + + const getEntityValueType = (): string => { + const { Int, Smallint, Tinyint } = CassandraType; + const { Double, Int32, Int64 } = TableType; + + if ( + selectedKey === Double || + selectedKey === Int32 || + selectedKey === Int64 || + selectedKey === Int || + selectedKey === Smallint || + selectedKey === Tinyint + ) { + return "number"; + } + return "string"; + }; + + return ( + <> + + + + + {!isEntityValueDisable && ( + + editEntity + + )} + {isDeleteOptionVisible && userContext.apiType !== "Cassandra" && ( + + delete entity + + )} + + + ); +}; diff --git a/src/Common/ThemeUtility.ts b/src/Common/ThemeUtility.ts index 1c9fc7671..ae0e6872c 100644 --- a/src/Common/ThemeUtility.ts +++ b/src/Common/ThemeUtility.ts @@ -2,18 +2,16 @@ * Copyright (C) Microsoft Corporation. All rights reserved. *----------------------------------------------------------*/ -export default class ThemeUtility { - public static getMonacoTheme(theme: string): string { - switch (theme) { - case "default": - case "hc-white": - return "vs"; - case "dark": - return "vs-dark"; - case "hc-black": - return "hc-black"; - default: - return "vs"; - } +export function getMonacoTheme(theme: string): string { + switch (theme) { + case "default": + case "hc-white": + return "vs"; + case "dark": + return "vs-dark"; + case "hc-black": + return "hc-black"; + default: + return "vs"; } } diff --git a/src/Common/Tooltip/InfoTooltip.tsx b/src/Common/Tooltip/InfoTooltip.tsx new file mode 100644 index 000000000..480aa9020 --- /dev/null +++ b/src/Common/Tooltip/InfoTooltip.tsx @@ -0,0 +1,16 @@ +import { Icon, TooltipHost } from "@fluentui/react"; +import * as React from "react"; + +export interface TooltipProps { + children: string; +} + +export const InfoTooltip: React.FunctionComponent = ({ children }: TooltipProps) => { + return ( + + + + + + ); +}; diff --git a/src/Common/Upload/Upload.tsx b/src/Common/Upload/Upload.tsx new file mode 100644 index 000000000..3feb4fdfd --- /dev/null +++ b/src/Common/Upload/Upload.tsx @@ -0,0 +1,75 @@ +import { Image, Stack, TextField } from "@fluentui/react"; +import React, { ChangeEvent, FunctionComponent, KeyboardEvent, useRef, useState } from "react"; +import FolderIcon from "../../../images/folder_16x16.svg"; +import * as Constants from "../Constants"; +import { InfoTooltip } from "../Tooltip/InfoTooltip"; + +interface UploadProps { + label: string; + accept?: string; + tooltip?: string; + multiple?: boolean; + tabIndex?: number; + onUpload: (event: ChangeEvent) => void; +} + +export const Upload: FunctionComponent = ({ + label, + accept, + tooltip, + multiple, + tabIndex, + ...props +}: UploadProps) => { + const [selectedFilesTitle, setSelectedFilesTitle] = useState([]); + + const fileRef = useRef(); + + const onImportLinkKeyPress = (event: KeyboardEvent): void => { + if (event.keyCode === Constants.KeyCodes.Enter || event.keyCode === Constants.KeyCodes.Space) { + onImportLinkClick(); + } + }; + + const onImportLinkClick = (): void => { + fileRef?.current?.click(); + }; + + const onUpload = (event: ChangeEvent): void => { + const { files } = event.target; + + const newFileList = []; + for (let i = 0; i < files.length; i++) { + newFileList.push(files.item(i).name); + } + if (newFileList) { + setSelectedFilesTitle(newFileList); + props.onUpload(event); + } + }; + const title = label + " to upload"; + return ( +
+ {label} + {tooltip && {tooltip}} + + + + + {title} + + +
+ ); +}; diff --git a/src/Common/UrlUtility.ts b/src/Common/UrlUtility.ts index 4d6727956..3d990c7a7 100644 --- a/src/Common/UrlUtility.ts +++ b/src/Common/UrlUtility.ts @@ -1,55 +1,61 @@ -export default class UrlUtility { - public static parseDocumentsPath(resourcePath: string): any { - if (typeof resourcePath !== "string") { - return {}; - } - - if (resourcePath.length === 0) { - return {}; - } - - if (resourcePath[resourcePath.length - 1] !== "/") { - resourcePath = resourcePath + "/"; - } - - if (resourcePath[0] !== "/") { - resourcePath = "/" + resourcePath; - } - - var id: string; - var type: string; - var pathParts = resourcePath.split("/"); - - if (pathParts.length % 2 === 0) { - id = pathParts[pathParts.length - 2]; - type = pathParts[pathParts.length - 3]; - } else { - id = pathParts[pathParts.length - 3]; - type = pathParts[pathParts.length - 2]; - } - - var result = { - type: type, - objectBody: { - id: id, - self: resourcePath, - }, - }; - - return result; - } - - public static createUri(baseUri: string, relativeUri: string): string { - if (!baseUri) { - throw new Error("baseUri is null or empty"); - } - - var slashAtEndOfUriRegex = /\/$/, - slashAtStartOfUriRegEx = /^\//; - - var normalizedBaseUri = baseUri.replace(slashAtEndOfUriRegex, "") + "/", - normalizedRelativeUri = (relativeUri && relativeUri.replace(slashAtStartOfUriRegEx, "")) || ""; - - return normalizedBaseUri + normalizedRelativeUri; - } +interface Result { + type?: string; + objectBody?: { + id: string; + self: string; + }; +} + +export function parseDocumentsPath(resourcePath: string): Result { + if (typeof resourcePath !== "string") { + return {}; + } + + if (resourcePath.length === 0) { + return {}; + } + + if (resourcePath[resourcePath.length - 1] !== "/") { + resourcePath = resourcePath + "/"; + } + + if (resourcePath[0] !== "/") { + resourcePath = "/" + resourcePath; + } + + let id: string; + let type: string; + const pathParts = resourcePath.split("/"); + + if (pathParts.length % 2 === 0) { + id = pathParts[pathParts.length - 2]; + type = pathParts[pathParts.length - 3]; + } else { + id = pathParts[pathParts.length - 3]; + type = pathParts[pathParts.length - 2]; + } + + const result = { + type: type, + objectBody: { + id: id, + self: resourcePath, + }, + }; + + return result; +} + +export function createUri(baseUri: string, relativeUri: string): string { + if (!baseUri) { + throw new Error("baseUri is null or empty"); + } + + const slashAtEndOfUriRegex = /\/$/, + slashAtStartOfUriRegEx = /^\//; + + const normalizedBaseUri = baseUri.replace(slashAtEndOfUriRegex, "") + "/", + normalizedRelativeUri = (relativeUri && relativeUri.replace(slashAtStartOfUriRegEx, "")) || ""; + + return normalizedBaseUri + normalizedRelativeUri; } diff --git a/src/Common/__snapshots__/CosmosClient.test.ts.snap b/src/Common/__snapshots__/CosmosClient.test.ts.snap index a7af26f41..7ba1b22ce 100644 --- a/src/Common/__snapshots__/CosmosClient.test.ts.snap +++ b/src/Common/__snapshots__/CosmosClient.test.ts.snap @@ -2,7 +2,7 @@ exports[`requestPlugin Emulator builds a url for emulator proxy via webpack 1`] = ` Object { - "endpoint": "/proxy", + "endpoint": "http://localhost/proxy", "headers": Object { "x-ms-proxy-target": "http://localhost", }, @@ -12,7 +12,7 @@ Object { exports[`requestPlugin Hosted builds a proxy URL in development 1`] = ` Object { - "endpoint": "/proxy", + "endpoint": "http://localhost/proxy", "headers": Object { "x-ms-proxy-target": "baz", }, diff --git a/src/Common/dataAccess/bulkCreateDocument.ts b/src/Common/dataAccess/bulkCreateDocument.ts new file mode 100644 index 000000000..ec7ae7b8f --- /dev/null +++ b/src/Common/dataAccess/bulkCreateDocument.ts @@ -0,0 +1,39 @@ +import { JSONObject, OperationResponse } from "@azure/cosmos"; +import { CollectionBase } from "../../Contracts/ViewModels"; +import { logConsoleInfo, logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; +import { client } from "../CosmosClient"; +import { handleError } from "../ErrorHandlingUtils"; + +export const bulkCreateDocument = async ( + collection: CollectionBase, + documents: JSONObject[] +): Promise => { + const clearMessage = logConsoleProgress( + `Executing ${documents.length} bulk operations for container ${collection.id()}` + ); + + try { + const response = await client() + .database(collection.databaseId) + .container(collection.id()) + .items.bulk( + documents.map((doc) => ({ operationType: "Create", resourceBody: doc })), + { continueOnError: true } + ); + + const successCount = response.filter((r) => r.statusCode === 201).length; + const throttledCount = response.filter((r) => r.statusCode === 429).length; + + logConsoleInfo( + `${ + documents.length + } operations completed for container ${collection.id()}. ${successCount} operations succeeded. ${throttledCount} operations throttled` + ); + return response; + } catch (error) { + handleError(error, "BulkCreateDocument", `Error bulk creating items for container ${collection.id()}`); + throw error; + } finally { + clearMessage(); + } +}; diff --git a/src/Common/dataAccess/createCollection.test.ts b/src/Common/dataAccess/createCollection.test.ts index fc5b9a911..2f6bf63e4 100644 --- a/src/Common/dataAccess/createCollection.test.ts +++ b/src/Common/dataAccess/createCollection.test.ts @@ -1,12 +1,14 @@ jest.mock("../../Utils/arm/request"); jest.mock("../CosmosClient"); +import ko from "knockout"; import { AuthType } from "../../AuthType"; import { CreateCollectionParams, DatabaseAccount } from "../../Contracts/DataModels"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; +import { Database } from "../../Contracts/ViewModels"; +import { useDatabases } from "../../Explorer/useDatabases"; +import { updateUserContext } from "../../UserContext"; import { armRequest } from "../../Utils/arm/request"; import { client } from "../CosmosClient"; -import { createCollection, constructRpOptions } from "./createCollection"; -import { updateUserContext } from "../../UserContext"; +import { constructRpOptions, createCollection } from "./createCollection"; describe("createCollection", () => { const createCollectionParams: CreateCollectionParams = { @@ -22,7 +24,16 @@ describe("createCollection", () => { databaseAccount: { name: "test", } as DatabaseAccount, - defaultExperience: DefaultAccountExperienceType.DocumentDB, + apiType: "SQL", + }); + useDatabases.setState({ + databases: [ + { + id: ko.observable("testDatabase"), + loadCollections: () => undefined, + collections: ko.observableArray([]), + } as Database, + ], }); }); diff --git a/src/Common/dataAccess/createCollection.ts b/src/Common/dataAccess/createCollection.ts index 00cfeb4b5..791b29fcc 100644 --- a/src/Common/dataAccess/createCollection.ts +++ b/src/Common/dataAccess/createCollection.ts @@ -1,33 +1,25 @@ -import * as DataModels from "../../Contracts/DataModels"; -import { AuthType } from "../../AuthType"; import { ContainerResponse, DatabaseResponse } from "@azure/cosmos"; +import { RequestOptions } from "@azure/cosmos/dist-esm"; import { ContainerRequest } from "@azure/cosmos/dist-esm/client/Container/ContainerRequest"; import { DatabaseRequest } from "@azure/cosmos/dist-esm/client/Database/DatabaseRequest"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; -import { RequestOptions } from "@azure/cosmos/dist-esm"; -import * as ARMTypes from "../../Utils/arm/generatedClients/2020-04-01/types"; -import { client } from "../CosmosClient"; -import { createMongoCollectionWithProxy } from "../MongoProxyClient"; -import { createUpdateSqlContainer, getSqlContainer } from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { - createUpdateCassandraTable, - getCassandraTable, -} from "../../Utils/arm/generatedClients/2020-04-01/cassandraResources"; -import { - createUpdateMongoDBCollection, - getMongoDBCollection, -} from "../../Utils/arm/generatedClients/2020-04-01/mongoDBResources"; -import { - createUpdateGremlinGraph, - getGremlinGraph, -} from "../../Utils/arm/generatedClients/2020-04-01/gremlinResources"; -import { createUpdateTable, getTable } from "../../Utils/arm/generatedClients/2020-04-01/tableResources"; -import { logConsoleProgress, logConsoleInfo } from "../../Utils/NotificationConsoleUtils"; -import { userContext } from "../../UserContext"; -import { createDatabase } from "./createDatabase"; -import * as TelemetryProcessor from "../../Shared/Telemetry/TelemetryProcessor"; +import { AuthType } from "../../AuthType"; +import * as DataModels from "../../Contracts/DataModels"; +import { useDatabases } from "../../Explorer/useDatabases"; import { Action, ActionModifiers } from "../../Shared/Telemetry/TelemetryConstants"; +import * as TelemetryProcessor from "../../Shared/Telemetry/TelemetryProcessor"; +import { userContext } from "../../UserContext"; +import { getCollectionName } from "../../Utils/APITypeUtils"; +import { createUpdateCassandraTable } from "../../Utils/arm/generatedClients/cosmos/cassandraResources"; +import { createUpdateGremlinGraph } from "../../Utils/arm/generatedClients/cosmos/gremlinResources"; +import { createUpdateMongoDBCollection } from "../../Utils/arm/generatedClients/cosmos/mongoDBResources"; +import { createUpdateSqlContainer } from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { createUpdateTable } from "../../Utils/arm/generatedClients/cosmos/tableResources"; +import * as ARMTypes from "../../Utils/arm/generatedClients/cosmos/types"; +import { logConsoleInfo, logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; +import { client } from "../CosmosClient"; import { handleError } from "../ErrorHandlingUtils"; +import { createMongoCollectionWithProxy } from "../MongoProxyClient"; +import { createDatabase } from "./createDatabase"; export const createCollection = async (params: DataModels.CreateCollectionParams): Promise => { const clearMessage = logConsoleProgress( @@ -46,7 +38,7 @@ export const createCollection = async (params: DataModels.CreateCollectionParams await createDatabase(createDatabaseParams); } collection = await createCollectionWithARM(params); - } else if (userContext.defaultExperience === DefaultAccountExperienceType.MongoDB) { + } else if (userContext.apiType === "Mongo") { collection = await createMongoCollectionWithProxy(params); } else { collection = await createCollectionWithSDK(params); @@ -63,41 +55,34 @@ export const createCollection = async (params: DataModels.CreateCollectionParams }; const createCollectionWithARM = async (params: DataModels.CreateCollectionParams): Promise => { - const defaultExperience = userContext.defaultExperience; - switch (defaultExperience) { - case DefaultAccountExperienceType.DocumentDB: + if (!params.createNewDatabase) { + const isValid = await useDatabases.getState().validateCollectionId(params.databaseId, params.collectionId); + if (!isValid) { + const collectionName = getCollectionName().toLocaleLowerCase(); + throw new Error( + `Create ${collectionName} failed: ${collectionName} with id ${params.collectionId} already exists` + ); + } + } + + const { apiType } = userContext; + switch (apiType) { + case "SQL": return createSqlContainer(params); - case DefaultAccountExperienceType.MongoDB: + case "Mongo": return createMongoCollection(params); - case DefaultAccountExperienceType.Cassandra: + case "Cassandra": return createCassandraTable(params); - case DefaultAccountExperienceType.Graph: + case "Gremlin": return createGraph(params); - case DefaultAccountExperienceType.Table: + case "Tables": return createTable(params); default: - throw new Error(`Unsupported default experience type: ${defaultExperience}`); + throw new Error(`Unsupported default experience type: ${apiType}`); } }; const createSqlContainer = async (params: DataModels.CreateCollectionParams): Promise => { - try { - const getResponse = await getSqlContainer( - userContext.subscriptionId, - userContext.resourceGroup, - userContext.databaseAccount.name, - params.databaseId, - params.collectionId - ); - if (getResponse?.properties?.resource) { - throw new Error(`Create container failed: container with id ${params.collectionId} already exists`); - } - } catch (error) { - if (error.code !== "NotFound") { - throw error; - } - } - const options: ARMTypes.CreateUpdateOptions = constructRpOptions(params); const resource: ARMTypes.SqlContainerResource = { id: params.collectionId, @@ -135,23 +120,6 @@ const createSqlContainer = async (params: DataModels.CreateCollectionParams): Pr const createMongoCollection = async (params: DataModels.CreateCollectionParams): Promise => { const mongoWildcardIndexOnAllFields: ARMTypes.MongoIndex[] = [{ key: { keys: ["$**"] } }, { key: { keys: ["_id"] } }]; - try { - const getResponse = await getMongoDBCollection( - userContext.subscriptionId, - userContext.resourceGroup, - userContext.databaseAccount.name, - params.databaseId, - params.collectionId - ); - if (getResponse?.properties?.resource) { - throw new Error(`Create collection failed: collection with id ${params.collectionId} already exists`); - } - } catch (error) { - if (error.code !== "NotFound") { - throw error; - } - } - const options: ARMTypes.CreateUpdateOptions = constructRpOptions(params); const resource: ARMTypes.MongoDBCollectionResource = { id: params.collectionId, @@ -193,23 +161,6 @@ const createMongoCollection = async (params: DataModels.CreateCollectionParams): }; const createCassandraTable = async (params: DataModels.CreateCollectionParams): Promise => { - try { - const getResponse = await getCassandraTable( - userContext.subscriptionId, - userContext.resourceGroup, - userContext.databaseAccount.name, - params.databaseId, - params.collectionId - ); - if (getResponse?.properties?.resource) { - throw new Error(`Create table failed: table with id ${params.collectionId} already exists`); - } - } catch (error) { - if (error.code !== "NotFound") { - throw error; - } - } - const options: ARMTypes.CreateUpdateOptions = constructRpOptions(params); const resource: ARMTypes.CassandraTableResource = { id: params.collectionId, @@ -237,23 +188,6 @@ const createCassandraTable = async (params: DataModels.CreateCollectionParams): }; const createGraph = async (params: DataModels.CreateCollectionParams): Promise => { - try { - const getResponse = await getGremlinGraph( - userContext.subscriptionId, - userContext.resourceGroup, - userContext.databaseAccount.name, - params.databaseId, - params.collectionId - ); - if (getResponse?.properties?.resource) { - throw new Error(`Create graph failed: graph with id ${params.collectionId} already exists`); - } - } catch (error) { - if (error.code !== "NotFound") { - throw error; - } - } - const options: ARMTypes.CreateUpdateOptions = constructRpOptions(params); const resource: ARMTypes.GremlinGraphResource = { id: params.collectionId, @@ -288,22 +222,6 @@ const createGraph = async (params: DataModels.CreateCollectionParams): Promise => { - try { - const getResponse = await getTable( - userContext.subscriptionId, - userContext.resourceGroup, - userContext.databaseAccount.name, - params.collectionId - ); - if (getResponse?.properties?.resource) { - throw new Error(`Create table failed: table with id ${params.collectionId} already exists`); - } - } catch (error) { - if (error.code !== "NotFound") { - throw error; - } - } - const options: ARMTypes.CreateUpdateOptions = constructRpOptions(params); const resource: ARMTypes.TableResource = { id: params.collectionId, diff --git a/src/Common/dataAccess/createDatabase.ts b/src/Common/dataAccess/createDatabase.ts index 11dadae67..2467b7975 100644 --- a/src/Common/dataAccess/createDatabase.ts +++ b/src/Common/dataAccess/createDatabase.ts @@ -1,37 +1,29 @@ -import * as DataModels from "../../Contracts/DataModels"; -import { AuthType } from "../../AuthType"; import { DatabaseResponse } from "@azure/cosmos"; import { DatabaseRequest } from "@azure/cosmos/dist-esm/client/Database/DatabaseRequest"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; +import { AuthType } from "../../AuthType"; +import * as DataModels from "../../Contracts/DataModels"; +import { useDatabases } from "../../Explorer/useDatabases"; +import { userContext } from "../../UserContext"; +import { getDatabaseName } from "../../Utils/APITypeUtils"; +import { createUpdateCassandraKeyspace } from "../../Utils/arm/generatedClients/cosmos/cassandraResources"; +import { createUpdateGremlinDatabase } from "../../Utils/arm/generatedClients/cosmos/gremlinResources"; +import { createUpdateMongoDBDatabase } from "../../Utils/arm/generatedClients/cosmos/mongoDBResources"; +import { createUpdateSqlDatabase } from "../../Utils/arm/generatedClients/cosmos/sqlResources"; import { CassandraKeyspaceCreateUpdateParameters, + CreateUpdateOptions, GremlinDatabaseCreateUpdateParameters, MongoDBDatabaseCreateUpdateParameters, SqlDatabaseCreateUpdateParameters, - CreateUpdateOptions, -} from "../../Utils/arm/generatedClients/2020-04-01/types"; +} from "../../Utils/arm/generatedClients/cosmos/types"; +import { logConsoleInfo, logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; import { client } from "../CosmosClient"; -import { createUpdateSqlDatabase, getSqlDatabase } from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { - createUpdateCassandraKeyspace, - getCassandraKeyspace, -} from "../../Utils/arm/generatedClients/2020-04-01/cassandraResources"; -import { - createUpdateMongoDBDatabase, - getMongoDBDatabase, -} from "../../Utils/arm/generatedClients/2020-04-01/mongoDBResources"; -import { - createUpdateGremlinDatabase, - getGremlinDatabase, -} from "../../Utils/arm/generatedClients/2020-04-01/gremlinResources"; import { handleError } from "../ErrorHandlingUtils"; -import { logConsoleProgress, logConsoleInfo } from "../../Utils/NotificationConsoleUtils"; -import { userContext } from "../../UserContext"; export async function createDatabase(params: DataModels.CreateDatabaseParams): Promise { const clearMessage = logConsoleProgress(`Creating a new database ${params.databaseId}`); try { - if (userContext.defaultExperience === DefaultAccountExperienceType.Table) { + if (userContext.apiType === "Tables") { throw new Error("Creating database resources is not allowed for tables accounts"); } const database: DataModels.Database = await (userContext.authType === AuthType.AAD && !userContext.useSDKOperations @@ -49,38 +41,28 @@ export async function createDatabase(params: DataModels.CreateDatabaseParams): P } async function createDatabaseWithARM(params: DataModels.CreateDatabaseParams): Promise { - const defaultExperience = userContext.defaultExperience; - switch (defaultExperience) { - case DefaultAccountExperienceType.DocumentDB: + if (!useDatabases.getState().validateDatabaseId(params.databaseId)) { + const databaseName = getDatabaseName().toLocaleLowerCase(); + throw new Error(`Create ${databaseName} failed: ${databaseName} with id ${params.databaseId} already exists`); + } + + const { apiType } = userContext; + + switch (apiType) { + case "SQL": return createSqlDatabase(params); - case DefaultAccountExperienceType.MongoDB: + case "Mongo": return createMongoDatabase(params); - case DefaultAccountExperienceType.Cassandra: + case "Cassandra": return createCassandraKeyspace(params); - case DefaultAccountExperienceType.Graph: + case "Gremlin": return createGremlineDatabase(params); default: - throw new Error(`Unsupported default experience type: ${defaultExperience}`); + throw new Error(`Unsupported default experience type: ${apiType}`); } } async function createSqlDatabase(params: DataModels.CreateDatabaseParams): Promise { - try { - const getResponse = await getSqlDatabase( - userContext.subscriptionId, - userContext.resourceGroup, - userContext.databaseAccount.name, - params.databaseId - ); - if (getResponse?.properties?.resource) { - throw new Error(`Create database failed: database with id ${params.databaseId} already exists`); - } - } catch (error) { - if (error.code !== "NotFound") { - throw error; - } - } - const options: CreateUpdateOptions = constructRpOptions(params); const rpPayload: SqlDatabaseCreateUpdateParameters = { properties: { @@ -101,22 +83,6 @@ async function createSqlDatabase(params: DataModels.CreateDatabaseParams): Promi } async function createMongoDatabase(params: DataModels.CreateDatabaseParams): Promise { - try { - const getResponse = await getMongoDBDatabase( - userContext.subscriptionId, - userContext.resourceGroup, - userContext.databaseAccount.name, - params.databaseId - ); - if (getResponse?.properties?.resource) { - throw new Error(`Create database failed: database with id ${params.databaseId} already exists`); - } - } catch (error) { - if (error.code !== "NotFound") { - throw error; - } - } - const options: CreateUpdateOptions = constructRpOptions(params); const rpPayload: MongoDBDatabaseCreateUpdateParameters = { properties: { @@ -137,22 +103,6 @@ async function createMongoDatabase(params: DataModels.CreateDatabaseParams): Pro } async function createCassandraKeyspace(params: DataModels.CreateDatabaseParams): Promise { - try { - const getResponse = await getCassandraKeyspace( - userContext.subscriptionId, - userContext.resourceGroup, - userContext.databaseAccount.name, - params.databaseId - ); - if (getResponse?.properties?.resource) { - throw new Error(`Create database failed: database with id ${params.databaseId} already exists`); - } - } catch (error) { - if (error.code !== "NotFound") { - throw error; - } - } - const options: CreateUpdateOptions = constructRpOptions(params); const rpPayload: CassandraKeyspaceCreateUpdateParameters = { properties: { @@ -173,22 +123,6 @@ async function createCassandraKeyspace(params: DataModels.CreateDatabaseParams): } async function createGremlineDatabase(params: DataModels.CreateDatabaseParams): Promise { - try { - const getResponse = await getGremlinDatabase( - userContext.subscriptionId, - userContext.resourceGroup, - userContext.databaseAccount.name, - params.databaseId - ); - if (getResponse?.properties?.resource) { - throw new Error(`Create database failed: database with id ${params.databaseId} already exists`); - } - } catch (error) { - if (error.code !== "NotFound") { - throw error; - } - } - const options: CreateUpdateOptions = constructRpOptions(params); const rpPayload: GremlinDatabaseCreateUpdateParameters = { properties: { diff --git a/src/Common/dataAccess/createDocument.ts b/src/Common/dataAccess/createDocument.ts index b64f70ff9..94dde951d 100644 --- a/src/Common/dataAccess/createDocument.ts +++ b/src/Common/dataAccess/createDocument.ts @@ -1,8 +1,8 @@ import { CollectionBase } from "../../Contracts/ViewModels"; +import { logConsoleInfo, logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; import { client } from "../CosmosClient"; import { getEntityName } from "../DocumentUtility"; import { handleError } from "../ErrorHandlingUtils"; -import { logConsoleInfo, logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; export const createDocument = async (collection: CollectionBase, newDocument: unknown): Promise => { const entityName = getEntityName(); diff --git a/src/Common/dataAccess/createStoredProcedure.ts b/src/Common/dataAccess/createStoredProcedure.ts index e3a448dec..579835277 100644 --- a/src/Common/dataAccess/createStoredProcedure.ts +++ b/src/Common/dataAccess/createStoredProcedure.ts @@ -1,18 +1,17 @@ -import { AuthType } from "../../AuthType"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; import { Resource, StoredProcedureDefinition } from "@azure/cosmos"; -import { - SqlStoredProcedureCreateUpdateParameters, - SqlStoredProcedureResource, -} from "../../Utils/arm/generatedClients/2020-04-01/types"; -import { client } from "../CosmosClient"; +import { AuthType } from "../../AuthType"; +import { userContext } from "../../UserContext"; import { createUpdateSqlStoredProcedure, getSqlStoredProcedure, -} from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { handleError } from "../ErrorHandlingUtils"; +} from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { + SqlStoredProcedureCreateUpdateParameters, + SqlStoredProcedureResource, +} from "../../Utils/arm/generatedClients/cosmos/types"; import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; -import { userContext } from "../../UserContext"; +import { client } from "../CosmosClient"; +import { handleError } from "../ErrorHandlingUtils"; export async function createStoredProcedure( databaseId: string, @@ -21,11 +20,7 @@ export async function createStoredProcedure( ): Promise { const clearMessage = logConsoleProgress(`Creating stored procedure ${storedProcedure.id}`); try { - if ( - userContext.authType === AuthType.AAD && - !userContext.useSDKOperations && - userContext.defaultExperience === DefaultAccountExperienceType.DocumentDB - ) { + if (userContext.authType === AuthType.AAD && !userContext.useSDKOperations && userContext.apiType === "SQL") { try { const getResponse = await getSqlStoredProcedure( userContext.subscriptionId, diff --git a/src/Common/dataAccess/createTrigger.ts b/src/Common/dataAccess/createTrigger.ts index 8a750402f..ad825820f 100644 --- a/src/Common/dataAccess/createTrigger.ts +++ b/src/Common/dataAccess/createTrigger.ts @@ -1,28 +1,20 @@ +import { TriggerDefinition } from "@azure/cosmos"; import { AuthType } from "../../AuthType"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; -import { Resource, TriggerDefinition } from "@azure/cosmos"; -import { - SqlTriggerCreateUpdateParameters, - SqlTriggerResource, -} from "../../Utils/arm/generatedClients/2020-04-01/types"; -import { client } from "../CosmosClient"; -import { createUpdateSqlTrigger, getSqlTrigger } from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { handleError } from "../ErrorHandlingUtils"; -import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; import { userContext } from "../../UserContext"; +import { createUpdateSqlTrigger, getSqlTrigger } from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { SqlTriggerCreateUpdateParameters, SqlTriggerResource } from "../../Utils/arm/generatedClients/cosmos/types"; +import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; +import { client } from "../CosmosClient"; +import { handleError } from "../ErrorHandlingUtils"; export async function createTrigger( databaseId: string, collectionId: string, - trigger: TriggerDefinition -): Promise { + trigger: SqlTriggerResource +): Promise { const clearMessage = logConsoleProgress(`Creating trigger ${trigger.id}`); try { - if ( - userContext.authType === AuthType.AAD && - !userContext.useSDKOperations && - userContext.defaultExperience === DefaultAccountExperienceType.DocumentDB - ) { + if (userContext.authType === AuthType.AAD && !userContext.useSDKOperations && userContext.apiType === "SQL") { try { const getResponse = await getSqlTrigger( userContext.subscriptionId, @@ -43,7 +35,7 @@ export async function createTrigger( const createTriggerParams: SqlTriggerCreateUpdateParameters = { properties: { - resource: trigger as SqlTriggerResource, + resource: trigger, options: {}, }, }; @@ -56,10 +48,13 @@ export async function createTrigger( trigger.id, createTriggerParams ); - return rpResponse && (rpResponse.properties?.resource as TriggerDefinition & Resource); + return rpResponse && rpResponse.properties?.resource; } - const response = await client().database(databaseId).container(collectionId).scripts.triggers.create(trigger); + const response = await client() + .database(databaseId) + .container(collectionId) + .scripts.triggers.create((trigger as unknown) as TriggerDefinition); // TODO: TypeScript does not like the SQL SDK trigger type return response.resource; } catch (error) { handleError(error, "CreateTrigger", `Error while creating trigger ${trigger.id}`); diff --git a/src/Common/dataAccess/createUserDefinedFunction.ts b/src/Common/dataAccess/createUserDefinedFunction.ts index c90b4b6f0..3b7dd4a12 100644 --- a/src/Common/dataAccess/createUserDefinedFunction.ts +++ b/src/Common/dataAccess/createUserDefinedFunction.ts @@ -1,18 +1,17 @@ -import { AuthType } from "../../AuthType"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; import { Resource, UserDefinedFunctionDefinition } from "@azure/cosmos"; -import { - SqlUserDefinedFunctionCreateUpdateParameters, - SqlUserDefinedFunctionResource, -} from "../../Utils/arm/generatedClients/2020-04-01/types"; -import { client } from "../CosmosClient"; +import { AuthType } from "../../AuthType"; +import { userContext } from "../../UserContext"; import { createUpdateSqlUserDefinedFunction, getSqlUserDefinedFunction, -} from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { handleError } from "../ErrorHandlingUtils"; +} from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { + SqlUserDefinedFunctionCreateUpdateParameters, + SqlUserDefinedFunctionResource, +} from "../../Utils/arm/generatedClients/cosmos/types"; import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; -import { userContext } from "../../UserContext"; +import { client } from "../CosmosClient"; +import { handleError } from "../ErrorHandlingUtils"; export async function createUserDefinedFunction( databaseId: string, @@ -21,11 +20,7 @@ export async function createUserDefinedFunction( ): Promise { const clearMessage = logConsoleProgress(`Creating user defined function ${userDefinedFunction.id}`); try { - if ( - userContext.authType === AuthType.AAD && - !userContext.useSDKOperations && - userContext.defaultExperience === DefaultAccountExperienceType.DocumentDB - ) { + if (userContext.authType === AuthType.AAD && !userContext.useSDKOperations && userContext.apiType === "SQL") { try { const getResponse = await getSqlUserDefinedFunction( userContext.subscriptionId, diff --git a/src/Common/dataAccess/deleteCollection.test.ts b/src/Common/dataAccess/deleteCollection.test.ts index 17886b6c3..f7ddc723d 100644 --- a/src/Common/dataAccess/deleteCollection.test.ts +++ b/src/Common/dataAccess/deleteCollection.test.ts @@ -1,13 +1,12 @@ jest.mock("../../Utils/arm/request"); jest.mock("../MessageHandler"); jest.mock("../CosmosClient"); -import { deleteCollection } from "./deleteCollection"; -import { armRequest } from "../../Utils/arm/request"; import { AuthType } from "../../AuthType"; -import { client } from "../CosmosClient"; -import { updateUserContext } from "../../UserContext"; import { DatabaseAccount } from "../../Contracts/DataModels"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; +import { updateUserContext } from "../../UserContext"; +import { armRequest } from "../../Utils/arm/request"; +import { client } from "../CosmosClient"; +import { deleteCollection } from "./deleteCollection"; describe("deleteCollection", () => { beforeAll(() => { @@ -15,7 +14,7 @@ describe("deleteCollection", () => { databaseAccount: { name: "test", } as DatabaseAccount, - defaultExperience: DefaultAccountExperienceType.DocumentDB, + apiType: "SQL", }); }); diff --git a/src/Common/dataAccess/deleteCollection.ts b/src/Common/dataAccess/deleteCollection.ts index 7bb08c5d7..63e58b8c8 100644 --- a/src/Common/dataAccess/deleteCollection.ts +++ b/src/Common/dataAccess/deleteCollection.ts @@ -1,14 +1,13 @@ import { AuthType } from "../../AuthType"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; -import { deleteSqlContainer } from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { deleteCassandraTable } from "../../Utils/arm/generatedClients/2020-04-01/cassandraResources"; -import { deleteMongoDBCollection } from "../../Utils/arm/generatedClients/2020-04-01/mongoDBResources"; -import { deleteGremlinGraph } from "../../Utils/arm/generatedClients/2020-04-01/gremlinResources"; -import { deleteTable } from "../../Utils/arm/generatedClients/2020-04-01/tableResources"; -import { handleError } from "../ErrorHandlingUtils"; -import { logConsoleInfo, logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; import { userContext } from "../../UserContext"; +import { deleteCassandraTable } from "../../Utils/arm/generatedClients/cosmos/cassandraResources"; +import { deleteGremlinGraph } from "../../Utils/arm/generatedClients/cosmos/gremlinResources"; +import { deleteMongoDBCollection } from "../../Utils/arm/generatedClients/cosmos/mongoDBResources"; +import { deleteSqlContainer } from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { deleteTable } from "../../Utils/arm/generatedClients/cosmos/tableResources"; +import { logConsoleInfo, logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; import { client } from "../CosmosClient"; +import { handleError } from "../ErrorHandlingUtils"; export async function deleteCollection(databaseId: string, collectionId: string): Promise { const clearMessage = logConsoleProgress(`Deleting container ${collectionId}`); @@ -28,23 +27,21 @@ export async function deleteCollection(databaseId: string, collectionId: string) } function deleteCollectionWithARM(databaseId: string, collectionId: string): Promise { - const subscriptionId = userContext.subscriptionId; - const resourceGroup = userContext.resourceGroup; - const accountName = userContext.databaseAccount.name; - const defaultExperience = userContext.defaultExperience; + const { subscriptionId, resourceGroup, apiType, databaseAccount } = userContext; + const accountName = databaseAccount.name; - switch (defaultExperience) { - case DefaultAccountExperienceType.DocumentDB: + switch (apiType) { + case "SQL": return deleteSqlContainer(subscriptionId, resourceGroup, accountName, databaseId, collectionId); - case DefaultAccountExperienceType.MongoDB: + case "Mongo": return deleteMongoDBCollection(subscriptionId, resourceGroup, accountName, databaseId, collectionId); - case DefaultAccountExperienceType.Cassandra: + case "Cassandra": return deleteCassandraTable(subscriptionId, resourceGroup, accountName, databaseId, collectionId); - case DefaultAccountExperienceType.Graph: + case "Gremlin": return deleteGremlinGraph(subscriptionId, resourceGroup, accountName, databaseId, collectionId); - case DefaultAccountExperienceType.Table: + case "Tables": return deleteTable(subscriptionId, resourceGroup, accountName, collectionId); default: - throw new Error(`Unsupported default experience type: ${defaultExperience}`); + throw new Error(`Unsupported default experience type: ${apiType}`); } } diff --git a/src/Common/dataAccess/deleteDatabase.test.ts b/src/Common/dataAccess/deleteDatabase.test.ts index dc78998bd..05d1ce5f3 100644 --- a/src/Common/dataAccess/deleteDatabase.test.ts +++ b/src/Common/dataAccess/deleteDatabase.test.ts @@ -1,13 +1,12 @@ jest.mock("../../Utils/arm/request"); jest.mock("../MessageHandler"); jest.mock("../CosmosClient"); -import { deleteDatabase } from "./deleteDatabase"; -import { armRequest } from "../../Utils/arm/request"; import { AuthType } from "../../AuthType"; -import { client } from "../CosmosClient"; -import { updateUserContext } from "../../UserContext"; import { DatabaseAccount } from "../../Contracts/DataModels"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; +import { updateUserContext } from "../../UserContext"; +import { armRequest } from "../../Utils/arm/request"; +import { client } from "../CosmosClient"; +import { deleteDatabase } from "./deleteDatabase"; describe("deleteDatabase", () => { beforeAll(() => { @@ -15,7 +14,7 @@ describe("deleteDatabase", () => { databaseAccount: { name: "test", } as DatabaseAccount, - defaultExperience: DefaultAccountExperienceType.DocumentDB, + apiType: "SQL", }); }); diff --git a/src/Common/dataAccess/deleteDatabase.ts b/src/Common/dataAccess/deleteDatabase.ts index 20a1119f3..c6c744e35 100644 --- a/src/Common/dataAccess/deleteDatabase.ts +++ b/src/Common/dataAccess/deleteDatabase.ts @@ -1,19 +1,18 @@ import { AuthType } from "../../AuthType"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; -import { deleteSqlDatabase } from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { deleteCassandraKeyspace } from "../../Utils/arm/generatedClients/2020-04-01/cassandraResources"; -import { deleteMongoDBDatabase } from "../../Utils/arm/generatedClients/2020-04-01/mongoDBResources"; -import { deleteGremlinDatabase } from "../../Utils/arm/generatedClients/2020-04-01/gremlinResources"; -import { handleError } from "../ErrorHandlingUtils"; -import { logConsoleInfo, logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; import { userContext } from "../../UserContext"; +import { deleteCassandraKeyspace } from "../../Utils/arm/generatedClients/cosmos/cassandraResources"; +import { deleteGremlinDatabase } from "../../Utils/arm/generatedClients/cosmos/gremlinResources"; +import { deleteMongoDBDatabase } from "../../Utils/arm/generatedClients/cosmos/mongoDBResources"; +import { deleteSqlDatabase } from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { logConsoleInfo, logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; import { client } from "../CosmosClient"; +import { handleError } from "../ErrorHandlingUtils"; export async function deleteDatabase(databaseId: string): Promise { const clearMessage = logConsoleProgress(`Deleting database ${databaseId}`); try { - if (userContext.defaultExperience === DefaultAccountExperienceType.Table) { + if (userContext.apiType === "Tables") { throw new Error("Deleting database resources is not allowed for tables accounts"); } if (userContext.authType === AuthType.AAD && !userContext.useSDKOperations) { @@ -31,21 +30,19 @@ export async function deleteDatabase(databaseId: string): Promise { } function deleteDatabaseWithARM(databaseId: string): Promise { - const subscriptionId = userContext.subscriptionId; - const resourceGroup = userContext.resourceGroup; - const accountName = userContext.databaseAccount.name; - const defaultExperience = userContext.defaultExperience; + const { subscriptionId, resourceGroup, apiType, databaseAccount } = userContext; + const accountName = databaseAccount.name; - switch (defaultExperience) { - case DefaultAccountExperienceType.DocumentDB: + switch (apiType) { + case "SQL": return deleteSqlDatabase(subscriptionId, resourceGroup, accountName, databaseId); - case DefaultAccountExperienceType.MongoDB: + case "Mongo": return deleteMongoDBDatabase(subscriptionId, resourceGroup, accountName, databaseId); - case DefaultAccountExperienceType.Cassandra: + case "Cassandra": return deleteCassandraKeyspace(subscriptionId, resourceGroup, accountName, databaseId); - case DefaultAccountExperienceType.Graph: + case "Gremlin": return deleteGremlinDatabase(subscriptionId, resourceGroup, accountName, databaseId); default: - throw new Error(`Unsupported default experience type: ${defaultExperience}`); + throw new Error(`Unsupported default experience type: ${apiType}`); } } diff --git a/src/Common/dataAccess/deleteStoredProcedure.ts b/src/Common/dataAccess/deleteStoredProcedure.ts index acc6dfc4a..daaf8315a 100644 --- a/src/Common/dataAccess/deleteStoredProcedure.ts +++ b/src/Common/dataAccess/deleteStoredProcedure.ts @@ -1,10 +1,9 @@ import { AuthType } from "../../AuthType"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; -import { client } from "../CosmosClient"; -import { deleteSqlStoredProcedure } from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { handleError } from "../ErrorHandlingUtils"; -import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; import { userContext } from "../../UserContext"; +import { deleteSqlStoredProcedure } from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; +import { client } from "../CosmosClient"; +import { handleError } from "../ErrorHandlingUtils"; export async function deleteStoredProcedure( databaseId: string, @@ -13,11 +12,7 @@ export async function deleteStoredProcedure( ): Promise { const clearMessage = logConsoleProgress(`Deleting stored procedure ${storedProcedureId}`); try { - if ( - userContext.authType === AuthType.AAD && - !userContext.useSDKOperations && - userContext.defaultExperience === DefaultAccountExperienceType.DocumentDB - ) { + if (userContext.authType === AuthType.AAD && !userContext.useSDKOperations && userContext.apiType === "SQL") { await deleteSqlStoredProcedure( userContext.subscriptionId, userContext.resourceGroup, diff --git a/src/Common/dataAccess/deleteTrigger.ts b/src/Common/dataAccess/deleteTrigger.ts index f36d44e23..b4a7aa7ad 100644 --- a/src/Common/dataAccess/deleteTrigger.ts +++ b/src/Common/dataAccess/deleteTrigger.ts @@ -1,19 +1,14 @@ import { AuthType } from "../../AuthType"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; -import { client } from "../CosmosClient"; -import { deleteSqlTrigger } from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { handleError } from "../ErrorHandlingUtils"; -import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; import { userContext } from "../../UserContext"; +import { deleteSqlTrigger } from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; +import { client } from "../CosmosClient"; +import { handleError } from "../ErrorHandlingUtils"; export async function deleteTrigger(databaseId: string, collectionId: string, triggerId: string): Promise { const clearMessage = logConsoleProgress(`Deleting trigger ${triggerId}`); try { - if ( - userContext.authType === AuthType.AAD && - !userContext.useSDKOperations && - userContext.defaultExperience === DefaultAccountExperienceType.DocumentDB - ) { + if (userContext.authType === AuthType.AAD && !userContext.useSDKOperations && userContext.apiType === "SQL") { await deleteSqlTrigger( userContext.subscriptionId, userContext.resourceGroup, diff --git a/src/Common/dataAccess/deleteUserDefinedFunction.ts b/src/Common/dataAccess/deleteUserDefinedFunction.ts index b1e622a5a..c9683c1ab 100644 --- a/src/Common/dataAccess/deleteUserDefinedFunction.ts +++ b/src/Common/dataAccess/deleteUserDefinedFunction.ts @@ -1,19 +1,14 @@ import { AuthType } from "../../AuthType"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; -import { client } from "../CosmosClient"; -import { deleteSqlUserDefinedFunction } from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { handleError } from "../ErrorHandlingUtils"; -import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; import { userContext } from "../../UserContext"; +import { deleteSqlUserDefinedFunction } from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; +import { client } from "../CosmosClient"; +import { handleError } from "../ErrorHandlingUtils"; export async function deleteUserDefinedFunction(databaseId: string, collectionId: string, id: string): Promise { const clearMessage = logConsoleProgress(`Deleting user defined function ${id}`); try { - if ( - userContext.authType === AuthType.AAD && - !userContext.useSDKOperations && - userContext.defaultExperience === DefaultAccountExperienceType.DocumentDB - ) { + if (userContext.authType === AuthType.AAD && !userContext.useSDKOperations && userContext.apiType === "SQL") { await deleteSqlUserDefinedFunction( userContext.subscriptionId, userContext.resourceGroup, diff --git a/src/Common/dataAccess/getCollectionDataUsageSize.ts b/src/Common/dataAccess/getCollectionDataUsageSize.ts index a86f22c25..bb53bc6ac 100644 --- a/src/Common/dataAccess/getCollectionDataUsageSize.ts +++ b/src/Common/dataAccess/getCollectionDataUsageSize.ts @@ -1,8 +1,8 @@ import { AuthType } from "../../AuthType"; -import { armRequest } from "../../Utils/arm/request"; import { configContext } from "../../ConfigContext"; -import { handleError } from "../ErrorHandlingUtils"; import { userContext } from "../../UserContext"; +import { armRequest } from "../../Utils/arm/request"; +import { handleError } from "../ErrorHandlingUtils"; interface TimeSeriesData { data: { @@ -45,9 +45,9 @@ export const getCollectionUsageSizeInKB = async (databaseName: string, container return undefined; } - const subscriptionId = userContext.subscriptionId; - const resourceGroup = userContext.resourceGroup; - const accountName = userContext.databaseAccount.name; + const { subscriptionId, resourceGroup, databaseAccount } = userContext; + const accountName = databaseAccount.name; + const filter = `DatabaseName eq '${databaseName}' and CollectionName eq '${containerName}'`; const metricNames = "DataUsage,IndexUsage"; const path = `/subscriptions/${subscriptionId}/resourceGroups/${resourceGroup}/providers/Microsoft.DocumentDB/databaseAccounts/${accountName}/providers/microsoft.insights/metrics`; diff --git a/src/Common/dataAccess/queryDocuments.ts b/src/Common/dataAccess/queryDocuments.ts index 16b2fb39e..c24e22ff6 100644 --- a/src/Common/dataAccess/queryDocuments.ts +++ b/src/Common/dataAccess/queryDocuments.ts @@ -1,6 +1,6 @@ -import { Queries } from "../Constants"; import { FeedOptions, ItemDefinition, QueryIterator, Resource } from "@azure/cosmos"; import { LocalStorageUtility, StorageKey } from "../../Shared/StorageUtility"; +import { Queries } from "../Constants"; import { client } from "../CosmosClient"; export const queryDocuments = ( diff --git a/src/Common/dataAccess/queryDocumentsPage.ts b/src/Common/dataAccess/queryDocumentsPage.ts index 064e4126f..e8b5447ef 100644 --- a/src/Common/dataAccess/queryDocumentsPage.ts +++ b/src/Common/dataAccess/queryDocumentsPage.ts @@ -1,8 +1,8 @@ import { QueryResults } from "../../Contracts/ViewModels"; import { logConsoleInfo, logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; -import { MinimalQueryIterator, nextPage } from "../IteratorUtilities"; -import { handleError } from "../ErrorHandlingUtils"; import { getEntityName } from "../DocumentUtility"; +import { handleError } from "../ErrorHandlingUtils"; +import { MinimalQueryIterator, nextPage } from "../IteratorUtilities"; export const queryDocumentsPage = async ( resourceName: string, diff --git a/src/Common/dataAccess/readCollection.test.ts b/src/Common/dataAccess/readCollection.test.ts index 8b5060948..b6d6b1752 100644 --- a/src/Common/dataAccess/readCollection.test.ts +++ b/src/Common/dataAccess/readCollection.test.ts @@ -1,10 +1,9 @@ jest.mock("../CosmosClient"); import { AuthType } from "../../AuthType"; import { DatabaseAccount } from "../../Contracts/DataModels"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; +import { updateUserContext } from "../../UserContext"; import { client } from "../CosmosClient"; import { readCollection } from "./readCollection"; -import { updateUserContext } from "../../UserContext"; describe("readCollection", () => { beforeAll(() => { @@ -13,7 +12,7 @@ describe("readCollection", () => { databaseAccount: { name: "test", } as DatabaseAccount, - defaultExperience: DefaultAccountExperienceType.DocumentDB, + apiType: "SQL", }); }); diff --git a/src/Common/dataAccess/readCollectionOffer.ts b/src/Common/dataAccess/readCollectionOffer.ts index c56183622..c307242d8 100644 --- a/src/Common/dataAccess/readCollectionOffer.ts +++ b/src/Common/dataAccess/readCollectionOffer.ts @@ -1,25 +1,20 @@ import { AuthType } from "../../AuthType"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; import { Offer, ReadCollectionOfferParams } from "../../Contracts/DataModels"; -import { handleError } from "../ErrorHandlingUtils"; -import { getSqlContainerThroughput } from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { getMongoDBCollectionThroughput } from "../../Utils/arm/generatedClients/2020-04-01/mongoDBResources"; -import { getCassandraTableThroughput } from "../../Utils/arm/generatedClients/2020-04-01/cassandraResources"; -import { getGremlinGraphThroughput } from "../../Utils/arm/generatedClients/2020-04-01/gremlinResources"; -import { getTableThroughput } from "../../Utils/arm/generatedClients/2020-04-01/tableResources"; -import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; -import { readOfferWithSDK } from "./readOfferWithSDK"; import { userContext } from "../../UserContext"; +import { getCassandraTableThroughput } from "../../Utils/arm/generatedClients/cosmos/cassandraResources"; +import { getGremlinGraphThroughput } from "../../Utils/arm/generatedClients/cosmos/gremlinResources"; +import { getMongoDBCollectionThroughput } from "../../Utils/arm/generatedClients/cosmos/mongoDBResources"; +import { getSqlContainerThroughput } from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { getTableThroughput } from "../../Utils/arm/generatedClients/cosmos/tableResources"; +import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; +import { handleError } from "../ErrorHandlingUtils"; +import { readOfferWithSDK } from "./readOfferWithSDK"; export const readCollectionOffer = async (params: ReadCollectionOfferParams): Promise => { const clearMessage = logConsoleProgress(`Querying offer for collection ${params.collectionId}`); try { - if ( - userContext.authType === AuthType.AAD && - !userContext.useSDKOperations && - userContext.defaultExperience !== DefaultAccountExperienceType.Table - ) { + if (userContext.authType === AuthType.AAD && !userContext.useSDKOperations && userContext.apiType !== "Tables") { return await readCollectionOfferWithARM(params.databaseId, params.collectionId); } @@ -33,15 +28,13 @@ export const readCollectionOffer = async (params: ReadCollectionOfferParams): Pr }; const readCollectionOfferWithARM = async (databaseId: string, collectionId: string): Promise => { - const subscriptionId = userContext.subscriptionId; - const resourceGroup = userContext.resourceGroup; - const accountName = userContext.databaseAccount.name; - const defaultExperience = userContext.defaultExperience; + const { subscriptionId, resourceGroup, apiType, databaseAccount } = userContext; + const accountName = databaseAccount.name; let rpResponse; try { - switch (defaultExperience) { - case DefaultAccountExperienceType.DocumentDB: + switch (apiType) { + case "SQL": rpResponse = await getSqlContainerThroughput( subscriptionId, resourceGroup, @@ -50,7 +43,7 @@ const readCollectionOfferWithARM = async (databaseId: string, collectionId: stri collectionId ); break; - case DefaultAccountExperienceType.MongoDB: + case "Mongo": rpResponse = await getMongoDBCollectionThroughput( subscriptionId, resourceGroup, @@ -59,7 +52,7 @@ const readCollectionOfferWithARM = async (databaseId: string, collectionId: stri collectionId ); break; - case DefaultAccountExperienceType.Cassandra: + case "Cassandra": rpResponse = await getCassandraTableThroughput( subscriptionId, resourceGroup, @@ -68,7 +61,7 @@ const readCollectionOfferWithARM = async (databaseId: string, collectionId: stri collectionId ); break; - case DefaultAccountExperienceType.Graph: + case "Gremlin": rpResponse = await getGremlinGraphThroughput( subscriptionId, resourceGroup, @@ -77,11 +70,11 @@ const readCollectionOfferWithARM = async (databaseId: string, collectionId: stri collectionId ); break; - case DefaultAccountExperienceType.Table: + case "Tables": rpResponse = await getTableThroughput(subscriptionId, resourceGroup, accountName, collectionId); break; default: - throw new Error(`Unsupported default experience type: ${defaultExperience}`); + throw new Error(`Unsupported default experience type: ${apiType}`); } } catch (error) { if (error.code !== "NotFound") { diff --git a/src/Common/dataAccess/readCollections.test.ts b/src/Common/dataAccess/readCollections.test.ts index 998591b48..50348b574 100644 --- a/src/Common/dataAccess/readCollections.test.ts +++ b/src/Common/dataAccess/readCollections.test.ts @@ -2,11 +2,10 @@ jest.mock("../../Utils/arm/request"); jest.mock("../CosmosClient"); import { AuthType } from "../../AuthType"; import { DatabaseAccount } from "../../Contracts/DataModels"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; +import { updateUserContext } from "../../UserContext"; import { armRequest } from "../../Utils/arm/request"; import { client } from "../CosmosClient"; import { readCollections } from "./readCollections"; -import { updateUserContext } from "../../UserContext"; describe("readCollections", () => { beforeAll(() => { @@ -14,7 +13,7 @@ describe("readCollections", () => { databaseAccount: { name: "test", } as DatabaseAccount, - defaultExperience: DefaultAccountExperienceType.DocumentDB, + apiType: "SQL", }); }); diff --git a/src/Common/dataAccess/readCollections.ts b/src/Common/dataAccess/readCollections.ts index c067afe49..92be4f57e 100644 --- a/src/Common/dataAccess/readCollections.ts +++ b/src/Common/dataAccess/readCollections.ts @@ -1,25 +1,19 @@ -import * as DataModels from "../../Contracts/DataModels"; import { AuthType } from "../../AuthType"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; +import * as DataModels from "../../Contracts/DataModels"; +import { userContext } from "../../UserContext"; +import { listCassandraTables } from "../../Utils/arm/generatedClients/cosmos/cassandraResources"; +import { listGremlinGraphs } from "../../Utils/arm/generatedClients/cosmos/gremlinResources"; +import { listMongoDBCollections } from "../../Utils/arm/generatedClients/cosmos/mongoDBResources"; +import { listSqlContainers } from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { listTables } from "../../Utils/arm/generatedClients/cosmos/tableResources"; +import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; import { client } from "../CosmosClient"; import { handleError } from "../ErrorHandlingUtils"; -import { listSqlContainers } from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { listCassandraTables } from "../../Utils/arm/generatedClients/2020-04-01/cassandraResources"; -import { listMongoDBCollections } from "../../Utils/arm/generatedClients/2020-04-01/mongoDBResources"; -import { listGremlinGraphs } from "../../Utils/arm/generatedClients/2020-04-01/gremlinResources"; -import { listTables } from "../../Utils/arm/generatedClients/2020-04-01/tableResources"; -import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; -import { userContext } from "../../UserContext"; export async function readCollections(databaseId: string): Promise { const clearMessage = logConsoleProgress(`Querying containers for database ${databaseId}`); try { - if ( - userContext.authType === AuthType.AAD && - !userContext.useSDKOperations && - userContext.defaultExperience !== DefaultAccountExperienceType.MongoDB && - userContext.defaultExperience !== DefaultAccountExperienceType.Table - ) { + if (userContext.authType === AuthType.AAD && !userContext.useSDKOperations && userContext.apiType !== "Tables") { return await readCollectionsWithARM(databaseId); } @@ -35,29 +29,28 @@ export async function readCollections(databaseId: string): Promise { let rpResponse; - const subscriptionId = userContext.subscriptionId; - const resourceGroup = userContext.resourceGroup; - const accountName = userContext.databaseAccount.name; - const defaultExperience = userContext.defaultExperience; - switch (defaultExperience) { - case DefaultAccountExperienceType.DocumentDB: + const { subscriptionId, resourceGroup, apiType, databaseAccount } = userContext; + const accountName = databaseAccount.name; + + switch (apiType) { + case "SQL": rpResponse = await listSqlContainers(subscriptionId, resourceGroup, accountName, databaseId); break; - case DefaultAccountExperienceType.MongoDB: + case "Mongo": rpResponse = await listMongoDBCollections(subscriptionId, resourceGroup, accountName, databaseId); break; - case DefaultAccountExperienceType.Cassandra: + case "Cassandra": rpResponse = await listCassandraTables(subscriptionId, resourceGroup, accountName, databaseId); break; - case DefaultAccountExperienceType.Graph: + case "Gremlin": rpResponse = await listGremlinGraphs(subscriptionId, resourceGroup, accountName, databaseId); break; - case DefaultAccountExperienceType.Table: + case "Tables": rpResponse = await listTables(subscriptionId, resourceGroup, accountName); break; default: - throw new Error(`Unsupported default experience type: ${defaultExperience}`); + throw new Error(`Unsupported default experience type: ${apiType}`); } return rpResponse?.value?.map((collection) => collection.properties?.resource as DataModels.Collection); diff --git a/src/Common/dataAccess/readDatabaseOffer.ts b/src/Common/dataAccess/readDatabaseOffer.ts index 9a3688ea0..d27d68078 100644 --- a/src/Common/dataAccess/readDatabaseOffer.ts +++ b/src/Common/dataAccess/readDatabaseOffer.ts @@ -1,24 +1,19 @@ import { AuthType } from "../../AuthType"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; import { Offer, ReadDatabaseOfferParams } from "../../Contracts/DataModels"; -import { getSqlDatabaseThroughput } from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { getMongoDBDatabaseThroughput } from "../../Utils/arm/generatedClients/2020-04-01/mongoDBResources"; -import { getCassandraKeyspaceThroughput } from "../../Utils/arm/generatedClients/2020-04-01/cassandraResources"; -import { getGremlinDatabaseThroughput } from "../../Utils/arm/generatedClients/2020-04-01/gremlinResources"; -import { handleError } from "../ErrorHandlingUtils"; -import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; -import { readOfferWithSDK } from "./readOfferWithSDK"; import { userContext } from "../../UserContext"; +import { getCassandraKeyspaceThroughput } from "../../Utils/arm/generatedClients/cosmos/cassandraResources"; +import { getGremlinDatabaseThroughput } from "../../Utils/arm/generatedClients/cosmos/gremlinResources"; +import { getMongoDBDatabaseThroughput } from "../../Utils/arm/generatedClients/cosmos/mongoDBResources"; +import { getSqlDatabaseThroughput } from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; +import { handleError } from "../ErrorHandlingUtils"; +import { readOfferWithSDK } from "./readOfferWithSDK"; export const readDatabaseOffer = async (params: ReadDatabaseOfferParams): Promise => { const clearMessage = logConsoleProgress(`Querying offer for database ${params.databaseId}`); try { - if ( - userContext.authType === AuthType.AAD && - !userContext.useSDKOperations && - userContext.defaultExperience !== DefaultAccountExperienceType.Table - ) { + if (userContext.authType === AuthType.AAD && !userContext.useSDKOperations && userContext.apiType !== "Tables") { return await readDatabaseOfferWithARM(params.databaseId); } @@ -32,28 +27,26 @@ export const readDatabaseOffer = async (params: ReadDatabaseOfferParams): Promis }; const readDatabaseOfferWithARM = async (databaseId: string): Promise => { - const subscriptionId = userContext.subscriptionId; - const resourceGroup = userContext.resourceGroup; - const accountName = userContext.databaseAccount.name; - const defaultExperience = userContext.defaultExperience; + const { subscriptionId, resourceGroup, apiType, databaseAccount } = userContext; + const accountName = databaseAccount.name; let rpResponse; try { - switch (defaultExperience) { - case DefaultAccountExperienceType.DocumentDB: + switch (apiType) { + case "SQL": rpResponse = await getSqlDatabaseThroughput(subscriptionId, resourceGroup, accountName, databaseId); break; - case DefaultAccountExperienceType.MongoDB: + case "Mongo": rpResponse = await getMongoDBDatabaseThroughput(subscriptionId, resourceGroup, accountName, databaseId); break; - case DefaultAccountExperienceType.Cassandra: + case "Cassandra": rpResponse = await getCassandraKeyspaceThroughput(subscriptionId, resourceGroup, accountName, databaseId); break; - case DefaultAccountExperienceType.Graph: + case "Gremlin": rpResponse = await getGremlinDatabaseThroughput(subscriptionId, resourceGroup, accountName, databaseId); break; default: - throw new Error(`Unsupported default experience type: ${defaultExperience}`); + throw new Error(`Unsupported default experience type: ${apiType}`); } } catch (error) { if (error.code !== "NotFound") { diff --git a/src/Common/dataAccess/readDatabases.test.ts b/src/Common/dataAccess/readDatabases.test.ts index 4315d0a1c..8f6368f78 100644 --- a/src/Common/dataAccess/readDatabases.test.ts +++ b/src/Common/dataAccess/readDatabases.test.ts @@ -2,11 +2,10 @@ jest.mock("../../Utils/arm/request"); jest.mock("../CosmosClient"); import { AuthType } from "../../AuthType"; import { DatabaseAccount } from "../../Contracts/DataModels"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; +import { updateUserContext } from "../../UserContext"; import { armRequest } from "../../Utils/arm/request"; import { client } from "../CosmosClient"; import { readDatabases } from "./readDatabases"; -import { updateUserContext } from "../../UserContext"; describe("readDatabases", () => { beforeAll(() => { @@ -14,7 +13,7 @@ describe("readDatabases", () => { databaseAccount: { name: "test", } as DatabaseAccount, - defaultExperience: DefaultAccountExperienceType.DocumentDB, + apiType: "SQL", }); }); diff --git a/src/Common/dataAccess/readDatabases.ts b/src/Common/dataAccess/readDatabases.ts index ddcc72c93..e5136676e 100644 --- a/src/Common/dataAccess/readDatabases.ts +++ b/src/Common/dataAccess/readDatabases.ts @@ -1,24 +1,19 @@ -import * as DataModels from "../../Contracts/DataModels"; import { AuthType } from "../../AuthType"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; +import * as DataModels from "../../Contracts/DataModels"; +import { userContext } from "../../UserContext"; +import { listCassandraKeyspaces } from "../../Utils/arm/generatedClients/cosmos/cassandraResources"; +import { listGremlinDatabases } from "../../Utils/arm/generatedClients/cosmos/gremlinResources"; +import { listMongoDBDatabases } from "../../Utils/arm/generatedClients/cosmos/mongoDBResources"; +import { listSqlDatabases } from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; import { client } from "../CosmosClient"; import { handleError } from "../ErrorHandlingUtils"; -import { listSqlDatabases } from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { listCassandraKeyspaces } from "../../Utils/arm/generatedClients/2020-04-01/cassandraResources"; -import { listMongoDBDatabases } from "../../Utils/arm/generatedClients/2020-04-01/mongoDBResources"; -import { listGremlinDatabases } from "../../Utils/arm/generatedClients/2020-04-01/gremlinResources"; -import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; -import { userContext } from "../../UserContext"; export async function readDatabases(): Promise { let databases: DataModels.Database[]; const clearMessage = logConsoleProgress(`Querying databases`); try { - if ( - userContext.authType === AuthType.AAD && - !userContext.useSDKOperations && - userContext.defaultExperience !== DefaultAccountExperienceType.Table - ) { + if (userContext.authType === AuthType.AAD && !userContext.useSDKOperations && userContext.apiType !== "Tables") { databases = await readDatabasesWithARM(); } else { const sdkResponse = await client().databases.readAll().fetchAll(); @@ -34,26 +29,24 @@ export async function readDatabases(): Promise { async function readDatabasesWithARM(): Promise { let rpResponse; - const subscriptionId = userContext.subscriptionId; - const resourceGroup = userContext.resourceGroup; - const accountName = userContext.databaseAccount.name; - const defaultExperience = userContext.defaultExperience; + const { subscriptionId, resourceGroup, apiType, databaseAccount } = userContext; + const accountName = databaseAccount.name; - switch (defaultExperience) { - case DefaultAccountExperienceType.DocumentDB: + switch (apiType) { + case "SQL": rpResponse = await listSqlDatabases(subscriptionId, resourceGroup, accountName); break; - case DefaultAccountExperienceType.MongoDB: + case "Mongo": rpResponse = await listMongoDBDatabases(subscriptionId, resourceGroup, accountName); break; - case DefaultAccountExperienceType.Cassandra: + case "Cassandra": rpResponse = await listCassandraKeyspaces(subscriptionId, resourceGroup, accountName); break; - case DefaultAccountExperienceType.Graph: + case "Gremlin": rpResponse = await listGremlinDatabases(subscriptionId, resourceGroup, accountName); break; default: - throw new Error(`Unsupported default experience type: ${defaultExperience}`); + throw new Error(`Unsupported default experience type: ${apiType}`); } return rpResponse?.value?.map((database) => database.properties?.resource as DataModels.Database); diff --git a/src/Common/dataAccess/readMongoDBCollection.tsx b/src/Common/dataAccess/readMongoDBCollection.tsx index 240e81315..cdc4a0845 100644 --- a/src/Common/dataAccess/readMongoDBCollection.tsx +++ b/src/Common/dataAccess/readMongoDBCollection.tsx @@ -1,9 +1,9 @@ +import { AuthType } from "../../AuthType"; import { userContext } from "../../UserContext"; -import { getMongoDBCollection } from "../../Utils/arm/generatedClients/2020-04-01/mongoDBResources"; -import { MongoDBCollectionResource } from "../../Utils/arm/generatedClients/2020-04-01/types"; +import { getMongoDBCollection } from "../../Utils/arm/generatedClients/cosmos/mongoDBResources"; +import { MongoDBCollectionResource } from "../../Utils/arm/generatedClients/cosmos/types"; import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; import { handleError } from "../ErrorHandlingUtils"; -import { AuthType } from "../../AuthType"; export async function readMongoDBCollectionThroughRP( databaseId: string, @@ -13,9 +13,9 @@ export async function readMongoDBCollectionThroughRP( return undefined; } let collection: MongoDBCollectionResource; - const subscriptionId = userContext.subscriptionId; - const resourceGroup = userContext.resourceGroup; - const accountName = userContext.databaseAccount.name; + + const { subscriptionId, resourceGroup, databaseAccount } = userContext; + const accountName = databaseAccount.name; const clearMessage = logConsoleProgress(`Reading container ${collectionId}`); try { diff --git a/src/Common/dataAccess/readStoredProcedures.ts b/src/Common/dataAccess/readStoredProcedures.ts index 78a5bcee6..65edb54c2 100644 --- a/src/Common/dataAccess/readStoredProcedures.ts +++ b/src/Common/dataAccess/readStoredProcedures.ts @@ -1,11 +1,10 @@ -import { AuthType } from "../../AuthType"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; import { Resource, StoredProcedureDefinition } from "@azure/cosmos"; +import { AuthType } from "../../AuthType"; +import { userContext } from "../../UserContext"; +import { listSqlStoredProcedures } from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; import { client } from "../CosmosClient"; import { handleError } from "../ErrorHandlingUtils"; -import { listSqlStoredProcedures } from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; -import { userContext } from "../../UserContext"; export async function readStoredProcedures( databaseId: string, @@ -13,11 +12,7 @@ export async function readStoredProcedures( ): Promise<(StoredProcedureDefinition & Resource)[]> { const clearMessage = logConsoleProgress(`Querying stored procedures for container ${collectionId}`); try { - if ( - userContext.authType === AuthType.AAD && - !userContext.useSDKOperations && - userContext.defaultExperience === DefaultAccountExperienceType.DocumentDB - ) { + if (userContext.authType === AuthType.AAD && !userContext.useSDKOperations && userContext.apiType === "SQL") { const rpResponse = await listSqlStoredProcedures( userContext.subscriptionId, userContext.resourceGroup, diff --git a/src/Common/dataAccess/readTriggers.ts b/src/Common/dataAccess/readTriggers.ts index fa97f98d6..764f3ace1 100644 --- a/src/Common/dataAccess/readTriggers.ts +++ b/src/Common/dataAccess/readTriggers.ts @@ -1,23 +1,19 @@ +import { TriggerDefinition } from "@azure/cosmos"; import { AuthType } from "../../AuthType"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; -import { Resource, TriggerDefinition } from "@azure/cosmos"; -import { client } from "../CosmosClient"; -import { listSqlTriggers } from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; import { userContext } from "../../UserContext"; +import { listSqlTriggers } from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { SqlTriggerResource } from "../../Utils/arm/generatedClients/cosmos/types"; +import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; +import { client } from "../CosmosClient"; import { handleError } from "../ErrorHandlingUtils"; export async function readTriggers( databaseId: string, collectionId: string -): Promise<(TriggerDefinition & Resource)[]> { +): Promise { const clearMessage = logConsoleProgress(`Querying triggers for container ${collectionId}`); try { - if ( - userContext.authType === AuthType.AAD && - !userContext.useSDKOperations && - userContext.defaultExperience === DefaultAccountExperienceType.DocumentDB - ) { + if (userContext.authType === AuthType.AAD && !userContext.useSDKOperations && userContext.apiType === "SQL") { const rpResponse = await listSqlTriggers( userContext.subscriptionId, userContext.resourceGroup, @@ -25,7 +21,7 @@ export async function readTriggers( databaseId, collectionId ); - return rpResponse?.value?.map((trigger) => trigger.properties?.resource as TriggerDefinition & Resource); + return rpResponse?.value?.map((trigger) => trigger.properties?.resource); } const response = await client().database(databaseId).container(collectionId).scripts.triggers.readAll().fetchAll(); diff --git a/src/Common/dataAccess/readUserDefinedFunctions.ts b/src/Common/dataAccess/readUserDefinedFunctions.ts index 7d59bec6f..a55ad0ca6 100644 --- a/src/Common/dataAccess/readUserDefinedFunctions.ts +++ b/src/Common/dataAccess/readUserDefinedFunctions.ts @@ -1,27 +1,23 @@ -import { AuthType } from "../../AuthType"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; import { Resource, UserDefinedFunctionDefinition } from "@azure/cosmos"; +import { AuthType } from "../../AuthType"; +import { userContext } from "../../UserContext"; +import { listSqlUserDefinedFunctions } from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; import { client } from "../CosmosClient"; import { handleError } from "../ErrorHandlingUtils"; -import { listSqlUserDefinedFunctions } from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; -import { userContext } from "../../UserContext"; export async function readUserDefinedFunctions( databaseId: string, collectionId: string ): Promise<(UserDefinedFunctionDefinition & Resource)[]> { const clearMessage = logConsoleProgress(`Querying user defined functions for container ${collectionId}`); + const { authType, useSDKOperations, apiType, subscriptionId, resourceGroup, databaseAccount } = userContext; try { - if ( - userContext.authType === AuthType.AAD && - !userContext.useSDKOperations && - userContext.defaultExperience === DefaultAccountExperienceType.DocumentDB - ) { + if (authType === AuthType.AAD && !useSDKOperations && apiType === "SQL") { const rpResponse = await listSqlUserDefinedFunctions( - userContext.subscriptionId, - userContext.resourceGroup, - userContext.databaseAccount.name, + subscriptionId, + resourceGroup, + databaseAccount.name, databaseId, collectionId ); diff --git a/src/Common/dataAccess/updateCollection.ts b/src/Common/dataAccess/updateCollection.ts index 3724a0e22..cb553b77f 100644 --- a/src/Common/dataAccess/updateCollection.ts +++ b/src/Common/dataAccess/updateCollection.ts @@ -1,51 +1,40 @@ +import { ContainerDefinition } from "@azure/cosmos"; +import { RequestOptions } from "@azure/cosmos/dist-esm"; import { AuthType } from "../../AuthType"; import { Collection } from "../../Contracts/DataModels"; -import { ContainerDefinition } from "@azure/cosmos"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; -import { - CreateUpdateOptions, - ExtendedResourceProperties, - MongoDBCollectionCreateUpdateParameters, - MongoDBCollectionResource, - SqlContainerCreateUpdateParameters, - SqlContainerResource, -} from "../../Utils/arm/generatedClients/2020-04-01/types"; -import { RequestOptions } from "@azure/cosmos/dist-esm"; -import { client } from "../CosmosClient"; -import { createUpdateSqlContainer, getSqlContainer } from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; +import { userContext } from "../../UserContext"; import { createUpdateCassandraTable, getCassandraTable, -} from "../../Utils/arm/generatedClients/2020-04-01/cassandraResources"; +} from "../../Utils/arm/generatedClients/cosmos/cassandraResources"; +import { createUpdateGremlinGraph, getGremlinGraph } from "../../Utils/arm/generatedClients/cosmos/gremlinResources"; import { createUpdateMongoDBCollection, getMongoDBCollection, -} from "../../Utils/arm/generatedClients/2020-04-01/mongoDBResources"; +} from "../../Utils/arm/generatedClients/cosmos/mongoDBResources"; +import { createUpdateSqlContainer, getSqlContainer } from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { createUpdateTable, getTable } from "../../Utils/arm/generatedClients/cosmos/tableResources"; import { - createUpdateGremlinGraph, - getGremlinGraph, -} from "../../Utils/arm/generatedClients/2020-04-01/gremlinResources"; -import { createUpdateTable, getTable } from "../../Utils/arm/generatedClients/2020-04-01/tableResources"; -import { handleError } from "../ErrorHandlingUtils"; + ExtendedResourceProperties, + MongoDBCollectionCreateUpdateParameters, + SqlContainerCreateUpdateParameters, + SqlContainerResource, +} from "../../Utils/arm/generatedClients/cosmos/types"; import { logConsoleInfo, logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; -import { userContext } from "../../UserContext"; +import { client } from "../CosmosClient"; +import { handleError } from "../ErrorHandlingUtils"; export async function updateCollection( databaseId: string, collectionId: string, - newCollection: Collection, + newCollection: Partial, options: RequestOptions = {} ): Promise { let collection: Collection; const clearMessage = logConsoleProgress(`Updating container ${collectionId}`); try { - if ( - userContext.authType === AuthType.AAD && - !userContext.useSDKOperations && - userContext.defaultExperience !== DefaultAccountExperienceType.MongoDB && - userContext.defaultExperience !== DefaultAccountExperienceType.Table - ) { + if (userContext.authType === AuthType.AAD && !userContext.useSDKOperations && userContext.apiType !== "Tables") { collection = await updateCollectionWithARM(databaseId, collectionId, newCollection); } else { const sdkResponse = await client() @@ -69,24 +58,31 @@ export async function updateCollection( async function updateCollectionWithARM( databaseId: string, collectionId: string, - newCollection: Collection + newCollection: Partial ): Promise { - const subscriptionId = userContext.subscriptionId; - const resourceGroup = userContext.resourceGroup; - const accountName = userContext.databaseAccount.name; - const defaultExperience = userContext.defaultExperience; + const { subscriptionId, resourceGroup, apiType, databaseAccount } = userContext; + const accountName = databaseAccount.name; - switch (defaultExperience) { - case DefaultAccountExperienceType.DocumentDB: + switch (apiType) { + case "SQL": return updateSqlContainer(databaseId, collectionId, subscriptionId, resourceGroup, accountName, newCollection); - case DefaultAccountExperienceType.Cassandra: + case "Cassandra": return updateCassandraTable(databaseId, collectionId, subscriptionId, resourceGroup, accountName, newCollection); - case DefaultAccountExperienceType.Graph: + case "Gremlin": return updateGremlinGraph(databaseId, collectionId, subscriptionId, resourceGroup, accountName, newCollection); - case DefaultAccountExperienceType.Table: + case "Tables": return updateTable(collectionId, subscriptionId, resourceGroup, accountName, newCollection); + case "Mongo": + return updateMongoDBCollection( + databaseId, + collectionId, + subscriptionId, + resourceGroup, + accountName, + newCollection + ); default: - throw new Error(`Unsupported default experience type: ${defaultExperience}`); + throw new Error(`Unsupported default experience type: ${apiType}`); } } @@ -96,7 +92,7 @@ async function updateSqlContainer( subscriptionId: string, resourceGroup: string, accountName: string, - newCollection: Collection + newCollection: Partial ): Promise { const getResponse = await getSqlContainer(subscriptionId, resourceGroup, accountName, databaseId, collectionId); if (getResponse && getResponse.properties && getResponse.properties.resource) { @@ -115,35 +111,26 @@ async function updateSqlContainer( throw new Error(`Sql container to update does not exist. Database id: ${databaseId} Collection id: ${collectionId}`); } -export async function updateMongoDBCollectionThroughRP( +export async function updateMongoDBCollection( databaseId: string, collectionId: string, - newCollection: MongoDBCollectionResource, - updateOptions?: CreateUpdateOptions -): Promise { - const subscriptionId = userContext.subscriptionId; - const resourceGroup = userContext.resourceGroup; - const accountName = userContext.databaseAccount.name; - + subscriptionId: string, + resourceGroup: string, + accountName: string, + newCollection: Partial +): Promise { const getResponse = await getMongoDBCollection(subscriptionId, resourceGroup, accountName, databaseId, collectionId); if (getResponse && getResponse.properties && getResponse.properties.resource) { - const updateParams: MongoDBCollectionCreateUpdateParameters = { - properties: { - resource: newCollection, - options: updateOptions, - }, - }; - + getResponse.properties.resource = newCollection as SqlContainerResource & ExtendedResourceProperties; const updateResponse = await createUpdateMongoDBCollection( subscriptionId, resourceGroup, accountName, databaseId, collectionId, - updateParams + getResponse as MongoDBCollectionCreateUpdateParameters ); - - return updateResponse && (updateResponse.properties.resource as MongoDBCollectionResource); + return updateResponse && (updateResponse.properties.resource as Collection); } throw new Error( @@ -157,7 +144,7 @@ async function updateCassandraTable( subscriptionId: string, resourceGroup: string, accountName: string, - newCollection: Collection + newCollection: Partial ): Promise { const getResponse = await getCassandraTable(subscriptionId, resourceGroup, accountName, databaseId, collectionId); if (getResponse && getResponse.properties && getResponse.properties.resource) { @@ -184,7 +171,7 @@ async function updateGremlinGraph( subscriptionId: string, resourceGroup: string, accountName: string, - newCollection: Collection + newCollection: Partial ): Promise { const getResponse = await getGremlinGraph(subscriptionId, resourceGroup, accountName, databaseId, collectionId); if (getResponse && getResponse.properties && getResponse.properties.resource) { @@ -208,7 +195,7 @@ async function updateTable( subscriptionId: string, resourceGroup: string, accountName: string, - newCollection: Collection + newCollection: Partial ): Promise { const getResponse = await getTable(subscriptionId, resourceGroup, accountName, collectionId); if (getResponse && getResponse.properties && getResponse.properties.resource) { diff --git a/src/Common/dataAccess/updateOffer.ts b/src/Common/dataAccess/updateOffer.ts index 00a6864e9..380de430d 100644 --- a/src/Common/dataAccess/updateOffer.ts +++ b/src/Common/dataAccess/updateOffer.ts @@ -1,54 +1,53 @@ -import { AuthType } from "../../AuthType"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; -import { HttpHeaders } from "../Constants"; -import { Offer, SDKOfferDefinition, UpdateOfferParams } from "../../Contracts/DataModels"; import { OfferDefinition } from "@azure/cosmos"; import { RequestOptions } from "@azure/cosmos/dist-esm"; -import { ThroughputSettingsUpdateParameters } from "../../Utils/arm/generatedClients/2020-04-01/types"; -import { client } from "../CosmosClient"; -import { handleError } from "../ErrorHandlingUtils"; -import { logConsoleInfo, logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; -import { parseSDKOfferResponse } from "../OfferUtility"; -import { readCollectionOffer } from "./readCollectionOffer"; -import { readDatabaseOffer } from "./readDatabaseOffer"; +import { AuthType } from "../../AuthType"; +import { Offer, SDKOfferDefinition, UpdateOfferParams } from "../../Contracts/DataModels"; +import { userContext } from "../../UserContext"; import { - updateSqlDatabaseThroughput, - migrateSqlDatabaseToAutoscale, - migrateSqlDatabaseToManualThroughput, - migrateSqlContainerToAutoscale, - migrateSqlContainerToManualThroughput, - updateSqlContainerThroughput, -} from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { - updateCassandraKeyspaceThroughput, migrateCassandraKeyspaceToAutoscale, migrateCassandraKeyspaceToManualThroughput, migrateCassandraTableToAutoscale, migrateCassandraTableToManualThroughput, + updateCassandraKeyspaceThroughput, updateCassandraTableThroughput, -} from "../../Utils/arm/generatedClients/2020-04-01/cassandraResources"; +} from "../../Utils/arm/generatedClients/cosmos/cassandraResources"; import { - updateMongoDBDatabaseThroughput, - migrateMongoDBDatabaseToAutoscale, - migrateMongoDBDatabaseToManualThroughput, - migrateMongoDBCollectionToAutoscale, - migrateMongoDBCollectionToManualThroughput, - updateMongoDBCollectionThroughput, -} from "../../Utils/arm/generatedClients/2020-04-01/mongoDBResources"; -import { - updateGremlinDatabaseThroughput, migrateGremlinDatabaseToAutoscale, migrateGremlinDatabaseToManualThroughput, migrateGremlinGraphToAutoscale, migrateGremlinGraphToManualThroughput, + updateGremlinDatabaseThroughput, updateGremlinGraphThroughput, -} from "../../Utils/arm/generatedClients/2020-04-01/gremlinResources"; -import { userContext } from "../../UserContext"; +} from "../../Utils/arm/generatedClients/cosmos/gremlinResources"; +import { + migrateMongoDBCollectionToAutoscale, + migrateMongoDBCollectionToManualThroughput, + migrateMongoDBDatabaseToAutoscale, + migrateMongoDBDatabaseToManualThroughput, + updateMongoDBCollectionThroughput, + updateMongoDBDatabaseThroughput, +} from "../../Utils/arm/generatedClients/cosmos/mongoDBResources"; +import { + migrateSqlContainerToAutoscale, + migrateSqlContainerToManualThroughput, + migrateSqlDatabaseToAutoscale, + migrateSqlDatabaseToManualThroughput, + updateSqlContainerThroughput, + updateSqlDatabaseThroughput, +} from "../../Utils/arm/generatedClients/cosmos/sqlResources"; import { migrateTableToAutoscale, migrateTableToManualThroughput, updateTableThroughput, -} from "../../Utils/arm/generatedClients/2020-04-01/tableResources"; +} from "../../Utils/arm/generatedClients/cosmos/tableResources"; +import { ThroughputSettingsUpdateParameters } from "../../Utils/arm/generatedClients/cosmos/types"; +import { logConsoleInfo, logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; +import { HttpHeaders } from "../Constants"; +import { client } from "../CosmosClient"; +import { handleError } from "../ErrorHandlingUtils"; +import { parseSDKOfferResponse } from "../OfferUtility"; +import { readCollectionOffer } from "./readCollectionOffer"; +import { readDatabaseOffer } from "./readDatabaseOffer"; export const updateOffer = async (params: UpdateOfferParams): Promise => { let updatedOffer: Offer; @@ -61,7 +60,7 @@ export const updateOffer = async (params: UpdateOfferParams): Promise => if (userContext.authType === AuthType.AAD && !userContext.useSDKOperations) { if (params.collectionId) { updatedOffer = await updateCollectionOfferWithARM(params); - } else if (userContext.defaultExperience === DefaultAccountExperienceType.Table) { + } else if (userContext.apiType === "Tables") { // update table's database offer with SDK since RP doesn't support it updatedOffer = await updateOfferWithSDK(params); } else { @@ -82,24 +81,24 @@ export const updateOffer = async (params: UpdateOfferParams): Promise => const updateCollectionOfferWithARM = async (params: UpdateOfferParams): Promise => { try { - switch (userContext.defaultExperience) { - case DefaultAccountExperienceType.DocumentDB: + switch (userContext.apiType) { + case "SQL": await updateSqlContainerOffer(params); break; - case DefaultAccountExperienceType.MongoDB: + case "Mongo": await updateMongoCollectionOffer(params); break; - case DefaultAccountExperienceType.Cassandra: + case "Cassandra": await updateCassandraTableOffer(params); break; - case DefaultAccountExperienceType.Graph: + case "Gremlin": await updateGremlinGraphOffer(params); break; - case DefaultAccountExperienceType.Table: + case "Tables": await updateTableOffer(params); break; default: - throw new Error(`Unsupported default experience type: ${userContext.defaultExperience}`); + throw new Error(`Unsupported default experience type: ${userContext.apiType}`); } } catch (error) { if (error.code !== "MethodNotAllowed") { @@ -116,21 +115,21 @@ const updateCollectionOfferWithARM = async (params: UpdateOfferParams): Promise< const updateDatabaseOfferWithARM = async (params: UpdateOfferParams): Promise => { try { - switch (userContext.defaultExperience) { - case DefaultAccountExperienceType.DocumentDB: + switch (userContext.apiType) { + case "SQL": await updateSqlDatabaseOffer(params); break; - case DefaultAccountExperienceType.MongoDB: + case "Mongo": await updateMongoDatabaseOffer(params); break; - case DefaultAccountExperienceType.Cassandra: + case "Cassandra": await updateCassandraKeyspaceOffer(params); break; - case DefaultAccountExperienceType.Graph: + case "Gremlin": await updateGremlinDatabaseOffer(params); break; default: - throw new Error(`Unsupported default experience type: ${userContext.defaultExperience}`); + throw new Error(`Unsupported default experience type: ${userContext.apiType}`); } } catch (error) { if (error.code !== "MethodNotAllowed") { @@ -145,9 +144,8 @@ const updateDatabaseOfferWithARM = async (params: UpdateOfferParams): Promise => { - const subscriptionId = userContext.subscriptionId; - const resourceGroup = userContext.resourceGroup; - const accountName = userContext.databaseAccount.name; + const { subscriptionId, resourceGroup, databaseAccount } = userContext; + const accountName = databaseAccount.name; if (params.migrateToAutoPilot) { await migrateSqlContainerToAutoscale( @@ -179,9 +177,8 @@ const updateSqlContainerOffer = async (params: UpdateOfferParams): Promise }; const updateMongoCollectionOffer = async (params: UpdateOfferParams): Promise => { - const subscriptionId = userContext.subscriptionId; - const resourceGroup = userContext.resourceGroup; - const accountName = userContext.databaseAccount.name; + const { subscriptionId, resourceGroup, databaseAccount } = userContext; + const accountName = databaseAccount.name; if (params.migrateToAutoPilot) { await migrateMongoDBCollectionToAutoscale( @@ -213,9 +210,8 @@ const updateMongoCollectionOffer = async (params: UpdateOfferParams): Promise => { - const subscriptionId = userContext.subscriptionId; - const resourceGroup = userContext.resourceGroup; - const accountName = userContext.databaseAccount.name; + const { subscriptionId, resourceGroup, databaseAccount } = userContext; + const accountName = databaseAccount.name; if (params.migrateToAutoPilot) { await migrateCassandraTableToAutoscale( @@ -247,9 +243,8 @@ const updateCassandraTableOffer = async (params: UpdateOfferParams): Promise => { - const subscriptionId = userContext.subscriptionId; - const resourceGroup = userContext.resourceGroup; - const accountName = userContext.databaseAccount.name; + const { subscriptionId, resourceGroup, databaseAccount } = userContext; + const accountName = databaseAccount.name; if (params.migrateToAutoPilot) { await migrateGremlinGraphToAutoscale( @@ -281,9 +276,8 @@ const updateGremlinGraphOffer = async (params: UpdateOfferParams): Promise }; const updateTableOffer = async (params: UpdateOfferParams): Promise => { - const subscriptionId = userContext.subscriptionId; - const resourceGroup = userContext.resourceGroup; - const accountName = userContext.databaseAccount.name; + const { subscriptionId, resourceGroup, databaseAccount } = userContext; + const accountName = databaseAccount.name; if (params.migrateToAutoPilot) { await migrateTableToAutoscale(subscriptionId, resourceGroup, accountName, params.collectionId); @@ -296,9 +290,8 @@ const updateTableOffer = async (params: UpdateOfferParams): Promise => { }; const updateSqlDatabaseOffer = async (params: UpdateOfferParams): Promise => { - const subscriptionId = userContext.subscriptionId; - const resourceGroup = userContext.resourceGroup; - const accountName = userContext.databaseAccount.name; + const { subscriptionId, resourceGroup, databaseAccount } = userContext; + const accountName = databaseAccount.name; if (params.migrateToAutoPilot) { await migrateSqlDatabaseToAutoscale(subscriptionId, resourceGroup, accountName, params.databaseId); @@ -311,9 +304,8 @@ const updateSqlDatabaseOffer = async (params: UpdateOfferParams): Promise }; const updateMongoDatabaseOffer = async (params: UpdateOfferParams): Promise => { - const subscriptionId = userContext.subscriptionId; - const resourceGroup = userContext.resourceGroup; - const accountName = userContext.databaseAccount.name; + const { subscriptionId, resourceGroup, databaseAccount } = userContext; + const accountName = databaseAccount.name; if (params.migrateToAutoPilot) { await migrateMongoDBDatabaseToAutoscale(subscriptionId, resourceGroup, accountName, params.databaseId); @@ -326,9 +318,8 @@ const updateMongoDatabaseOffer = async (params: UpdateOfferParams): Promise => { - const subscriptionId = userContext.subscriptionId; - const resourceGroup = userContext.resourceGroup; - const accountName = userContext.databaseAccount.name; + const { subscriptionId, resourceGroup, databaseAccount } = userContext; + const accountName = databaseAccount.name; if (params.migrateToAutoPilot) { await migrateCassandraKeyspaceToAutoscale(subscriptionId, resourceGroup, accountName, params.databaseId); @@ -341,9 +332,8 @@ const updateCassandraKeyspaceOffer = async (params: UpdateOfferParams): Promise< }; const updateGremlinDatabaseOffer = async (params: UpdateOfferParams): Promise => { - const subscriptionId = userContext.subscriptionId; - const resourceGroup = userContext.resourceGroup; - const accountName = userContext.databaseAccount.name; + const { subscriptionId, resourceGroup, databaseAccount } = userContext; + const accountName = databaseAccount.name; if (params.migrateToAutoPilot) { await migrateGremlinDatabaseToAutoscale(subscriptionId, resourceGroup, accountName, params.databaseId); diff --git a/src/Common/dataAccess/updateStoredProcedure.ts b/src/Common/dataAccess/updateStoredProcedure.ts index de49ef82a..b3cf875a0 100644 --- a/src/Common/dataAccess/updateStoredProcedure.ts +++ b/src/Common/dataAccess/updateStoredProcedure.ts @@ -1,18 +1,17 @@ -import { AuthType } from "../../AuthType"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; import { Resource, StoredProcedureDefinition } from "@azure/cosmos"; -import { - SqlStoredProcedureCreateUpdateParameters, - SqlStoredProcedureResource, -} from "../../Utils/arm/generatedClients/2020-04-01/types"; -import { client } from "../CosmosClient"; +import { AuthType } from "../../AuthType"; +import { userContext } from "../../UserContext"; import { createUpdateSqlStoredProcedure, getSqlStoredProcedure, -} from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { handleError } from "../ErrorHandlingUtils"; +} from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { + SqlStoredProcedureCreateUpdateParameters, + SqlStoredProcedureResource, +} from "../../Utils/arm/generatedClients/cosmos/types"; import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; -import { userContext } from "../../UserContext"; +import { client } from "../CosmosClient"; +import { handleError } from "../ErrorHandlingUtils"; export async function updateStoredProcedure( databaseId: string, @@ -21,15 +20,13 @@ export async function updateStoredProcedure( ): Promise { const clearMessage = logConsoleProgress(`Updating stored procedure ${storedProcedure.id}`); try { - if ( - userContext.authType === AuthType.AAD && - !userContext.useSDKOperations && - userContext.defaultExperience === DefaultAccountExperienceType.DocumentDB - ) { + const { authType, useSDKOperations, apiType, subscriptionId, resourceGroup, databaseAccount } = userContext; + + if (authType === AuthType.AAD && !useSDKOperations && apiType === "SQL") { const getResponse = await getSqlStoredProcedure( - userContext.subscriptionId, - userContext.resourceGroup, - userContext.databaseAccount.name, + subscriptionId, + resourceGroup, + databaseAccount.name, databaseId, collectionId, storedProcedure.id @@ -43,9 +40,9 @@ export async function updateStoredProcedure( }, }; const rpResponse = await createUpdateSqlStoredProcedure( - userContext.subscriptionId, - userContext.resourceGroup, - userContext.databaseAccount.name, + subscriptionId, + resourceGroup, + databaseAccount.name, databaseId, collectionId, storedProcedure.id, diff --git a/src/Common/dataAccess/updateTrigger.ts b/src/Common/dataAccess/updateTrigger.ts index 3a3040695..6d5afb4be 100644 --- a/src/Common/dataAccess/updateTrigger.ts +++ b/src/Common/dataAccess/updateTrigger.ts @@ -1,32 +1,25 @@ -import { AuthType } from "../../AuthType"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; -import { - SqlTriggerCreateUpdateParameters, - SqlTriggerResource, -} from "../../Utils/arm/generatedClients/2020-04-01/types"; import { TriggerDefinition } from "@azure/cosmos"; -import { client } from "../CosmosClient"; -import { createUpdateSqlTrigger, getSqlTrigger } from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { handleError } from "../ErrorHandlingUtils"; -import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; +import { AuthType } from "../../AuthType"; import { userContext } from "../../UserContext"; +import { createUpdateSqlTrigger, getSqlTrigger } from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { SqlTriggerCreateUpdateParameters, SqlTriggerResource } from "../../Utils/arm/generatedClients/cosmos/types"; +import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; +import { client } from "../CosmosClient"; +import { handleError } from "../ErrorHandlingUtils"; export async function updateTrigger( databaseId: string, collectionId: string, - trigger: TriggerDefinition -): Promise { + trigger: SqlTriggerResource +): Promise { const clearMessage = logConsoleProgress(`Updating trigger ${trigger.id}`); + const { authType, useSDKOperations, apiType, subscriptionId, resourceGroup, databaseAccount } = userContext; try { - if ( - userContext.authType === AuthType.AAD && - !userContext.useSDKOperations && - userContext.defaultExperience === DefaultAccountExperienceType.DocumentDB - ) { + if (authType === AuthType.AAD && !useSDKOperations && apiType === "SQL") { const getResponse = await getSqlTrigger( - userContext.subscriptionId, - userContext.resourceGroup, - userContext.databaseAccount.name, + subscriptionId, + resourceGroup, + databaseAccount.name, databaseId, collectionId, trigger.id @@ -35,20 +28,20 @@ export async function updateTrigger( if (getResponse?.properties?.resource) { const createTriggerParams: SqlTriggerCreateUpdateParameters = { properties: { - resource: trigger as SqlTriggerResource, + resource: trigger, options: {}, }, }; const rpResponse = await createUpdateSqlTrigger( - userContext.subscriptionId, - userContext.resourceGroup, - userContext.databaseAccount.name, + subscriptionId, + resourceGroup, + databaseAccount.name, databaseId, collectionId, trigger.id, createTriggerParams ); - return rpResponse && (rpResponse.properties?.resource as TriggerDefinition); + return rpResponse && rpResponse.properties?.resource; } throw new Error(`Failed to update trigger: ${trigger.id} does not exist.`); @@ -58,7 +51,7 @@ export async function updateTrigger( .database(databaseId) .container(collectionId) .scripts.trigger(trigger.id) - .replace(trigger); + .replace((trigger as unknown) as TriggerDefinition); // TODO: TypeScript does not like the SQL SDK trigger type return response?.resource; } catch (error) { handleError(error, "UpdateTrigger", `Error while updating trigger ${trigger.id}`); diff --git a/src/Common/dataAccess/updateUserDefinedFunction.ts b/src/Common/dataAccess/updateUserDefinedFunction.ts index 59e01c970..f3b28bf51 100644 --- a/src/Common/dataAccess/updateUserDefinedFunction.ts +++ b/src/Common/dataAccess/updateUserDefinedFunction.ts @@ -1,18 +1,17 @@ -import { AuthType } from "../../AuthType"; -import { DefaultAccountExperienceType } from "../../DefaultAccountExperienceType"; import { Resource, UserDefinedFunctionDefinition } from "@azure/cosmos"; -import { - SqlUserDefinedFunctionCreateUpdateParameters, - SqlUserDefinedFunctionResource, -} from "../../Utils/arm/generatedClients/2020-04-01/types"; -import { client } from "../CosmosClient"; +import { AuthType } from "../../AuthType"; +import { userContext } from "../../UserContext"; import { createUpdateSqlUserDefinedFunction, getSqlUserDefinedFunction, -} from "../../Utils/arm/generatedClients/2020-04-01/sqlResources"; -import { handleError } from "../ErrorHandlingUtils"; +} from "../../Utils/arm/generatedClients/cosmos/sqlResources"; +import { + SqlUserDefinedFunctionCreateUpdateParameters, + SqlUserDefinedFunctionResource, +} from "../../Utils/arm/generatedClients/cosmos/types"; import { logConsoleProgress } from "../../Utils/NotificationConsoleUtils"; -import { userContext } from "../../UserContext"; +import { client } from "../CosmosClient"; +import { handleError } from "../ErrorHandlingUtils"; export async function updateUserDefinedFunction( databaseId: string, @@ -20,16 +19,13 @@ export async function updateUserDefinedFunction( userDefinedFunction: UserDefinedFunctionDefinition ): Promise { const clearMessage = logConsoleProgress(`Updating user defined function ${userDefinedFunction.id}`); + const { authType, useSDKOperations, apiType, subscriptionId, resourceGroup, databaseAccount } = userContext; try { - if ( - userContext.authType === AuthType.AAD && - !userContext.useSDKOperations && - userContext.defaultExperience === DefaultAccountExperienceType.DocumentDB - ) { + if (authType === AuthType.AAD && !useSDKOperations && apiType === "SQL") { const getResponse = await getSqlUserDefinedFunction( - userContext.subscriptionId, - userContext.resourceGroup, - userContext.databaseAccount.name, + subscriptionId, + resourceGroup, + databaseAccount.name, databaseId, collectionId, userDefinedFunction.id @@ -43,9 +39,9 @@ export async function updateUserDefinedFunction( }, }; const rpResponse = await createUpdateSqlUserDefinedFunction( - userContext.subscriptionId, - userContext.resourceGroup, - userContext.databaseAccount.name, + subscriptionId, + resourceGroup, + databaseAccount.name, databaseId, collectionId, userDefinedFunction.id, diff --git a/src/ConfigContext.ts b/src/ConfigContext.ts index 654928c6b..289e650cb 100644 --- a/src/ConfigContext.ts +++ b/src/ConfigContext.ts @@ -26,6 +26,8 @@ export interface ConfigContext { GITHUB_CLIENT_SECRET?: string; // No need to inject secret for prod. Juno already knows it. hostedExplorerURL: string; armAPIVersion?: string; + allowedJunoOrigins: string[]; + msalRedirectURI?: string; } // Default configuration @@ -53,6 +55,13 @@ let configContext: Readonly = { GITHUB_CLIENT_ID: "6cb2f63cf6f7b5cbdeca", // Registered OAuth app: https://github.com/settings/applications/1189306 JUNO_ENDPOINT: "https://tools.cosmos.azure.com", BACKEND_ENDPOINT: "https://main.documentdb.ext.azure.com", + allowedJunoOrigins: [ + "https://juno-test.documents-dev.windows-int.net", + "https://juno-test2.documents-dev.windows-int.net", + "https://tools.cosmos.azure.com", + "https://tools-staging.cosmos.azure.com", + "https://localhost", + ], }; export function resetConfigContext(): void { @@ -86,13 +95,18 @@ export async function initializeConfiguration(): Promise { }); if (response.status === 200) { try { - const { allowedParentFrameOrigins, ...externalConfig } = await response.json(); + const { allowedParentFrameOrigins, allowedJunoOrigins, ...externalConfig } = await response.json(); Object.assign(configContext, externalConfig); if (allowedParentFrameOrigins && allowedParentFrameOrigins.length > 0) { updateConfigContext({ allowedParentFrameOrigins: [...configContext.allowedParentFrameOrigins, ...allowedParentFrameOrigins], }); } + if (allowedJunoOrigins && allowedJunoOrigins.length > 0) { + updateConfigContext({ + allowedJunoOrigins: [...configContext.allowedJunoOrigins, ...allowedJunoOrigins], + }); + } } catch (error) { console.error("Unable to parse json in config file"); console.error(error); @@ -104,6 +118,14 @@ export async function initializeConfiguration(): Promise { const armAPIVersion = params.get("armAPIVersion") || ""; updateConfigContext({ armAPIVersion }); } + if (params.has("armEndpoint")) { + const ARM_ENDPOINT = params.get("armEndpoint") || ""; + updateConfigContext({ ARM_ENDPOINT }); + } + if (params.has("aadEndpoint")) { + const AAD_ENDPOINT = params.get("aadEndpoint") || ""; + updateConfigContext({ AAD_ENDPOINT }); + } if (params.has("platform")) { const platform = params.get("platform"); switch (platform) { diff --git a/src/Contracts/ActionContracts.ts b/src/Contracts/ActionContracts.ts index dac45dbe0..f8fc956e6 100644 --- a/src/Contracts/ActionContracts.ts +++ b/src/Contracts/ActionContracts.ts @@ -4,6 +4,7 @@ export enum TabKind { SQLDocuments, MongoDocuments, + SchemaAnalyzer, TableEntities, Graph, SQLQuery, diff --git a/src/Contracts/DataModels.ts b/src/Contracts/DataModels.ts index 39d758ec9..efd5ffb78 100644 --- a/src/Contracts/DataModels.ts +++ b/src/Contracts/DataModels.ts @@ -4,15 +4,15 @@ export interface DatabaseAccount { location: string; type: string; kind: string; - tags: any; properties: DatabaseAccountExtendedProperties; } export interface DatabaseAccountExtendedProperties { - documentEndpoint: string; - tableEndpoint: string; - gremlinEndpoint: string; - cassandraEndpoint: string; + documentEndpoint?: string; + disableLocalAuth?: boolean; + tableEndpoint?: string; + gremlinEndpoint?: string; + cassandraEndpoint?: string; configurationOverrides?: ConfigurationOverrides; capabilities?: Capability[]; enableMultipleWriteLocations?: boolean; @@ -21,6 +21,9 @@ export interface DatabaseAccountExtendedProperties { writeLocations?: DatabaseAccountResponseLocation[]; enableFreeTier?: boolean; enableAnalyticalStorage?: boolean; + isVirtualNetworkFilterEnabled?: boolean; + ipRules?: IpRule[]; + privateEndpointConnections?: unknown[]; } export interface DatabaseAccountResponseLocation { @@ -32,6 +35,10 @@ export interface DatabaseAccountResponseLocation { provisioningState: string; } +export interface IpRule { + ipAddressOrRange: string; +} + export interface ConfigurationOverrides { EnableBsonSchema: string; } @@ -121,6 +128,10 @@ export interface ISchemaRequest { } export interface Collection extends Resource { + // Only in Mongo collections loaded via ARM + shardKey?: { + [key: string]: string; + }; defaultTtl?: number; indexingPolicy?: IndexingPolicy; partitionKey?: PartitionKey; @@ -158,7 +169,7 @@ export interface KeyResource { export interface IndexingPolicy { automatic: boolean; - indexingMode: string; + indexingMode: "consistent" | "lazy" | "none"; includedPaths: any; excludedPaths: any; compositeIndexes?: any; @@ -167,7 +178,7 @@ export interface IndexingPolicy { export interface PartitionKey { paths: string[]; - kind: string; + kind: "Hash" | "Range" | "MultiHash"; version: number; systemKey?: boolean; } @@ -382,16 +393,6 @@ export interface GeospatialConfig { type: string; } -export interface GatewayDatabaseAccount { - MediaLink: string; - DatabasesLink: string; - MaxMediaStorageUsageInMB: number; - CurrentMediaStorageUsageInMB: number; - EnableMultipleWriteLocations?: boolean; - WritableLocations: RegionEndpoint[]; - ReadableLocations: RegionEndpoint[]; -} - export interface RegionEndpoint { name: string; documentAccountEndpoint: string; @@ -412,13 +413,6 @@ export interface AccountKeys { secondaryReadonlyMasterKey: string; } -export interface AfecFeature { - id: string; - name: string; - properties: { state: string }; - type: string; -} - export interface OperationStatus { status: string; id?: string; @@ -498,91 +492,6 @@ export interface MongoParameters extends RpParameters { analyticalStorageTtl?: number; } -export interface SparkClusterLibrary { - name: string; -} - -export interface Library extends SparkClusterLibrary { - properties: { - kind: "Jar"; - source: { - kind: "HttpsUri"; - uri: string; - libraryFileName: string; - }; - }; -} - -export interface LibraryFeedResponse { - value: Library[]; -} - -export interface ArmResource { - id: string; - location: string; - name: string; - type: string; - tags: { [key: string]: string }; -} - -export interface ArcadiaWorkspaceIdentity { - type: string; - principalId: string; - tenantId: string; -} - -export interface ArcadiaWorkspaceProperties { - managedResourceGroupName: string; - provisioningState: string; - sqlAdministratorLogin: string; - connectivityEndpoints: { - artifacts: string; - dev: string; - spark: string; - sql: string; - web: string; - }; - defaultDataLakeStorage: { - accountUrl: string; - filesystem: string; - }; -} - -export interface ArcadiaWorkspaceFeedResponse { - value: ArcadiaWorkspace[]; -} - -export interface ArcadiaWorkspace extends ArmResource { - identity: ArcadiaWorkspaceIdentity; - properties: ArcadiaWorkspaceProperties; -} - -export interface SparkPoolFeedResponse { - value: SparkPool[]; -} - -export interface SparkPoolProperties { - creationDate: string; - sparkVersion: string; - nodeCount: number; - nodeSize: string; - nodeSizeFamily: string; - provisioningState: string; - autoScale: { - enabled: boolean; - minNodeCount: number; - maxNodeCount: number; - }; - autoPause: { - enabled: boolean; - delayInMinutes: number; - }; -} - -export interface SparkPool extends ArmResource { - properties: SparkPoolProperties; -} - export interface MemoryUsageInfo { freeKB: number; totalKB: number; diff --git a/src/Contracts/ExplorerContracts.ts b/src/Contracts/ExplorerContracts.ts index 1689a96b5..d1c3dba58 100644 --- a/src/Contracts/ExplorerContracts.ts +++ b/src/Contracts/ExplorerContracts.ts @@ -1,6 +1,6 @@ -import * as Versions from "./Versions"; import * as ActionContracts from "./ActionContracts"; import * as Diagnostics from "./Diagnostics"; +import * as Versions from "./Versions"; /** * Messaging types used with Data Explorer <-> Portal communication diff --git a/src/Contracts/SelfServeContracts.ts b/src/Contracts/SelfServeContracts.ts new file mode 100644 index 000000000..942aa3dab --- /dev/null +++ b/src/Contracts/SelfServeContracts.ts @@ -0,0 +1,9 @@ +/** + * Messaging types used with SelfServe Component <-> Portal communication + * and Hosted <-> SelfServe Component communication + */ + +export enum SelfServeMessageTypes { + TelemetryInfo = "TelemetryInfo", + Notification = "Notification", +} diff --git a/src/Contracts/ViewModels.ts b/src/Contracts/ViewModels.ts index bdb5116fd..210d34075 100644 --- a/src/Contracts/ViewModels.ts +++ b/src/Contracts/ViewModels.ts @@ -5,9 +5,8 @@ import { TriggerDefinition, UserDefinedFunctionDefinition, } from "@azure/cosmos"; -import { CommandButtonComponentProps } from "../Explorer/Controls/CommandButton/CommandButtonComponent"; import Explorer from "../Explorer/Explorer"; -import { ConsoleData } from "../Explorer/Menus/NotificationConsole/NotificationConsoleComponent"; +import { ConsoleData } from "../Explorer/Menus/NotificationConsole/ConsoleData"; import { CassandraTableKey, CassandraTableKeys } from "../Explorer/Tables/TableDataClient"; import ConflictId from "../Explorer/Tree/ConflictId"; import DocumentId from "../Explorer/Tree/DocumentId"; @@ -15,7 +14,8 @@ import StoredProcedure from "../Explorer/Tree/StoredProcedure"; import Trigger from "../Explorer/Tree/Trigger"; import UserDefinedFunction from "../Explorer/Tree/UserDefinedFunction"; import { SelfServeType } from "../SelfServe/SelfServeUtils"; -import { UploadDetails } from "../workers/upload/definitions"; +import { CollectionCreationDefaults } from "../UserContext"; +import { SqlTriggerResource } from "../Utils/arm/generatedClients/cosmos/types"; import * as DataModels from "./DataModels"; import { SubscriptionType } from "./SubscriptionType"; @@ -23,6 +23,14 @@ export interface TokenProvider { getAuthHeader(): Promise; } +export interface UploadDetailsRecord { + fileName: string; + numSucceeded: number; + numFailed: number; + numThrottled: number; + errors: string[]; +} + export interface QueryResultsMetadata { hasMoreResults: boolean; firstItemIndex: number; @@ -81,14 +89,12 @@ export interface Database extends TreeNode { selectedSubnodeKind: ko.Observable; - selectDatabase(): void; expandDatabase(): Promise; collapseDatabase(): void; loadCollections(): Promise; findCollectionWithId(collectionId: string): Collection; openAddCollection(database: Database, event: MouseEvent): void; - onDeleteDatabaseContextMenuClick(source: Database, event: MouseEvent | KeyboardEvent): void; onSettingsClick: () => void; loadOffer(): Promise; getPendingThroughputSplitNotification(): Promise; @@ -135,6 +141,7 @@ export interface Collection extends CollectionBase { onTableEntitiesClick(): void; onGraphDocumentsClick(): void; onMongoDBDocumentsClick(): void; + onSchemaAnalyzerClick(): void; openTab(): void; onSettingsClick: () => Promise; @@ -168,14 +175,14 @@ export interface Collection extends CollectionBase { createStoredProcedureNode(data: StoredProcedureDefinition & Resource): StoredProcedure; createUserDefinedFunctionNode(data: UserDefinedFunctionDefinition & Resource): UserDefinedFunction; - createTriggerNode(data: TriggerDefinition & Resource): Trigger; + createTriggerNode(data: TriggerDefinition | SqlTriggerResource): Trigger; findStoredProcedureWithId(sprocRid: string): StoredProcedure; findTriggerWithId(triggerRid: string): Trigger; findUserDefinedFunctionWithId(udfRid: string): UserDefinedFunction; onDragOver(source: Collection, event: { originalEvent: DragEvent }): void; onDrop(source: Collection, event: { originalEvent: DragEvent }): void; - uploadFiles(fileList: FileList): Promise; + uploadFiles(fileList: FileList): Promise<{ data: UploadDetailsRecord[] }>; getLabel(): string; getPendingThroughputSplitNotification(): Promise; @@ -199,17 +206,14 @@ export enum NeighborType { BOTH, } -/** - * Set of observable related to graph configuration by user - */ -export interface GraphConfigUiData { - showNeighborType: ko.Observable; - nodeProperties: ko.ObservableArray; - nodePropertiesWithNone: ko.ObservableArray; - nodeCaptionChoice: ko.Observable; - nodeColorKeyChoice: ko.Observable; - nodeIconChoice: ko.Observable; - nodeIconSet: ko.Observable; +export interface IGraphConfigUiData { + showNeighborType: NeighborType; + nodeProperties: string[]; + nodePropertiesWithNone: string[]; + nodeCaptionChoice: string; + nodeColorKeyChoice: string; + nodeIconChoice: string; + nodeIconSet: string; } /** @@ -270,9 +274,6 @@ export interface TabOptions { tabKind: CollectionTabKind; title: string; tabPath: string; - isActive: ko.Observable; - hashLocation: string; - onUpdateTabsButtons: (buttons: CommandButtonComponentProps[]) => void; isTabsContentExpanded?: ko.Observable; onLoadStartKey?: number; @@ -283,6 +284,7 @@ export interface TabOptions { rid?: string; node?: TreeNode; theme?: string; + index?: number; } export interface DocumentsTabOptions extends TabOptions { @@ -361,6 +363,7 @@ export enum CollectionTabKind { Schema = 19, CollectionSettingsV2 = 20, DatabaseSettingsV2 = 21, + SchemaAnalyzer = 22, } export enum TerminalKind { @@ -376,7 +379,6 @@ export interface DataExplorerInputsFrame { masterKey?: string; hasWriteAccess?: boolean; authorizationToken?: string; - features: { [key: string]: string }; csmEndpoint?: string; dnsSuffix?: string; serverId?: string; @@ -390,29 +392,21 @@ export interface DataExplorerInputsFrame { sharedThroughputMaximum?: number; sharedThroughputDefault?: number; dataExplorerVersion?: string; - isAuthWithresourceToken?: boolean; defaultCollectionThroughput?: CollectionCreationDefaults; flights?: readonly string[]; - selfServeType?: SelfServeType; + features?: { + [key: string]: string; + }; } -export interface CollectionCreationDefaults { - storage: string; - throughput: ThroughputDefaults; -} - -export interface ThroughputDefaults { - fixed: number; - unlimited: - | number - | { - collectionThreshold: number; - lessThanOrEqualToThreshold: number; - greatThanThreshold: number; - }; - unlimitedmax: number; - unlimitedmin: number; - shared: number; +export interface SelfServeFrameInputs { + selfServeType: SelfServeType; + databaseAccount: any; + subscriptionId: string; + resourceGroup: string; + authorizationToken: string; + csmEndpoint: string; + flights?: readonly string[]; } export class MonacoEditorSettings { diff --git a/src/Controls/Heatmap/Heatmap.ts b/src/Controls/Heatmap/Heatmap.ts index aad6cd38a..3cdc4589d 100644 --- a/src/Controls/Heatmap/Heatmap.ts +++ b/src/Controls/Heatmap/Heatmap.ts @@ -1,5 +1,10 @@ -import * as Plotly from "plotly.js-cartesian-dist-min"; import dayjs from "dayjs"; +import * as Plotly from "plotly.js-cartesian-dist-min"; +import { StyleConstants } from "../../Common/Constants"; +import { sendCachedDataMessage, sendReadyMessage } from "../../Common/MessageHandler"; +import { MessageTypes } from "../../Contracts/ExplorerContracts"; +import { isInvalidParentFrameOrigin } from "../../Utils/MessageValidation"; +import "./Heatmap.less"; import { ChartSettings, DataPayload, @@ -11,11 +16,6 @@ import { PartitionTimeStampToData, PortalTheme, } from "./HeatmapDatatypes"; -import { isInvalidParentFrameOrigin } from "../../Utils/MessageValidation"; -import { sendCachedDataMessage, sendMessage } from "../../Common/MessageHandler"; -import { MessageTypes } from "../../Contracts/ExplorerContracts"; -import { StyleConstants } from "../../Common/Constants"; -import "./Heatmap.less"; export class Heatmap { public static readonly elementId: string = "heatmap"; @@ -266,4 +266,4 @@ export function handleMessage(event: MessageEvent) { } window.addEventListener("message", handleMessage, false); -sendMessage("ready"); +sendReadyMessage(); diff --git a/src/DefaultAccountExperienceType.ts b/src/DefaultAccountExperienceType.ts deleted file mode 100644 index 19a5d0f13..000000000 --- a/src/DefaultAccountExperienceType.ts +++ /dev/null @@ -1,8 +0,0 @@ -export enum DefaultAccountExperienceType { - DocumentDB = "DocumentDB", - Graph = "Graph", - MongoDB = "MongoDB", - Table = "Table", - Cassandra = "Cassandra", - ApiForMongoDB = "Azure Cosmos DB for MongoDB API", -} diff --git a/src/Definitions/worker.d.ts b/src/Definitions/worker.d.ts deleted file mode 100644 index 6a93b9569..000000000 --- a/src/Definitions/worker.d.ts +++ /dev/null @@ -1,7 +0,0 @@ -declare module "worker-loader!*" { - class WebpackWorker extends Worker { - constructor(); - } - - export default WebpackWorker; -} diff --git a/src/Explorer/ComponentRegisterer.test.ts b/src/Explorer/ComponentRegisterer.test.ts deleted file mode 100644 index 4820c2357..000000000 --- a/src/Explorer/ComponentRegisterer.test.ts +++ /dev/null @@ -1,115 +0,0 @@ -jest.mock("monaco-editor"); - -import * as ko from "knockout"; -import "./ComponentRegisterer"; - -describe("Component Registerer", () => { - it("should register input-typeahead component", () => { - expect(ko.components.isRegistered("input-typeahead")).toBe(true); - }); - - it("should register new-vertex-form component", () => { - expect(ko.components.isRegistered("new-vertex-form")).toBe(true); - }); - - it("should register error-display component", () => { - expect(ko.components.isRegistered("error-display")).toBe(true); - }); - - it("should register graph-style component", () => { - expect(ko.components.isRegistered("graph-style")).toBe(true); - }); - - it("should register json-editor component", () => { - expect(ko.components.isRegistered("json-editor")).toBe(true); - }); - - it("should register documents-tab component", () => { - expect(ko.components.isRegistered("documents-tab")).toBe(true); - }); - - it("should register stored-procedure-tab component", () => { - expect(ko.components.isRegistered("stored-procedure-tab")).toBe(true); - }); - - it("should register trigger-tab component", () => { - expect(ko.components.isRegistered("trigger-tab")).toBe(true); - }); - - it("should register user-defined-function-tab component", () => { - expect(ko.components.isRegistered("user-defined-function-tab")).toBe(true); - }); - - it("should register settings-tab-v2 component", () => { - expect(ko.components.isRegistered("database-settings-tab-v2")).toBe(true); - expect(ko.components.isRegistered("collection-settings-tab-v2")).toBe(true); - }); - - it("should register query-tab component", () => { - expect(ko.components.isRegistered("query-tab")).toBe(true); - }); - - it("should register tables-query-tab component", () => { - expect(ko.components.isRegistered("tables-query-tab")).toBe(true); - }); - - it("should register graph-tab component", () => { - expect(ko.components.isRegistered("graph-tab")).toBe(true); - }); - - it("should register notebookv2-tab component", () => { - expect(ko.components.isRegistered("notebookv2-tab")).toBe(true); - }); - - it("should register terminal-tab component", () => { - expect(ko.components.isRegistered("terminal-tab")).toBe(true); - }); - - it("should register mongo-shell-tab component", () => { - expect(ko.components.isRegistered("mongo-shell-tab")).toBe(true); - }); - - it("should registeradd-collection-pane component", () => { - expect(ko.components.isRegistered("add-collection-pane")).toBe(true); - }); - - it("should register delete-collection-confirmation-pane component", () => { - expect(ko.components.isRegistered("delete-collection-confirmation-pane")).toBe(true); - }); - - it("should register delete-database-confirmation-pane component", () => { - expect(ko.components.isRegistered("delete-database-confirmation-pane")).toBe(true); - }); - - it("should register save-query-pane component", () => { - expect(ko.components.isRegistered("save-query-pane")).toBe(true); - }); - - it("should register browse-queries-pane component", () => { - expect(ko.components.isRegistered("browse-queries-pane")).toBe(true); - }); - - it("should register graph-new-vertex-pane component", () => { - expect(ko.components.isRegistered("graph-new-vertex-pane")).toBe(true); - }); - - it("should register graph-styling-pane component", () => { - expect(ko.components.isRegistered("graph-styling-pane")).toBe(true); - }); - - it("should register upload-file-pane component", () => { - expect(ko.components.isRegistered("upload-file-pane")).toBe(true); - }); - - it("should register string-input-pane component", () => { - expect(ko.components.isRegistered("string-input-pane")).toBe(true); - }); - - it("should register setup-notebooks-pane component", () => { - expect(ko.components.isRegistered("setup-notebooks-pane")).toBe(true); - }); - - it("should register dynamic-list component", () => { - expect(ko.components.isRegistered("dynamic-list")).toBe(true); - }); -}); diff --git a/src/Explorer/ComponentRegisterer.ts b/src/Explorer/ComponentRegisterer.ts index b02c485e8..a58bd38a5 100644 --- a/src/Explorer/ComponentRegisterer.ts +++ b/src/Explorer/ComponentRegisterer.ts @@ -1,74 +1,8 @@ import * as ko from "knockout"; -import * as PaneComponents from "./Panes/PaneComponents"; -import * as TabComponents from "./Tabs/TabComponents"; import { DiffEditorComponent } from "./Controls/DiffEditor/DiffEditorComponent"; -import { DynamicListComponent } from "./Controls/DynamicList/DynamicListComponent"; import { EditorComponent } from "./Controls/Editor/EditorComponent"; -import { ErrorDisplayComponent } from "./Controls/ErrorDisplayComponent/ErrorDisplayComponent"; -import { GraphStyleComponent } from "./Graph/GraphStyleComponent/GraphStyleComponent"; -import { InputTypeaheadComponent } from "./Controls/InputTypeahead/InputTypeahead"; import { JsonEditorComponent } from "./Controls/JsonEditor/JsonEditorComponent"; -import { NewVertexComponent } from "./Graph/NewVertexComponent/NewVertexComponent"; -import { TabsManagerKOComponent } from "./Tabs/TabsManager"; -import { ThroughputInputComponentAutoPilotV3 } from "./Controls/ThroughputInput/ThroughputInputComponentAutoPilotV3"; -ko.components.register("input-typeahead", new InputTypeaheadComponent()); -ko.components.register("new-vertex-form", NewVertexComponent); -ko.components.register("error-display", new ErrorDisplayComponent()); -ko.components.register("graph-style", GraphStyleComponent); ko.components.register("editor", new EditorComponent()); ko.components.register("json-editor", new JsonEditorComponent()); ko.components.register("diff-editor", new DiffEditorComponent()); -ko.components.register("dynamic-list", DynamicListComponent); -ko.components.register("throughput-input-autopilot-v3", ThroughputInputComponentAutoPilotV3); -ko.components.register("tabs-manager", TabsManagerKOComponent()); - -// Collection Tabs -ko.components.register("documents-tab", new TabComponents.DocumentsTab()); -ko.components.register("mongo-documents-tab", new TabComponents.MongoDocumentsTab()); -ko.components.register("stored-procedure-tab", new TabComponents.StoredProcedureTab()); -ko.components.register("trigger-tab", new TabComponents.TriggerTab()); -ko.components.register("user-defined-function-tab", new TabComponents.UserDefinedFunctionTab()); -ko.components.register("collection-settings-tab-v2", new TabComponents.SettingsTabV2()); -ko.components.register("query-tab", new TabComponents.QueryTab()); -ko.components.register("tables-query-tab", new TabComponents.QueryTablesTab()); -ko.components.register("graph-tab", new TabComponents.GraphTab()); -ko.components.register("mongo-shell-tab", new TabComponents.MongoShellTab()); -ko.components.register("conflicts-tab", new TabComponents.ConflictsTab()); -ko.components.register("notebookv2-tab", new TabComponents.NotebookV2Tab()); -ko.components.register("terminal-tab", new TabComponents.TerminalTab()); -ko.components.register("gallery-tab", new TabComponents.GalleryTab()); -ko.components.register("notebook-viewer-tab", new TabComponents.NotebookViewerTab()); - -// Database Tabs -ko.components.register("database-settings-tab", new TabComponents.DatabaseSettingsTab()); -ko.components.register("database-settings-tab-v2", new TabComponents.SettingsTabV2()); - -// Panes -ko.components.register("add-database-pane", new PaneComponents.AddDatabasePaneComponent()); -ko.components.register("add-collection-pane", new PaneComponents.AddCollectionPaneComponent()); -ko.components.register( - "delete-collection-confirmation-pane", - new PaneComponents.DeleteCollectionConfirmationPaneComponent() -); -ko.components.register( - "delete-database-confirmation-pane", - new PaneComponents.DeleteDatabaseConfirmationPaneComponent() -); -ko.components.register("graph-new-vertex-pane", new PaneComponents.GraphNewVertexPaneComponent()); -ko.components.register("graph-styling-pane", new PaneComponents.GraphStylingPaneComponent()); -ko.components.register("table-add-entity-pane", new PaneComponents.TableAddEntityPaneComponent()); -ko.components.register("table-edit-entity-pane", new PaneComponents.TableEditEntityPaneComponent()); -ko.components.register("table-column-options-pane", new PaneComponents.TableColumnOptionsPaneComponent()); -ko.components.register("table-query-select-pane", new PaneComponents.TableQuerySelectPaneComponent()); -ko.components.register("cassandra-add-collection-pane", new PaneComponents.CassandraAddCollectionPaneComponent()); -ko.components.register("settings-pane", new PaneComponents.SettingsPaneComponent()); -ko.components.register("execute-sproc-params-pane", new PaneComponents.ExecuteSprocParamsComponent()); -ko.components.register("upload-items-pane", new PaneComponents.UploadItemsPaneComponent()); -ko.components.register("load-query-pane", new PaneComponents.LoadQueryPaneComponent()); -ko.components.register("save-query-pane", new PaneComponents.SaveQueryPaneComponent()); -ko.components.register("browse-queries-pane", new PaneComponents.BrowseQueriesPaneComponent()); -ko.components.register("upload-file-pane", new PaneComponents.UploadFilePaneComponent()); -ko.components.register("string-input-pane", new PaneComponents.StringInputPaneComponent()); -ko.components.register("setup-notebooks-pane", new PaneComponents.SetupNotebooksPaneComponent()); -ko.components.register("github-repos-pane", new PaneComponents.GitHubReposPaneComponent()); diff --git a/src/Explorer/ContextMenuButtonFactory.ts b/src/Explorer/ContextMenuButtonFactory.ts deleted file mode 100644 index 53dfe9370..000000000 --- a/src/Explorer/ContextMenuButtonFactory.ts +++ /dev/null @@ -1,170 +0,0 @@ -import * as ko from "knockout"; -import * as ViewModels from "../Contracts/ViewModels"; -import { TreeNodeMenuItem } from "./Controls/TreeComponent/TreeComponent"; -import AddCollectionIcon from "../../images/AddCollection.svg"; -import AddSqlQueryIcon from "../../images/AddSqlQuery_16x16.svg"; -import HostedTerminalIcon from "../../images/Hosted-Terminal.svg"; -import AddStoredProcedureIcon from "../../images/AddStoredProcedure.svg"; -import DeleteCollectionIcon from "../../images/DeleteCollection.svg"; -import DeleteDatabaseIcon from "../../images/DeleteDatabase.svg"; -import AddUdfIcon from "../../images/AddUdf.svg"; -import AddTriggerIcon from "../../images/AddTrigger.svg"; -import DeleteTriggerIcon from "../../images/DeleteTrigger.svg"; -import DeleteUDFIcon from "../../images/DeleteUDF.svg"; -import DeleteSprocIcon from "../../images/DeleteSproc.svg"; -import Explorer from "./Explorer"; -import UserDefinedFunction from "./Tree/UserDefinedFunction"; -import StoredProcedure from "./Tree/StoredProcedure"; -import Trigger from "./Tree/Trigger"; -import { userContext } from "../UserContext"; -import { DefaultAccountExperienceType } from "../DefaultAccountExperienceType"; - -export interface CollectionContextMenuButtonParams { - databaseId: string; - collectionId: string; -} - -export interface DatabaseContextMenuButtonParams { - databaseId: string; -} -/** - * New resource tree (in ReactJS) - */ -export class ResourceTreeContextMenuButtonFactory { - public static createDatabaseContextMenu(container: Explorer): TreeNodeMenuItem[] { - const items: TreeNodeMenuItem[] = [ - { - iconSrc: AddCollectionIcon, - onClick: () => container.onNewCollectionClicked(), - label: container.addCollectionText(), - }, - ]; - - if (userContext.defaultExperience !== DefaultAccountExperienceType.Table) { - items.push({ - iconSrc: DeleteDatabaseIcon, - onClick: () => container.deleteDatabaseConfirmationPane.open(), - label: container.deleteDatabaseText(), - styleClass: "deleteDatabaseMenuItem", - }); - } - return items; - } - - public static createCollectionContextMenuButton( - container: Explorer, - selectedCollection: ViewModels.Collection - ): TreeNodeMenuItem[] { - const items: TreeNodeMenuItem[] = []; - if (container.isPreferredApiDocumentDB() || container.isPreferredApiGraph()) { - items.push({ - iconSrc: AddSqlQueryIcon, - onClick: () => selectedCollection && selectedCollection.onNewQueryClick(selectedCollection, null), - label: "New SQL Query", - }); - } - - if (container.isPreferredApiMongoDB()) { - items.push({ - iconSrc: AddSqlQueryIcon, - onClick: () => selectedCollection && selectedCollection.onNewMongoQueryClick(selectedCollection, null), - label: "New Query", - }); - - items.push({ - iconSrc: HostedTerminalIcon, - onClick: () => { - const selectedCollection: ViewModels.Collection = container.findSelectedCollection(); - selectedCollection && selectedCollection.onNewMongoShellClick(); - }, - label: "New Shell", - }); - } - - if (container.isPreferredApiDocumentDB() || container.isPreferredApiGraph()) { - items.push({ - iconSrc: AddStoredProcedureIcon, - onClick: () => { - const selectedCollection: ViewModels.Collection = container.findSelectedCollection(); - selectedCollection && selectedCollection.onNewStoredProcedureClick(selectedCollection, null); - }, - label: "New Stored Procedure", - }); - - items.push({ - iconSrc: AddUdfIcon, - onClick: () => { - const selectedCollection: ViewModels.Collection = container.findSelectedCollection(); - selectedCollection && selectedCollection.onNewUserDefinedFunctionClick(selectedCollection, null); - }, - label: "New UDF", - }); - - items.push({ - iconSrc: AddTriggerIcon, - onClick: () => { - const selectedCollection: ViewModels.Collection = container.findSelectedCollection(); - selectedCollection && selectedCollection.onNewTriggerClick(selectedCollection, null); - }, - label: "New Trigger", - }); - } - - items.push({ - iconSrc: DeleteCollectionIcon, - onClick: () => container.openDeleteCollectionConfirmationPane(), - label: container.deleteCollectionText(), - styleClass: "deleteCollectionMenuItem", - }); - - return items; - } - - public static createStoreProcedureContextMenuItems( - container: Explorer, - storedProcedure: StoredProcedure - ): TreeNodeMenuItem[] { - if (container.isPreferredApiCassandra()) { - return []; - } - - return [ - { - iconSrc: DeleteSprocIcon, - onClick: () => storedProcedure.delete(), - label: "Delete Store Procedure", - }, - ]; - } - - public static createTriggerContextMenuItems(container: Explorer, trigger: Trigger): TreeNodeMenuItem[] { - if (container.isPreferredApiCassandra()) { - return []; - } - - return [ - { - iconSrc: DeleteTriggerIcon, - onClick: () => trigger.delete(), - label: "Delete Trigger", - }, - ]; - } - - public static createUserDefinedFunctionContextMenuItems( - container: Explorer, - userDefinedFunction: UserDefinedFunction - ): TreeNodeMenuItem[] { - if (container.isPreferredApiCassandra()) { - return []; - } - - return [ - { - iconSrc: DeleteUDFIcon, - onClick: () => userDefinedFunction.delete(), - label: "Delete User Defined Function", - }, - ]; - } -} diff --git a/src/Explorer/ContextMenuButtonFactory.tsx b/src/Explorer/ContextMenuButtonFactory.tsx new file mode 100644 index 000000000..70d02e5aa --- /dev/null +++ b/src/Explorer/ContextMenuButtonFactory.tsx @@ -0,0 +1,189 @@ +import React from "react"; +import AddCollectionIcon from "../../images/AddCollection.svg"; +import AddSqlQueryIcon from "../../images/AddSqlQuery_16x16.svg"; +import AddStoredProcedureIcon from "../../images/AddStoredProcedure.svg"; +import AddTriggerIcon from "../../images/AddTrigger.svg"; +import AddUdfIcon from "../../images/AddUdf.svg"; +import DeleteCollectionIcon from "../../images/DeleteCollection.svg"; +import DeleteDatabaseIcon from "../../images/DeleteDatabase.svg"; +import DeleteSprocIcon from "../../images/DeleteSproc.svg"; +import DeleteTriggerIcon from "../../images/DeleteTrigger.svg"; +import DeleteUDFIcon from "../../images/DeleteUDF.svg"; +import HostedTerminalIcon from "../../images/Hosted-Terminal.svg"; +import * as ViewModels from "../Contracts/ViewModels"; +import { useSidePanel } from "../hooks/useSidePanel"; +import { userContext } from "../UserContext"; +import { getCollectionName, getDatabaseName } from "../Utils/APITypeUtils"; +import { TreeNodeMenuItem } from "./Controls/TreeComponent/TreeComponent"; +import Explorer from "./Explorer"; +import { useNotebook } from "./Notebook/useNotebook"; +import { DeleteCollectionConfirmationPane } from "./Panes/DeleteCollectionConfirmationPane/DeleteCollectionConfirmationPane"; +import { DeleteDatabaseConfirmationPanel } from "./Panes/DeleteDatabaseConfirmationPanel"; +import StoredProcedure from "./Tree/StoredProcedure"; +import Trigger from "./Tree/Trigger"; +import UserDefinedFunction from "./Tree/UserDefinedFunction"; +import { useSelectedNode } from "./useSelectedNode"; + +export interface CollectionContextMenuButtonParams { + databaseId: string; + collectionId: string; +} + +export interface DatabaseContextMenuButtonParams { + databaseId: string; +} +/** + * New resource tree (in ReactJS) + */ +export const createDatabaseContextMenu = (container: Explorer, databaseId: string): TreeNodeMenuItem[] => { + const items: TreeNodeMenuItem[] = [ + { + iconSrc: AddCollectionIcon, + onClick: () => container.onNewCollectionClicked(databaseId), + label: `New ${getCollectionName()}`, + }, + ]; + + if (userContext.apiType !== "Tables") { + items.push({ + iconSrc: DeleteDatabaseIcon, + onClick: () => + useSidePanel + .getState() + .openSidePanel( + "Delete " + getDatabaseName(), + container.refreshAllDatabases()} /> + ), + label: `Delete ${getDatabaseName()}`, + styleClass: "deleteDatabaseMenuItem", + }); + } + return items; +}; + +export const createCollectionContextMenuButton = ( + container: Explorer, + selectedCollection: ViewModels.Collection +): TreeNodeMenuItem[] => { + const items: TreeNodeMenuItem[] = []; + if (userContext.apiType === "SQL" || userContext.apiType === "Gremlin") { + items.push({ + iconSrc: AddSqlQueryIcon, + onClick: () => selectedCollection && selectedCollection.onNewQueryClick(selectedCollection, undefined), + label: "New SQL Query", + }); + } + + if (userContext.apiType === "Mongo") { + items.push({ + iconSrc: AddSqlQueryIcon, + onClick: () => selectedCollection && selectedCollection.onNewMongoQueryClick(selectedCollection, undefined), + label: "New Query", + }); + + items.push({ + iconSrc: HostedTerminalIcon, + onClick: () => { + const selectedCollection: ViewModels.Collection = useSelectedNode.getState().findSelectedCollection(); + if (useNotebook.getState().isShellEnabled) { + container.openNotebookTerminal(ViewModels.TerminalKind.Mongo); + } else { + selectedCollection && selectedCollection.onNewMongoShellClick(); + } + }, + label: useNotebook.getState().isShellEnabled ? "Open Mongo Shell" : "New Shell", + }); + } + + if (userContext.apiType === "SQL" || userContext.apiType === "Gremlin") { + items.push({ + iconSrc: AddStoredProcedureIcon, + onClick: () => { + const selectedCollection: ViewModels.Collection = useSelectedNode.getState().findSelectedCollection(); + selectedCollection && selectedCollection.onNewStoredProcedureClick(selectedCollection, undefined); + }, + label: "New Stored Procedure", + }); + + items.push({ + iconSrc: AddUdfIcon, + onClick: () => { + const selectedCollection: ViewModels.Collection = useSelectedNode.getState().findSelectedCollection(); + selectedCollection && selectedCollection.onNewUserDefinedFunctionClick(selectedCollection); + }, + label: "New UDF", + }); + + items.push({ + iconSrc: AddTriggerIcon, + onClick: () => { + const selectedCollection: ViewModels.Collection = useSelectedNode.getState().findSelectedCollection(); + selectedCollection && selectedCollection.onNewTriggerClick(selectedCollection, undefined); + }, + label: "New Trigger", + }); + } + + items.push({ + iconSrc: DeleteCollectionIcon, + onClick: () => + useSidePanel + .getState() + .openSidePanel( + "Delete " + getCollectionName(), + container.refreshAllDatabases()} /> + ), + label: `Delete ${getCollectionName()}`, + styleClass: "deleteCollectionMenuItem", + }); + + return items; +}; + +export const createStoreProcedureContextMenuItems = ( + container: Explorer, + storedProcedure: StoredProcedure +): TreeNodeMenuItem[] => { + if (userContext.apiType === "Cassandra") { + return []; + } + + return [ + { + iconSrc: DeleteSprocIcon, + onClick: () => storedProcedure.delete(), + label: "Delete Store Procedure", + }, + ]; +}; + +export const createTriggerContextMenuItems = (container: Explorer, trigger: Trigger): TreeNodeMenuItem[] => { + if (userContext.apiType === "Cassandra") { + return []; + } + + return [ + { + iconSrc: DeleteTriggerIcon, + onClick: () => trigger.delete(), + label: "Delete Trigger", + }, + ]; +}; + +export const createUserDefinedFunctionContextMenuItems = ( + container: Explorer, + userDefinedFunction: UserDefinedFunction +): TreeNodeMenuItem[] => { + if (userContext.apiType === "Cassandra") { + return []; + } + + return [ + { + iconSrc: DeleteUDFIcon, + onClick: () => userDefinedFunction.delete(), + label: "Delete User Defined Function", + }, + ]; +}; diff --git a/src/Explorer/Controls/Accordion/AccordionComponent.tsx b/src/Explorer/Controls/Accordion/AccordionComponent.tsx index 90685b6ba..f2b5c1b45 100644 --- a/src/Explorer/Controls/Accordion/AccordionComponent.tsx +++ b/src/Explorer/Controls/Accordion/AccordionComponent.tsx @@ -3,13 +3,14 @@ */ import * as React from "react"; -import * as Constants from "../../../Common/Constants"; import AnimateHeight from "react-animate-height"; - import TriangleDownIcon from "../../../../images/Triangle-down.svg"; import TriangleRightIcon from "../../../../images/Triangle-right.svg"; +import * as Constants from "../../../Common/Constants"; -export interface AccordionComponentProps {} +export interface AccordionComponentProps { + children: React.ReactNode; +} export class AccordionComponent extends React.Component { public render(): JSX.Element { @@ -27,12 +28,12 @@ export interface AccordionItemComponentProps { } interface AccordionItemComponentState { - isExpanded: boolean; + isExpanded?: boolean; } export class AccordionItemComponent extends React.Component { private static readonly durationMS = 500; - private isExpanded: boolean; + private isExpanded?: boolean; constructor(props: AccordionItemComponentProps) { super(props); @@ -79,7 +80,7 @@ export class AccordionItemComponent extends React.Component): void => { + private onHeaderClick = (): void => { this.setState({ isExpanded: !this.state.isExpanded }); }; diff --git a/src/Explorer/Controls/Arcadia/ArcadiaMenuPicker.tsx b/src/Explorer/Controls/Arcadia/ArcadiaMenuPicker.tsx deleted file mode 100644 index ba713ca35..000000000 --- a/src/Explorer/Controls/Arcadia/ArcadiaMenuPicker.tsx +++ /dev/null @@ -1,143 +0,0 @@ -import * as React from "react"; -import { ArcadiaWorkspace, SparkPool } from "../../../Contracts/DataModels"; -import { DefaultButton, IButtonStyles } from "office-ui-fabric-react/lib/Button"; -import { IContextualMenuItem, IContextualMenuProps } from "office-ui-fabric-react/lib/ContextualMenu"; -import * as Logger from "../../../Common/Logger"; -import { getErrorMessage } from "../../../Common/ErrorHandlingUtils"; - -export interface ArcadiaMenuPickerProps { - selectText?: string; - disableSubmenu?: boolean; - selectedSparkPool: string; - workspaces: ArcadiaWorkspaceItem[]; - onSparkPoolSelect: ( - e: React.MouseEvent | React.KeyboardEvent, - item: IContextualMenuItem - ) => boolean | void; - onCreateNewWorkspaceClicked: () => boolean | void; - onCreateNewSparkPoolClicked: (workspaceResourceId: string) => boolean | void; -} - -interface ArcadiaMenuPickerStates { - selectedSparkPool: string; -} - -export interface ArcadiaWorkspaceItem extends ArcadiaWorkspace { - sparkPools: SparkPool[]; -} - -export class ArcadiaMenuPicker extends React.Component { - constructor(props: ArcadiaMenuPickerProps) { - super(props); - this.state = { - selectedSparkPool: props.selectedSparkPool, - }; - } - - private _onSparkPoolClicked = ( - e: React.MouseEvent | React.KeyboardEvent, - item: IContextualMenuItem - ): boolean | void => { - try { - this.props.onSparkPoolSelect(e, item); - this.setState({ - selectedSparkPool: item.text, - }); - } catch (error) { - Logger.logError(getErrorMessage(error), "ArcadiaMenuPicker/_onSparkPoolClicked"); - throw error; - } - }; - - private _onCreateNewWorkspaceClicked = ( - e: React.MouseEvent | React.KeyboardEvent, - item: IContextualMenuItem - ): boolean | void => { - this.props.onCreateNewWorkspaceClicked(); - }; - - private _onCreateNewSparkPoolClicked = ( - e: React.MouseEvent | React.KeyboardEvent, - item: IContextualMenuItem - ): boolean | void => { - this.props.onCreateNewSparkPoolClicked(item.key); - }; - - public render() { - const { workspaces } = this.props; - let workspaceMenuItems: IContextualMenuItem[] = workspaces.map((workspace) => { - let sparkPoolsMenuProps: IContextualMenuProps = { - items: workspace.sparkPools.map( - (sparkpool): IContextualMenuItem => ({ - key: sparkpool.id, - text: sparkpool.name, - onClick: this._onSparkPoolClicked, - }) - ), - }; - if (!sparkPoolsMenuProps.items.length) { - sparkPoolsMenuProps.items.push({ - key: workspace.id, - text: "Create new spark pool", - onClick: this._onCreateNewSparkPoolClicked, - }); - } - - return { - key: workspace.id, - text: workspace.name, - subMenuProps: this.props.disableSubmenu ? undefined : sparkPoolsMenuProps, - }; - }); - - if (!workspaceMenuItems.length) { - workspaceMenuItems.push({ - key: "create_workspace", - text: "Create new workspace", - onClick: this._onCreateNewWorkspaceClicked, - }); - } - - const dropdownStyle: IButtonStyles = { - root: { - backgroundColor: "transparent", - margin: "auto 5px", - padding: "0", - border: "0", - }, - rootHovered: { - backgroundColor: "transparent", - }, - rootChecked: { - backgroundColor: "transparent", - }, - rootFocused: { - backgroundColor: "transparent", - }, - rootExpanded: { - backgroundColor: "transparent", - }, - flexContainer: { - height: "30px", - border: "1px solid #a6a6a6", - padding: "0 8px", - }, - label: { - fontWeight: "400", - fontSize: "12px", - }, - }; - - return ( - - ); - } -} diff --git a/src/Explorer/Controls/CollapsiblePanel/CollapsibleSectionComponent.test.tsx b/src/Explorer/Controls/CollapsiblePanel/CollapsibleSectionComponent.test.tsx index 6193ac23b..304626933 100644 --- a/src/Explorer/Controls/CollapsiblePanel/CollapsibleSectionComponent.test.tsx +++ b/src/Explorer/Controls/CollapsiblePanel/CollapsibleSectionComponent.test.tsx @@ -6,6 +6,7 @@ describe("CollapsibleSectionComponent", () => { it("renders", () => { const props: CollapsibleSectionProps = { title: "Sample title", + isExpandedByDefault: true, }; const wrapper = shallow(); diff --git a/src/Explorer/Controls/CollapsiblePanel/CollapsibleSectionComponent.tsx b/src/Explorer/Controls/CollapsiblePanel/CollapsibleSectionComponent.tsx index ef59eab1c..d662db58b 100644 --- a/src/Explorer/Controls/CollapsiblePanel/CollapsibleSectionComponent.tsx +++ b/src/Explorer/Controls/CollapsiblePanel/CollapsibleSectionComponent.tsx @@ -1,9 +1,11 @@ -import { Icon, Label, Stack } from "office-ui-fabric-react"; +import { Icon, Label, Stack } from "@fluentui/react"; import * as React from "react"; -import { accordionIconStyles, accordionStackTokens } from "../Settings/SettingsRenderUtils"; +import { accordionStackTokens } from "../Settings/SettingsRenderUtils"; export interface CollapsibleSectionProps { title: string; + isExpandedByDefault: boolean; + onExpand?: () => void; } export interface CollapsibleSectionState { @@ -14,7 +16,7 @@ export class CollapsibleSectionComponent extends React.Component - - + + {this.state.isExpanded && this.props.children} diff --git a/src/Explorer/Controls/CollapsiblePanel/__snapshots__/CollapsibleSectionComponent.test.tsx.snap b/src/Explorer/Controls/CollapsiblePanel/__snapshots__/CollapsibleSectionComponent.test.tsx.snap index f9df3c40e..95d3c46bf 100644 --- a/src/Explorer/Controls/CollapsiblePanel/__snapshots__/CollapsibleSectionComponent.test.tsx.snap +++ b/src/Explorer/Controls/CollapsiblePanel/__snapshots__/CollapsibleSectionComponent.test.tsx.snap @@ -11,16 +11,10 @@ exports[`CollapsibleSectionComponent renders 1`] = ` "childrenGap": 10, } } + verticalAlign="center" > - Sample title diff --git a/src/Explorer/Controls/CommandButton/CommandButtonComponent.tsx b/src/Explorer/Controls/CommandButton/CommandButtonComponent.tsx index 93c53c56d..2c0f6f283 100644 --- a/src/Explorer/Controls/CommandButton/CommandButtonComponent.tsx +++ b/src/Explorer/Controls/CommandButton/CommandButtonComponent.tsx @@ -1,15 +1,12 @@ -import { StringUtils } from "../../../Utils/StringUtils"; -import { KeyCodes } from "../../../Common/Constants"; -import * as TelemetryProcessor from "../../../Shared/Telemetry/TelemetryProcessor"; -import { Action, ActionModifiers } from "../../../Shared/Telemetry/TelemetryConstants"; -import CollapseChevronDownIcon from "../../../../images/QueryBuilder/CollapseChevronDown_16x.png"; - /** * React component for Command button component. */ - import * as React from "react"; -import { ArcadiaMenuPickerProps } from "../Arcadia/ArcadiaMenuPicker"; +import CollapseChevronDownIcon from "../../../../images/QueryBuilder/CollapseChevronDown_16x.png"; +import { KeyCodes } from "../../../Common/Constants"; +import { Action, ActionModifiers } from "../../../Shared/Telemetry/TelemetryConstants"; +import * as TelemetryProcessor from "../../../Shared/Telemetry/TelemetryProcessor"; +import * as StringUtils from "../../../Utils/StringUtils"; /** * Options for this component @@ -114,15 +111,6 @@ export interface CommandButtonComponentProps { * Aria-label for the button */ ariaLabel: string; - //TODO: generalize customized command bar - /** - * If set to true, will render arcadia picker - */ - isArcadiaPicker?: boolean; - /** - * props to render arcadia picker - */ - arcadiaProps?: ArcadiaMenuPickerProps; } export class CommandButtonComponent extends React.Component { @@ -133,8 +121,7 @@ export class CommandButtonComponent extends React.Component void; + closeDialog: () => void; +} + +export const useDialog: UseStore = create((set) => ({ + visible: false, + openDialog: (props: DialogProps) => set(() => ({ visible: true, dialogProps: props })), + closeDialog: () => + set((state) => ({ visible: false, openDialog: state.openDialog, closeDialog: state.closeDialog }), true), +})); export interface TextFieldProps extends ITextFieldProps { label: string; @@ -29,7 +50,6 @@ export interface DialogProps { title: string; subText: string; isModal: boolean; - visible: boolean; choiceGroupProps?: IChoiceGroupProps; textFieldProps?: TextFieldProps; linkProps?: LinkProps; @@ -50,61 +70,73 @@ const DIALOG_TITLE_FONT_SIZE = "17px"; const DIALOG_TITLE_FONT_WEIGHT = 400; const DIALOG_SUBTEXT_FONT_SIZE = "15px"; -export class Dialog extends React.Component { - constructor(props: DialogProps) { - super(props); - } +export const Dialog: FC = () => { + const { visible, dialogProps: props } = useDialog(); + const { + title, + subText, + isModal, + choiceGroupProps, + textFieldProps, + linkProps, + progressIndicatorProps, + primaryButtonText, + secondaryButtonText, + onPrimaryButtonClick, + onSecondaryButtonClick, + primaryButtonDisabled, + type, + showCloseButton, + onDismiss, + } = props || {}; - public render(): JSX.Element { - const dialogProps: IDialogProps = { - hidden: !this.props.visible, - dialogContentProps: { - type: this.props.type || DialogType.normal, - title: this.props.title, - subText: this.props.subText, - styles: { - title: { fontSize: DIALOG_TITLE_FONT_SIZE, fontWeight: DIALOG_TITLE_FONT_WEIGHT }, - subText: { fontSize: DIALOG_SUBTEXT_FONT_SIZE }, - }, - showCloseButton: this.props.showCloseButton || false, - onDismiss: this.props.onDismiss, + const dialogProps: IDialogProps = { + hidden: !visible, + dialogContentProps: { + type: type || DialogType.normal, + title, + subText, + styles: { + title: { fontSize: DIALOG_TITLE_FONT_SIZE, fontWeight: DIALOG_TITLE_FONT_WEIGHT }, + subText: { fontSize: DIALOG_SUBTEXT_FONT_SIZE }, }, - modalProps: { isBlocking: this.props.isModal, isDarkOverlay: false }, - minWidth: DIALOG_MIN_WIDTH, - maxWidth: DIALOG_MAX_WIDTH, - }; - const choiceGroupProps: IChoiceGroupProps = this.props.choiceGroupProps; - const textFieldProps: ITextFieldProps = this.props.textFieldProps; - const linkProps: LinkProps = this.props.linkProps; - const progressIndicatorProps: IProgressIndicatorProps = this.props.progressIndicatorProps; - const primaryButtonProps: IButtonProps = { - text: this.props.primaryButtonText, - disabled: this.props.primaryButtonDisabled || false, - onClick: this.props.onPrimaryButtonClick, - }; - const secondaryButtonProps: IButtonProps = - this.props.secondaryButtonText && this.props.onSecondaryButtonClick - ? { - text: this.props.secondaryButtonText, - onClick: this.props.onSecondaryButtonClick, - } - : undefined; + showCloseButton: showCloseButton || false, + onDismiss, + }, + modalProps: { isBlocking: isModal, isDarkOverlay: false }, + minWidth: DIALOG_MIN_WIDTH, + maxWidth: DIALOG_MAX_WIDTH, + }; - return ( - - {choiceGroupProps && } - {textFieldProps && } - {linkProps && ( - - {linkProps.linkText} - - )} - {progressIndicatorProps && } - - - {secondaryButtonProps && } - - - ); - } -} + const primaryButtonProps: IButtonProps = { + text: primaryButtonText, + disabled: primaryButtonDisabled || false, + onClick: onPrimaryButtonClick, + }; + const secondaryButtonProps: IButtonProps = + secondaryButtonText && onSecondaryButtonClick + ? { + text: secondaryButtonText, + onClick: onSecondaryButtonClick, + } + : {}; + + return visible ? ( + + {choiceGroupProps && } + {textFieldProps && } + {linkProps && ( + + {linkProps.linkText} + + )} + {progressIndicatorProps && } + + + {secondaryButtonProps && } + + + ) : ( + <> + ); +}; diff --git a/src/Explorer/Controls/DiffEditor/DiffEditorComponent.ts b/src/Explorer/Controls/DiffEditor/DiffEditorComponent.ts index 854cb26f3..a20bb4718 100644 --- a/src/Explorer/Controls/DiffEditor/DiffEditorComponent.ts +++ b/src/Explorer/Controls/DiffEditor/DiffEditorComponent.ts @@ -1,6 +1,6 @@ import * as ViewModels from "../../../Contracts/ViewModels"; +import { loadMonaco, monaco } from "../../LazyMonaco"; import template from "./diff-editor-component.html"; -import * as monaco from "monaco-editor"; /** * Helper class for ko component registration @@ -92,7 +92,7 @@ export class DiffEditorViewModel { /** * Create the monaco editor on diff mode and attach to DOM */ - protected createDiffEditor( + protected async createDiffEditor( originalContent: string, modifiedContent: string, createCallback: (e: monaco.editor.IStandaloneDiffEditor) => void @@ -111,7 +111,7 @@ export class DiffEditorViewModel { } const language = this.params.editorLanguage || "json"; - + const monaco = await loadMonaco(); const originalModel = monaco.editor.createModel(originalContent, language); const modifiedModel = monaco.editor.createModel(modifiedContent, language); const diffEditor: monaco.editor.IStandaloneDiffEditor = monaco.editor.createDiffEditor( diff --git a/src/Explorer/Controls/Directory/DefaultDirectoryDropdownComponent.test.tsx b/src/Explorer/Controls/Directory/DefaultDirectoryDropdownComponent.test.tsx deleted file mode 100644 index 1fca6262d..000000000 --- a/src/Explorer/Controls/Directory/DefaultDirectoryDropdownComponent.test.tsx +++ /dev/null @@ -1,105 +0,0 @@ -import React from "react"; -import { shallow, mount } from "enzyme"; -import { DefaultDirectoryDropdownComponent, DefaultDirectoryDropdownProps } from "./DefaultDirectoryDropdownComponent"; -import { Tenant } from "../../../Contracts/DataModels"; - -const createBlankProps = (): DefaultDirectoryDropdownProps => { - return { - defaultDirectoryId: "", - directories: [], - onDefaultDirectoryChange: jest.fn(), - }; -}; - -const createBlankDirectory = (): Tenant => { - return { - countryCode: "", - displayName: "", - domains: [], - id: "", - tenantId: "", - }; -}; - -describe("test render", () => { - it("renders with no directories", () => { - const props = createBlankProps(); - - const wrapper = shallow(); - expect(wrapper).toMatchSnapshot(); - }); - - it("renders with directories but no default", () => { - const props = createBlankProps(); - const tenant1 = createBlankDirectory(); - tenant1.displayName = "Microsoft"; - tenant1.tenantId = "asdfghjklzxcvbnm1234567890"; - const tenant2 = createBlankDirectory(); - tenant1.displayName = "Macrohard"; - tenant1.tenantId = "asdfghjklzxcvbnm9876543210"; - props.directories = [tenant1, tenant2]; - - const wrapper = shallow(); - expect(wrapper).toMatchSnapshot(); - }); - - it("renders with directories and default", () => { - const props = createBlankProps(); - const tenant1 = createBlankDirectory(); - tenant1.displayName = "Microsoft"; - tenant1.tenantId = "asdfghjklzxcvbnm1234567890"; - const tenant2 = createBlankDirectory(); - tenant1.displayName = "Macrohard"; - tenant1.tenantId = "asdfghjklzxcvbnm9876543210"; - props.directories = [tenant1, tenant2]; - - props.defaultDirectoryId = "asdfghjklzxcvbnm9876543210"; - - const wrapper = shallow(); - expect(wrapper).toMatchSnapshot(); - }); - - it("renders with directories and last visit default", () => { - const props = createBlankProps(); - const tenant1 = createBlankDirectory(); - tenant1.displayName = "Microsoft"; - tenant1.tenantId = "asdfghjklzxcvbnm1234567890"; - const tenant2 = createBlankDirectory(); - tenant1.displayName = "Macrohard"; - tenant1.tenantId = "asdfghjklzxcvbnm9876543210"; - props.directories = [tenant1, tenant2]; - - props.defaultDirectoryId = "lastVisited"; - - const wrapper = shallow(); - expect(wrapper).toMatchSnapshot(); - }); -}); - -describe("test function", () => { - it("on default directory change", () => { - const props = createBlankProps(); - const tenant1 = createBlankDirectory(); - tenant1.displayName = "Microsoft"; - tenant1.tenantId = "asdfghjklzxcvbnm1234567890"; - const tenant2 = createBlankDirectory(); - tenant1.displayName = "Macrohard"; - tenant1.tenantId = "asdfghjklzxcvbnm9876543210"; - props.directories = [tenant1, tenant2]; - props.defaultDirectoryId = "lastVisited"; - - const wrapper = mount(); - - wrapper.find("div.defaultDirectoryDropdown").find("div.ms-Dropdown").simulate("click"); - expect(wrapper.exists("div.ms-Callout-main")).toBe(true); - wrapper.find("button.ms-Dropdown-item").at(1).simulate("click"); - expect(props.onDefaultDirectoryChange).toBeCalled(); - expect(props.onDefaultDirectoryChange).toHaveBeenCalled(); - - wrapper.find("div.defaultDirectoryDropdown").find("div.ms-Dropdown").simulate("click"); - expect(wrapper.exists("div.ms-Callout-main")).toBe(true); - wrapper.find("button.ms-Dropdown-item").at(0).simulate("click"); - expect(props.onDefaultDirectoryChange).toBeCalled(); - expect(props.onDefaultDirectoryChange).toHaveBeenCalled(); - }); -}); diff --git a/src/Explorer/Controls/Directory/DefaultDirectoryDropdownComponent.tsx b/src/Explorer/Controls/Directory/DefaultDirectoryDropdownComponent.tsx deleted file mode 100644 index 0511efdd4..000000000 --- a/src/Explorer/Controls/Directory/DefaultDirectoryDropdownComponent.tsx +++ /dev/null @@ -1,71 +0,0 @@ -/** - * React component for Switch Directory - */ - -import _ from "underscore"; -import * as React from "react"; -import { Dropdown, IDropdownOption, IDropdownProps } from "office-ui-fabric-react/lib/Dropdown"; -import { Tenant } from "../../../Contracts/DataModels"; - -export interface DefaultDirectoryDropdownProps { - directories: Array; - defaultDirectoryId: string; - onDefaultDirectoryChange: (newDirectory: Tenant) => void; -} - -export class DefaultDirectoryDropdownComponent extends React.Component { - public static readonly lastVisitedKey: string = "lastVisited"; - - public render(): JSX.Element { - const lastVisitedOption: IDropdownOption = { - key: DefaultDirectoryDropdownComponent.lastVisitedKey, - text: "Sign in to your last visited directory", - }; - const directoryOptions: Array = this.props.directories.map( - (dirc): IDropdownOption => { - return { - key: dirc.tenantId, - text: `${dirc.displayName}(${dirc.tenantId})`, - }; - } - ); - const dropDownOptions: Array = [lastVisitedOption, ...directoryOptions]; - const dropDownProps: IDropdownProps = { - label: "Set your default directory", - options: dropDownOptions, - defaultSelectedKey: this.props.defaultDirectoryId ? this.props.defaultDirectoryId : lastVisitedOption.key, - onChange: this._onDropdownChange, - className: "defaultDirectoryDropdown", - }; - - return ; - } - - private _onDropdownChange = (e: React.FormEvent, option?: IDropdownOption, index?: number): void => { - if (!option || !option.key) { - return; - } - - if (option.key === this.props.defaultDirectoryId) { - return; - } - - if (option.key === DefaultDirectoryDropdownComponent.lastVisitedKey) { - this.props.onDefaultDirectoryChange({ - tenantId: option.key, - countryCode: undefined, - displayName: undefined, - domains: [], - id: undefined, - }); - return; - } - - const selectedDirectory = _.find(this.props.directories, (d) => d.tenantId === option.key); - if (!selectedDirectory) { - return; - } - - this.props.onDefaultDirectoryChange(selectedDirectory); - }; -} diff --git a/src/Explorer/Controls/Directory/DirectoryComponentAdapter.tsx b/src/Explorer/Controls/Directory/DirectoryComponentAdapter.tsx deleted file mode 100644 index 19df0c8fa..000000000 --- a/src/Explorer/Controls/Directory/DirectoryComponentAdapter.tsx +++ /dev/null @@ -1,36 +0,0 @@ -import * as ko from "knockout"; -import * as React from "react"; -import { DirectoryListComponent, DirectoryListProps } from "./DirectoryListComponent"; -import { DefaultDirectoryDropdownComponent, DefaultDirectoryDropdownProps } from "./DefaultDirectoryDropdownComponent"; -import { ReactAdapter } from "../../../Bindings/ReactBindingHandler"; - -export class DirectoryComponentAdapter implements ReactAdapter { - public parameters: ko.Observable; - - constructor( - private _dropdownProps: ko.Observable, - private _listProps: ko.Observable - ) { - this._dropdownProps.subscribe(() => this.forceRender()); - this._listProps.subscribe(() => this.forceRender()); - this.parameters = ko.observable(Date.now()); - } - - public renderComponent(): JSX.Element { - return ( -
-
- -
-
-
- -
-
- ); - } - - public forceRender(): void { - window.requestAnimationFrame(() => this.parameters(Date.now())); - } -} diff --git a/src/Explorer/Controls/Directory/DirectoryListComponent.test.tsx b/src/Explorer/Controls/Directory/DirectoryListComponent.test.tsx deleted file mode 100644 index 2ca392ff9..000000000 --- a/src/Explorer/Controls/Directory/DirectoryListComponent.test.tsx +++ /dev/null @@ -1,78 +0,0 @@ -import React from "react"; -import { shallow, mount } from "enzyme"; -import { DirectoryListComponent, DirectoryListProps } from "./DirectoryListComponent"; -import { Tenant } from "../../../Contracts/DataModels"; - -const createBlankProps = (): DirectoryListProps => { - return { - selectedDirectoryId: undefined, - directories: [], - onNewDirectorySelected: jest.fn(), - }; -}; - -const createBlankDirectory = (): Tenant => { - return { - countryCode: undefined, - displayName: undefined, - domains: [], - id: undefined, - tenantId: undefined, - }; -}; - -describe("test render", () => { - it("renders with no directories", () => { - const props = createBlankProps(); - - const wrapper = shallow(); - expect(wrapper).toMatchSnapshot(); - }); - - it("renders with directories and selected", () => { - const props = createBlankProps(); - const tenant1 = createBlankDirectory(); - tenant1.displayName = "Microsoft"; - tenant1.tenantId = "asdfghjklzxcvbnm1234567890"; - const tenant2 = createBlankDirectory(); - tenant1.displayName = "Macrohard"; - tenant1.tenantId = "asdfghjklzxcvbnm9876543210"; - props.directories = [tenant1, tenant2]; - - props.selectedDirectoryId = "asdfghjklzxcvbnm9876543210"; - - const wrapper = shallow(); - expect(wrapper).toMatchSnapshot(); - }); - - it("renders with filters", () => { - const props = createBlankProps(); - const tenant1 = createBlankDirectory(); - tenant1.displayName = "Microsoft"; - tenant1.tenantId = "1234567890"; - const tenant2 = createBlankDirectory(); - tenant1.displayName = "Macrohard"; - tenant1.tenantId = "9876543210"; - props.directories = [tenant1, tenant2]; - props.selectedDirectoryId = "9876543210"; - - const wrapper = mount(); - wrapper.find("input.ms-TextField-field").simulate("change", { target: { value: "Macro" } }); - expect(wrapper).toMatchSnapshot(); - }); -}); - -describe("test function", () => { - it("on new directory selected", () => { - const props = createBlankProps(); - const tenant1 = createBlankDirectory(); - tenant1.displayName = "Microsoft"; - tenant1.tenantId = "asdfghjklzxcvbnm1234567890"; - props.directories = [tenant1]; - - const wrapper = mount(); - wrapper.find("button.directoryListButton").simulate("click"); - expect(props.onNewDirectorySelected).toBeCalled(); - expect(props.onNewDirectorySelected).toHaveBeenCalled(); - }); -}); diff --git a/src/Explorer/Controls/Directory/DirectoryListComponent.tsx b/src/Explorer/Controls/Directory/DirectoryListComponent.tsx deleted file mode 100644 index d7356d541..000000000 --- a/src/Explorer/Controls/Directory/DirectoryListComponent.tsx +++ /dev/null @@ -1,122 +0,0 @@ -import _ from "underscore"; -import * as React from "react"; - -import { DefaultButton, IButtonProps } from "office-ui-fabric-react/lib/Button"; -import { List } from "office-ui-fabric-react/lib/List"; -import { ScrollablePane } from "office-ui-fabric-react/lib/ScrollablePane"; -import { Sticky, StickyPositionType } from "office-ui-fabric-react/lib/Sticky"; -import { TextField, ITextFieldProps } from "office-ui-fabric-react/lib/TextField"; -import { Tenant } from "../../../Contracts/DataModels"; - -export interface DirectoryListProps { - directories: Array; - selectedDirectoryId: string; - onNewDirectorySelected: (newDirectory: Tenant) => void; -} - -export interface DirectoryListComponentState { - filterText: string; -} - -// onRenderCell is not called when selectedDirectoryId changed, so add a selected state to force render -interface ListTenant extends Tenant { - selected?: boolean; -} - -export class DirectoryListComponent extends React.Component { - constructor(props: DirectoryListProps) { - super(props); - - this.state = { - filterText: "", - }; - } - - public render(): JSX.Element { - const { directories: originalItems, selectedDirectoryId } = this.props; - const { filterText } = this.state; - const filteredItems = - originalItems && originalItems.length && filterText - ? originalItems.filter( - (directory) => - directory.displayName && - directory.displayName.toLowerCase().indexOf(filterText && filterText.toLowerCase()) >= 0 - ) - : originalItems; - const filteredItemsSelected = filteredItems.map((t) => { - let tenant: ListTenant = t; - tenant.selected = t.tenantId === selectedDirectoryId; - return tenant; - }); - - const textFieldProps: ITextFieldProps = { - className: "directoryListFilterTextBox", - placeholder: "Filter by directory name", - onChange: this._onFilterChanged, - ariaLabel: "Directory filter text box", - }; - - // TODO: add magnify glass to search bar with onRenderSuffix - return ( - - - - - - - ); - } - - private _onFilterChanged = (event: React.FormEvent, text?: string): void => { - this.setState({ - filterText: text, - }); - }; - - private _onRenderCell = (directory: ListTenant): JSX.Element => { - const buttonProps: IButtonProps = { - disabled: directory.selected || false, - className: "directoryListButton", - onClick: this._onNewDirectoryClick, - styles: { - root: { - backgroundColor: "transparent", - height: "auto", - borderBottom: "1px solid #ccc", - padding: "1px 0", - width: "100%", - }, - rootDisabled: { - backgroundColor: "#f1f1f8", - }, - rootHovered: { - backgroundColor: "rgba(85,179,255,.1)", - }, - flexContainer: { - height: "auto", - justifyContent: "flex-start", - }, - }, - }; - - return ( - -
-
{directory.displayName}
-
{directory.tenantId}
-
- - ); - }; - - private _onNewDirectoryClick = (e: React.MouseEvent): void => { - if (!e || !e.currentTarget) { - return; - } - const buttonElement = e.currentTarget; - const selectedDirectoryId = buttonElement.getElementsByClassName("directoryListItemId")[0].textContent; - const selectedDirectory = _.find(this.props.directories, (d) => d.tenantId === selectedDirectoryId); - - this.props.onNewDirectorySelected(selectedDirectory); - }; -} diff --git a/src/Explorer/Controls/Directory/__snapshots__/DefaultDirectoryDropdownComponent.test.tsx.snap b/src/Explorer/Controls/Directory/__snapshots__/DefaultDirectoryDropdownComponent.test.tsx.snap deleted file mode 100644 index ef5da945d..000000000 --- a/src/Explorer/Controls/Directory/__snapshots__/DefaultDirectoryDropdownComponent.test.tsx.snap +++ /dev/null @@ -1,93 +0,0 @@ -// Jest Snapshot v1, https://goo.gl/fbAQLP - -exports[`test render renders with directories and default 1`] = ` - -`; - -exports[`test render renders with directories and last visit default 1`] = ` - -`; - -exports[`test render renders with directories but no default 1`] = ` - -`; - -exports[`test render renders with no directories 1`] = ` - -`; diff --git a/src/Explorer/Controls/Directory/__snapshots__/DirectoryListComponent.test.tsx.snap b/src/Explorer/Controls/Directory/__snapshots__/DirectoryListComponent.test.tsx.snap deleted file mode 100644 index 2a0839246..000000000 --- a/src/Explorer/Controls/Directory/__snapshots__/DirectoryListComponent.test.tsx.snap +++ /dev/null @@ -1,1983 +0,0 @@ -// Jest Snapshot v1, https://goo.gl/fbAQLP - -exports[`test render renders with directories and selected 1`] = ` - - - - - - -`; - -exports[`test render renders with filters 1`] = ` - - - -
-