es2017 everywhere

.env.example

@@ -1 +1,14 @@
+PORTAL_RUNNER_USERNAME=
+PORTAL_RUNNER_PASSWORD=
+PORTAL_RUNNER_SUBSCRIPTION=
+PORTAL_RUNNER_RESOURCE_GROUP=
+PORTAL_RUNNER_DATABASE_ACCOUNT=
+PORTAL_RUNNER_DATABASE_ACCOUNT_KEY=
+PORTAL_RUNNER_CONNECTION_STRING=
+NOTEBOOKS_TEST_RUNNER_TENANT_ID=
+NOTEBOOKS_TEST_RUNNER_CLIENT_ID=
+NOTEBOOKS_TEST_RUNNER_CLIENT_SECRET=
+CASSANDRA_CONNECTION_STRING=
+MONGO_CONNECTION_STRING=
+TABLES_CONNECTION_STRING=
 DATA_EXPLORER_ENDPOINT=https://localhost:1234/hostedExplorer.html

.eslintignore

@@ -1,26 +1,37 @@
 **/node_modules/
-src/**/__mocks__/**/*
 dist/
 Contracts/
 src/Api/Apis.ts
 src/AuthType.ts
 src/Bindings/BindingHandlersRegisterer.ts
 src/Bindings/ReactBindingHandler.ts
+src/Common/ArrayHashMap.ts
 src/Common/Constants.ts
 src/Common/CosmosClient.test.ts
 src/Common/CosmosClient.ts
 src/Common/DataAccessUtilityBase.test.ts
 src/Common/DataAccessUtilityBase.ts
+src/Common/DeleteFeedback.ts
+src/Common/DocumentClientUtilityBase.ts
 src/Common/EditableUtility.ts
 src/Common/HashMap.test.ts
+src/Common/HashMap.ts
+src/Common/HeadersUtility.test.ts
+src/Common/HeadersUtility.ts
+src/Common/IteratorUtilities.test.ts
+src/Common/IteratorUtilities.ts
 src/Common/Logger.test.ts
 src/Common/MessageHandler.test.ts
 src/Common/MessageHandler.ts
 src/Common/MongoProxyClient.test.ts
 src/Common/MongoUtility.ts
 src/Common/NotificationsClientBase.ts
+src/Common/ObjectCache.test.ts
+src/Common/ObjectCache.ts
 src/Common/QueriesClient.ts
 src/Common/Splitter.ts
+src/Common/ThemeUtility.ts
+src/Common/UrlUtility.ts
 src/Config.ts
 src/Contracts/ActionContracts.ts
 src/Contracts/DataModels.ts
@@ -31,6 +42,7 @@ src/Contracts/ViewModels.ts
 src/Controls/Heatmap/Heatmap.test.ts
 src/Controls/Heatmap/Heatmap.ts
 src/Controls/Heatmap/HeatmapDatatypes.ts
+src/Definitions/adal.d.ts
 src/Definitions/datatables.d.ts
 src/Definitions/gif.d.ts
 src/Definitions/globals.d.ts
@@ -42,9 +54,13 @@ src/Definitions/jquery.d.ts
 src/Definitions/plotly.js-cartesian-dist.d-min.ts
 src/Definitions/png.d.ts
 src/Definitions/svg.d.ts
+src/Definitions/worker.d.ts
 src/Explorer/ComponentRegisterer.test.ts
 src/Explorer/ComponentRegisterer.ts
+src/Explorer/ContextMenuButtonFactory.ts
 src/Explorer/Controls/CollapsiblePanel/CollapsiblePanelComponent.ts
+src/Explorer/Controls/CommandButton/CommandButton.test.ts
+src/Explorer/Controls/CommandButton/CommandButton.ts
 src/Explorer/Controls/DiffEditor/DiffEditorComponent.ts
 src/Explorer/Controls/DynamicList/DynamicList.test.ts
 src/Explorer/Controls/DynamicList/DynamicListComponent.ts
@@ -53,6 +69,7 @@ src/Explorer/Controls/ErrorDisplayComponent/ErrorDisplayComponent.ts
 src/Explorer/Controls/InputTypeahead/InputTypeahead.ts
 src/Explorer/Controls/JsonEditor/JsonEditorComponent.ts
 src/Explorer/Controls/Notebook/NotebookAppMessageHandler.ts
+src/Explorer/Controls/ThroughputInput/ThroughputInput.test.ts
 src/Explorer/Controls/ThroughputInput/ThroughputInputComponent.ts
 src/Explorer/Controls/ThroughputInput/ThroughputInputComponentAutoPilotV3.ts
 src/Explorer/Controls/Toolbar/IToolbarAction.ts
@@ -71,6 +88,7 @@ src/Explorer/DataSamples/ContainerSampleGenerator.test.ts
 src/Explorer/DataSamples/ContainerSampleGenerator.ts
 src/Explorer/DataSamples/DataSamplesUtil.test.ts
 src/Explorer/DataSamples/DataSamplesUtil.ts
+src/Explorer/Explorer.ts
 src/Explorer/Graph/GraphExplorerComponent/ArraysByKeyCache.test.ts
 src/Explorer/Graph/GraphExplorerComponent/ArraysByKeyCache.ts
 src/Explorer/Graph/GraphExplorerComponent/D3ForceGraph.test.ts
@@ -78,12 +96,22 @@ src/Explorer/Graph/GraphExplorerComponent/D3ForceGraph.ts
 src/Explorer/Graph/GraphExplorerComponent/EdgeInfoCache.ts
 src/Explorer/Graph/GraphExplorerComponent/GraphData.test.ts
 src/Explorer/Graph/GraphExplorerComponent/GraphData.ts
+src/Explorer/Graph/GraphExplorerComponent/GraphUtil.test.ts
+src/Explorer/Graph/GraphExplorerComponent/GraphUtil.ts
 src/Explorer/Graph/GraphExplorerComponent/GremlinClient.test.ts
 src/Explorer/Graph/GraphExplorerComponent/GremlinClient.ts
 src/Explorer/Graph/GraphExplorerComponent/GremlinSimpleClient.test.ts
 src/Explorer/Graph/GraphExplorerComponent/GremlinSimpleClient.ts
+src/Explorer/Graph/GraphStyleComponent/GraphStyle.test.ts
+src/Explorer/Graph/GraphStyleComponent/GraphStyleComponent.ts
+src/Explorer/Graph/NewVertexComponent/NewVertex.test.ts
+src/Explorer/Graph/NewVertexComponent/NewVertexComponent.ts
+src/Explorer/Menus/CommandBar/CommandBarComponentButtonFactory.test.ts
+src/Explorer/Menus/CommandBar/CommandBarComponentButtonFactory.ts
 src/Explorer/Menus/ContextMenu.ts
 src/Explorer/MostRecentActivity/MostRecentActivity.ts
+src/Explorer/Notebook/FileSystemUtil.ts
+src/Explorer/Notebook/NTeractUtil.ts
 src/Explorer/Notebook/NotebookClientV2.ts
 src/Explorer/Notebook/NotebookComponent/NotebookContentProvider.ts
 src/Explorer/Notebook/NotebookComponent/__mocks__/rx-jupyter.ts
@@ -98,17 +126,52 @@ src/Explorer/Notebook/NotebookContainerClient.ts
 src/Explorer/Notebook/NotebookContentClient.ts
 src/Explorer/Notebook/NotebookContentItem.ts
 src/Explorer/Notebook/NotebookUtil.ts
+src/Explorer/OpenActions.test.ts
+src/Explorer/OpenActions.ts
 src/Explorer/OpenActionsStubs.ts
+src/Explorer/Panes/AddCollectionPane.test.ts
+src/Explorer/Panes/AddCollectionPane.ts
+src/Explorer/Panes/AddDatabasePane.test.ts
+src/Explorer/Panes/AddDatabasePane.ts
+src/Explorer/Panes/BrowseQueriesPane.ts
+src/Explorer/Panes/CassandraAddCollectionPane.ts
+src/Explorer/Panes/ContextualPaneBase.ts
+src/Explorer/Panes/DeleteCollectionConfirmationPane.test.ts
+src/Explorer/Panes/DeleteCollectionConfirmationPane.ts
+src/Explorer/Panes/DeleteDatabaseConfirmationPane.test.ts
+src/Explorer/Panes/DeleteDatabaseConfirmationPane.ts
+src/Explorer/Panes/ExecuteSprocParamsPane.ts
+src/Explorer/Panes/GraphStylingPane.ts
+src/Explorer/Panes/LoadQueryPane.ts
+src/Explorer/Panes/NewVertexPane.ts
+src/Explorer/Panes/PaneComponents.ts
+src/Explorer/Panes/RenewAdHocAccessPane.ts
+src/Explorer/Panes/SaveQueryPane.ts
+src/Explorer/Panes/SettingsPane.test.ts
+src/Explorer/Panes/SettingsPane.ts
+src/Explorer/Panes/SetupNotebooksPane.ts
+src/Explorer/Panes/StringInputPane.ts
+src/Explorer/Panes/SwitchDirectoryPane.ts
+src/Explorer/Panes/Tables/AddTableEntityPane.ts
+src/Explorer/Panes/Tables/EditTableEntityPane.ts
+src/Explorer/Panes/Tables/EntityPropertyViewModel.ts
+src/Explorer/Panes/Tables/QuerySelectPane.ts
+src/Explorer/Panes/Tables/TableColumnOptionsPane.ts
+src/Explorer/Panes/Tables/TableEntityPane.ts
 src/Explorer/Panes/Tables/Validators/EntityPropertyNameValidator.ts
 src/Explorer/Panes/Tables/Validators/EntityPropertyValidationCommon.ts
 src/Explorer/Panes/Tables/Validators/EntityPropertyValueValidator.ts
-src/Explorer/SplashScreen/SplashScreen.test.ts
+src/Explorer/Panes/UploadFilePane.ts
+src/Explorer/Panes/UploadItemsPane.ts
+src/Explorer/SplashScreen/SplashScreenComponentAdapter.test.ts
+src/Explorer/Tables/Constants.ts
 src/Explorer/Tables/DataTable/CacheBase.ts
 src/Explorer/Tables/DataTable/DataTableBindingManager.ts
 src/Explorer/Tables/DataTable/DataTableBuilder.ts
 src/Explorer/Tables/DataTable/DataTableContextMenu.ts
 src/Explorer/Tables/DataTable/DataTableOperationManager.ts
 src/Explorer/Tables/DataTable/DataTableOperations.ts
+src/Explorer/Tables/DataTable/DataTableUtilities.ts
 src/Explorer/Tables/DataTable/DataTableViewModel.ts
 src/Explorer/Tables/DataTable/TableCommands.ts
 src/Explorer/Tables/DataTable/TableEntityCache.ts
@@ -117,8 +180,11 @@ src/Explorer/Tables/Entities.ts
 src/Explorer/Tables/QueryBuilder/ClauseGroup.ts
 src/Explorer/Tables/QueryBuilder/ClauseGroupViewModel.ts
 src/Explorer/Tables/QueryBuilder/CustomTimestampHelper.ts
+src/Explorer/Tables/QueryBuilder/DateTimeUtilities.test.ts
+src/Explorer/Tables/QueryBuilder/DateTimeUtilities.ts
 src/Explorer/Tables/QueryBuilder/QueryBuilderViewModel.ts
 src/Explorer/Tables/QueryBuilder/QueryClauseViewModel.ts
+src/Explorer/Tables/QueryBuilder/QueryViewModel.ts
 src/Explorer/Tables/TableDataClient.ts
 src/Explorer/Tables/TableEntityProcessor.ts
 src/Explorer/Tables/Utilities.ts
@@ -128,67 +194,202 @@ src/Explorer/Tabs/DocumentsTab.test.ts
 src/Explorer/Tabs/DocumentsTab.ts
 src/Explorer/Tabs/GraphTab.ts
 src/Explorer/Tabs/MongoDocumentsTab.ts
+src/Explorer/Tabs/MongoQueryTab.ts
+src/Explorer/Tabs/MongoShellTab.ts
 src/Explorer/Tabs/NotebookV2Tab.ts
+src/Explorer/Tabs/QueryTab.test.ts
+src/Explorer/Tabs/QueryTab.ts
+src/Explorer/Tabs/QueryTablesTab.ts
 src/Explorer/Tabs/ScriptTabBase.ts
+src/Explorer/Tabs/SparkMasterTab.ts
+src/Explorer/Tabs/StoredProcedureTab.ts
 src/Explorer/Tabs/TabComponents.ts
 src/Explorer/Tabs/TabsBase.ts
 src/Explorer/Tabs/TriggerTab.ts
 src/Explorer/Tabs/UserDefinedFunctionTab.ts
 src/Explorer/Tree/AccessibleVerticalList.ts
+src/Explorer/Tree/Collection.test.ts
 src/Explorer/Tree/Collection.ts
 src/Explorer/Tree/ConflictId.ts
+src/Explorer/Tree/Database.ts
 src/Explorer/Tree/DocumentId.ts
 src/Explorer/Tree/ObjectId.ts
 src/Explorer/Tree/ResourceTokenCollection.ts
 src/Explorer/Tree/StoredProcedure.ts
 src/Explorer/Tree/TreeComponents.ts
 src/Explorer/Tree/Trigger.ts
+src/Explorer/Tree/UserDefinedFunction.ts
 src/Explorer/WaitsForTemplateViewModel.ts
 src/GitHub/GitHubClient.test.ts
 src/GitHub/GitHubClient.ts
 src/GitHub/GitHubConnector.ts
+src/GitHub/GitHubContentProvider.test.ts
+src/GitHub/GitHubContentProvider.ts
 src/GitHub/GitHubOAuthService.ts
+src/HostedExplorer.ts
 src/Index.ts
 src/Juno/JunoClient.test.ts
 src/Juno/JunoClient.ts
+src/Main.ts
+src/NotebookWorkspaceManager/NotebookWorkspaceManager.ts
+src/NotebookWorkspaceManager/NotebookWorkspaceResourceProviderMockClients.ts
+src/Platform/Emulator/DataAccessUtility.ts
+src/Platform/Emulator/ExplorerFactory.ts
+src/Platform/Emulator/Main.ts
+src/Platform/Emulator/NotificationsClient.ts
+src/Platform/Hosted/ArmResourceUtils.ts
 src/Platform/Hosted/Authorization.ts
+src/Platform/Hosted/DataAccessUtility.ts
+src/Platform/Hosted/ExplorerFactory.ts
+src/Platform/Hosted/Helpers/ConnectionStringParser.test.ts
+src/Platform/Hosted/Helpers/ConnectionStringParser.ts
+src/Platform/Hosted/HostedUtils.test.ts
+src/Platform/Hosted/HostedUtils.ts
+src/Platform/Hosted/Main.ts
+src/Platform/Hosted/Maint.test.ts
+src/Platform/Hosted/NotificationsClient.ts
+src/Platform/Portal/DataAccessUtility.ts
+src/Platform/Portal/ExplorerFactory.ts
+src/Platform/Portal/Main.ts
+src/Platform/Portal/NotificationsClient.ts
+src/PlatformType.ts
 src/ReactDevTools.ts
+src/ResourceProvider/IResourceProviderClient.test.ts
+src/ResourceProvider/IResourceProviderClient.ts
+src/ResourceProvider/ResourceProviderClient.ts
+src/ResourceProvider/ResourceProviderClientFactory.ts
+src/RouteHandlers/RouteHandler.ts
+src/RouteHandlers/TabRouteHandler.test.ts
+src/RouteHandlers/TabRouteHandler.ts
 src/Shared/Constants.ts
 src/Shared/DefaultExperienceUtility.test.ts
 src/Shared/DefaultExperienceUtility.ts
+src/Shared/ExplorerSettings.ts
+src/Shared/PriceEstimateCalculator.ts
+src/Shared/StorageUtility.test.ts
+src/Shared/StorageUtility.ts
+src/Shared/StringUtility.test.ts
+src/Shared/StringUtility.ts
 src/Shared/appInsights.ts
 src/SparkClusterManager/ArcadiaResourceManager.ts
 src/SparkClusterManager/SparkClusterManager.ts
 src/Terminal/JupyterLabAppFactory.ts
 src/Terminal/NotebookAppContracts.d.ts
+src/Terminal/index.ts
+src/TokenProviders/PortalTokenProvider.ts
+src/TokenProviders/TokenProviderFactory.ts
+src/Utils/AuthorizationUtils.test.ts
+src/Utils/AuthorizationUtils.ts
+src/Utils/AutoPilotUtils.test.ts
+src/Utils/AutoPilotUtils.ts
+src/Utils/DatabaseAccountUtils.test.ts
+src/Utils/DatabaseAccountUtils.ts
+src/Utils/JunoUtils.ts
+src/Utils/MessageValidation.ts
+src/Utils/NotebookConfigurationUtils.ts
+src/Utils/PricingUtils.test.ts
+src/Utils/QueryUtils.test.ts
+src/Utils/QueryUtils.ts
+src/Utils/StringUtils.test.ts
+src/Utils/StringUtils.ts
 src/applyExplorerBindings.ts
 src/global.d.ts
+src/quickstart.ts
 src/setupTests.ts
+src/workers/upload/definitions.ts
+src/workers/upload/index.ts
+src/Explorer/Controls/AccessibleElement/AccessibleElement.tsx
+src/Explorer/Controls/Accordion/AccordionComponent.tsx
+src/Explorer/Controls/AccountSwitch/AccountSwitchComponent.test.tsx
+src/Explorer/Controls/AccountSwitch/AccountSwitchComponent.tsx
+src/Explorer/Controls/AccountSwitch/AccountSwitchComponentAdapter.tsx
+src/Explorer/Controls/Arcadia/ArcadiaMenuPicker.tsx
+src/Explorer/Controls/CollapsiblePanel/CollapsiblePanel.tsx
+src/Explorer/Controls/CommandButton/CommandButtonComponent.tsx
+src/Explorer/Controls/DialogReactComponent/DialogComponent.tsx
+src/Explorer/Controls/DialogReactComponent/DialogComponentAdapter.tsx
+src/Explorer/Controls/Directory/DefaultDirectoryDropdownComponent.test.tsx
+src/Explorer/Controls/Directory/DefaultDirectoryDropdownComponent.tsx
+src/Explorer/Controls/Directory/DirectoryComponentAdapter.tsx
+src/Explorer/Controls/Directory/DirectoryListComponent.test.tsx
+src/Explorer/Controls/Directory/DirectoryListComponent.tsx
+src/Explorer/Controls/Editor/EditorReact.tsx
 src/Explorer/Controls/InputTypeahead/InputTypeaheadComponent.tsx
 src/Explorer/Controls/Notebook/NotebookTerminalComponent.test.tsx
 src/Explorer/Controls/Notebook/NotebookTerminalComponent.tsx
+src/Explorer/Controls/NotebookViewer/NotebookMetadataComponent.tsx
+src/NotebookViewer/NotebookViewer.tsx
 src/Explorer/Controls/NotebookViewer/NotebookViewerComponent.tsx
+src/Explorer/Controls/QueriesGridReactComponent/QueriesGridComponent.tsx
+src/Explorer/Controls/QueriesGridReactComponent/QueriesGridComponentAdapter.tsx
+src/Explorer/Controls/ResizeSensorReactComponent/ResizeSensorComponent.tsx
+src/Explorer/Controls/Spark/ClusterSettingsComponent.tsx
+src/Explorer/Controls/Spark/ClusterSettingsComponentAdapter.tsx
+src/Explorer/Controls/Tabs/TabComponent.tsx
+src/Explorer/Controls/TreeComponent/TreeComponent.test.tsx
 src/Explorer/Controls/TreeComponent/TreeComponent.tsx
+src/Explorer/Graph/GraphExplorerComponent/EditorNeighborsComponent.tsx
+src/Explorer/Graph/GraphExplorerComponent/EditorNodePropertiesComponent.test.tsx
+src/Explorer/Graph/GraphExplorerComponent/EditorNodePropertiesComponent.tsx
 src/Explorer/Graph/GraphExplorerComponent/GraphExplorer.test.tsx
 src/Explorer/Graph/GraphExplorerComponent/GraphExplorer.tsx
+src/Explorer/Graph/GraphExplorerComponent/GraphExplorerAdapter.tsx
 src/Explorer/Graph/GraphExplorerComponent/GraphVizComponent.tsx
 src/Explorer/Graph/GraphExplorerComponent/LeftPaneComponent.tsx
 src/Explorer/Graph/GraphExplorerComponent/MiddlePaneComponent.tsx
 src/Explorer/Graph/GraphExplorerComponent/NodePropertiesComponent.test.tsx
 src/Explorer/Graph/GraphExplorerComponent/NodePropertiesComponent.tsx
+src/Explorer/Graph/GraphExplorerComponent/QueryContainerComponent.tsx
+src/Explorer/Graph/GraphExplorerComponent/ReadOnlyNeighborsComponent.tsx
 src/Explorer/Graph/GraphExplorerComponent/ReadOnlyNodePropertiesComponent.test.tsx
 src/Explorer/Graph/GraphExplorerComponent/ReadOnlyNodePropertiesComponent.tsx
+src/Explorer/Menus/CommandBar/CommandBarComponentAdapter.tsx
+src/Explorer/Menus/CommandBar/CommandBarUtil.test.tsx
 src/Explorer/Menus/CommandBar/CommandBarUtil.tsx
+src/Explorer/Menus/CommandBar/MemoryTrackerComponent.tsx
+src/Explorer/Menus/NavBar/ControlBarComponent.tsx
+src/Explorer/Menus/NavBar/ControlBarComponentAdapter.tsx
+src/Explorer/Menus/NavBar/MeControlComponent.test.tsx
+src/Explorer/Menus/NavBar/MeControlComponent.tsx
+src/Explorer/Menus/NavBar/MeControlComponentAdapter.tsx
+src/Explorer/Menus/NotificationConsole/NotificationConsoleComponent.test.tsx
+src/Explorer/Menus/NotificationConsole/NotificationConsoleComponent.tsx
+src/Explorer/Menus/NotificationConsole/NotificationConsoleComponentAdapter.tsx
+src/Explorer/Notebook/NotebookComponent/NotebookComponent.tsx
 src/Explorer/Notebook/NotebookComponent/NotebookComponentAdapter.tsx
 src/Explorer/Notebook/NotebookComponent/NotebookComponentBootstrapper.tsx
 src/Explorer/Notebook/NotebookComponent/VirtualCommandBarComponent.tsx
+src/Explorer/Notebook/NotebookComponent/contents/file/index.tsx
+src/Explorer/Notebook/NotebookComponent/contents/file/text-file.tsx
 src/Explorer/Notebook/NotebookComponent/contents/index.tsx
+src/Explorer/Notebook/NotebookRenderer/AzureTheme.tsx
 src/Explorer/Notebook/NotebookRenderer/NotebookReadOnlyRenderer.tsx
 src/Explorer/Notebook/NotebookRenderer/NotebookRenderer.tsx
+src/Explorer/Notebook/NotebookRenderer/Prompt.tsx
+src/Explorer/Notebook/NotebookRenderer/PromptContent.tsx
+src/Explorer/Notebook/NotebookRenderer/StatusBar.test.tsx
+src/Explorer/Notebook/NotebookRenderer/StatusBar.tsx
+src/Explorer/Notebook/NotebookRenderer/Toolbar.tsx
+src/Explorer/Notebook/NotebookRenderer/decorators/CellCreator.tsx
+src/Explorer/Notebook/NotebookRenderer/decorators/CellLabeler.tsx
+src/Explorer/Notebook/NotebookRenderer/decorators/HoverableCell.tsx
 src/Explorer/Notebook/NotebookRenderer/decorators/draggable/index.tsx
 src/Explorer/Notebook/NotebookRenderer/decorators/hijack-scroll/index.tsx
 src/Explorer/Notebook/NotebookRenderer/decorators/kbd-shortcuts/index.tsx
 src/Explorer/Notebook/temp/inputs/connected-editors/codemirror.tsx
+src/Explorer/Notebook/temp/inputs/editor.tsx
+src/Explorer/Notebook/temp/markdown-cell.tsx
+src/Explorer/Notebook/temp/source.tsx
+src/Explorer/Notebook/temp/syntax-highlighter/index.tsx
+src/Explorer/SplashScreen/SplashScreenComponent.tsx
+src/Explorer/SplashScreen/SplashScreenComponentApdapter.tsx
+src/Explorer/Tabs/GalleryTab.tsx
+src/Explorer/Tabs/NotebookViewerTab.tsx
+src/Explorer/Tabs/TerminalTab.tsx
 src/Explorer/Tree/ResourceTreeAdapter.tsx
+src/Explorer/Tree/ResourceTreeAdapterForResourceToken.tsx
+src/GalleryViewer/Cards/GalleryCardComponent.tsx
+src/GalleryViewer/GalleryViewer.tsx
+src/GalleryViewer/GalleryViewerComponent.tsx
 __mocks__/monaco-editor.ts
-src/Explorer/Tree/ResourceTree.tsx
+src/Explorer/Tree/ResourceTreeAdapterForResourceToken.test.tsx

.eslintrc.js

@@ -1,57 +1,54 @@
 module.exports = {
   env: {
     browser: true,
-    es6: true,
+    es6: true
   },
-  plugins: ["@typescript-eslint", "no-null", "prefer-arrow", "react-hooks"],
+  plugins: ["@typescript-eslint", "no-null", "prefer-arrow"],
   extends: ["eslint:recommended", "plugin:@typescript-eslint/recommended"],
   globals: {
     Atomics: "readonly",
-    SharedArrayBuffer: "readonly",
+    SharedArrayBuffer: "readonly"
   },
   parser: "@typescript-eslint/parser",
   parserOptions: {
-    project: ["./tsconfig.json", "./tsconfig.test.json"],
     ecmaFeatures: {
-      jsx: true,
+      jsx: true
     },
     ecmaVersion: 2018,
-    sourceType: "module",
+    sourceType: "module"
   },
   overrides: [
     {
       files: ["**/*.tsx"],
+      env: {
+        jest: true
+      },
       extends: ["plugin:react/recommended"],
-      plugins: ["react"],
+      plugins: ["react"]
     },
     {
       files: ["**/*.{test,spec}.{ts,tsx}"],
       env: {
-        jest: true,
+        jest: true
       },
       extends: ["plugin:jest/recommended"],
-      plugins: ["jest"],
-    },
+      plugins: ["jest"]
+    }
   ],
   rules: {
-    "no-console": ["error", { allow: ["error", "warn", "dir"] }],
     curly: "error",
-    "@typescript-eslint/switch-exhaustiveness-check": "error",
     "@typescript-eslint/no-unused-vars": "error",
     "@typescript-eslint/no-extraneous-class": "error",
     "no-null/no-null": "error",
     "@typescript-eslint/no-explicit-any": "error",
     "prefer-arrow/prefer-arrow-functions": ["error", { allowStandaloneDeclarations: true }],
     eqeqeq: "error",
-    "react/display-name": "off",
-    "react-hooks/rules-of-hooks": "warn", // TODO: error
-    "react-hooks/exhaustive-deps": "warn", // TODO: error
     "no-restricted-syntax": [
       "error",
       {
         selector: "CallExpression[callee.object.name='JSON'][callee.property.name='stringify'] Identifier[name=/$err/]",
-        message: "Do not use JSON.stringify(error). It will print '{}'",
-      },
-    ],
-  },
+        message: "Do not use JSON.stringify(error). It will print '{}'"
+      }
+    ]
+  }
 };

.github/PULL_REQUEST_TEMPLATE.md

@@ -1 +0,0 @@
-[Preview this branch](https://cosmos-explorer-preview.azurewebsites.net/pull/EDIT_THIS_NUMBER_IN_THE_PR_DESCRIPTION?feature.someFeatureFlagYouMightNeed=true)

.github/dependabot.yml

@@ -1,9 +0,0 @@
-# Please see the documentation for all configuration options:
-# https://help.github.com/github/administering-a-repository/configuration-options-for-dependency-updates
-
-version: 2
-updates:
-  - package-ecosystem: "npm"
-    directory: "/"
-    schedule:
-      interval: "daily"

.github/workflows/ci.yml

@@ -9,29 +9,15 @@ on:
     branches:
       - master
 jobs:
-  codemetrics:
-    runs-on: ubuntu-latest
-    name: "Log Code Metrics"
-    if: github.ref == 'refs/heads/master'
-    steps:
-      - uses: actions/checkout@v2
-      - name: Use Node.js 14.x
-        uses: actions/setup-node@v1
-        with:
-          node-version: 14.x
-      - run: npm ci
-      - run: node utils/codeMetrics.js
-        env:
-          CODE_METRICS_APP_ID: ${{ secrets.CODE_METRICS_APP_ID }}
   compile:
     runs-on: ubuntu-latest
     name: "Compile TypeScript"
     steps:
       - uses: actions/checkout@v2
-      - name: Use Node.js 14.x
+      - name: Use Node.js 12.x
         uses: actions/setup-node@v1
         with:
-          node-version: 14.x
+          node-version: 12.x
       - run: npm ci
       - run: npm run compile
       - run: npm run compile:strict
@@ -40,10 +26,10 @@ jobs:
     name: "Check Format"
     steps:
       - uses: actions/checkout@v2
-      - name: Use Node.js 14.x
+      - name: Use Node.js 12.x
         uses: actions/setup-node@v1
         with:
-          node-version: 14.x
+          node-version: 12.x
       - run: npm ci
       - run: npm run format:check
   lint:
@@ -51,10 +37,10 @@ jobs:
     name: "Lint"
     steps:
       - uses: actions/checkout@v2
-      - name: Use Node.js 14.x
+      - name: Use Node.js 12.x
         uses: actions/setup-node@v1
         with:
-          node-version: 14.x
+          node-version: 12.x
       - run: npm ci
       - run: npm run lint
   unittest:
@@ -62,21 +48,22 @@ jobs:
     name: "Unit Tests"
     steps:
       - uses: actions/checkout@v2
-      - name: Use Node.js 14.x
+      - name: Use Node.js 12.x
         uses: actions/setup-node@v1
         with:
-          node-version: 14.x
+          node-version: 12.x
       - run: npm ci
       - run: npm run test
   build:
     runs-on: ubuntu-latest
+    needs: [lint, format, compile, unittest]
     name: "Build"
     steps:
       - uses: actions/checkout@v2
-      - name: Use Node.js 14.x
+      - name: Use Node.js 12.x
         uses: actions/setup-node@v1
         with:
-          node-version: 14.x
+          node-version: 12.x
       - run: npm ci
       - run: npm run build:contracts
       - name: Restore Build Cache
@@ -91,32 +78,23 @@ jobs:
         with:
           name: dist
           path: dist/
-      - name: Upload build to preview blob storage
-        run: az storage blob upload-batch -d '$web' -s 'dist' --account-name cosmosexplorerpreview --subscription cosmosdb-portalteam-generaldemo --destination-path "${{github.event.pull_request.head.sha || github.sha}}" --account-key="${PREVIEW_STORAGE_KEY}"
-        env:
-          PREVIEW_STORAGE_KEY: ${{ secrets.PREVIEW_STORAGE_KEY }}
-      - name: Upload preview config to blob storage
-        run: az storage blob upload -c '$web' -f ./preview/config.json --account-name cosmosexplorerpreview --subscription cosmosdb-portalteam-generaldemo --name "${{github.event.pull_request.head.sha || github.sha}}/config.json" --account-key="${PREVIEW_STORAGE_KEY}"
-        env:
-          PREVIEW_STORAGE_KEY: ${{ secrets.PREVIEW_STORAGE_KEY }}
   endtoendemulator:
     name: "End To End Emulator Tests"
-    # Temporarily disabled. This test needs to be rewritten in playwright
-    if: false
+    needs: [lint, format, compile, unittest]
     runs-on: windows-latest
     steps:
       - uses: actions/checkout@v2
-      - name: Use Node.js 14.x
+      - name: Use Node.js 12.x
         uses: actions/setup-node@v1
         with:
-          node-version: 14.x
+          node-version: 12.x
       - uses: southpolesteve/cosmos-emulator-github-action@v1
       - name: End to End Tests
         run: |
           npm ci
           npm start &
           npm run wait-for-server
-          npx jest -c ./jest.config.e2e.js --detectOpenHandles test/sql/container.spec.ts
+          npx jest -c ./jest.config.e2e.js --detectOpenHandles sql
         shell: bash
         env:
           DATA_EXPLORER_ENDPOINT: "https://localhost:1234/explorer.html?platform=Emulator"
@@ -127,48 +105,69 @@ jobs:
         with:
           name: screenshots
           path: failed-*
-  endtoend:
-    name: "E2E"
+  accessibility:
+    name: "Accessibility | Hosted"
+    needs: [lint, format, compile, unittest]
     runs-on: ubuntu-latest
-    env:
-      NODE_TLS_REJECT_UNAUTHORIZED: 0
-      NOTEBOOKS_TEST_RUNNER_CLIENT_SECRET: ${{ secrets.NOTEBOOKS_TEST_RUNNER_CLIENT_SECRET }}
-    strategy:
-      fail-fast: false
-      matrix:
-        test-file:
-          - ./test/cassandra/container.spec.ts
-          - ./test/graph/container.spec.ts
-          - ./test/sql/container.spec.ts
-          - ./test/mongo/container.spec.ts
-          - ./test/mongo/container32.spec.ts
-          - ./test/selfServe/selfServeExample.spec.ts
-          - ./test/notebooks/upload.spec.ts
-          - ./test/sql/resourceToken.spec.ts
-          - ./test/tables/container.spec.ts
     steps:
       - uses: actions/checkout@v2
-      - name: Use Node.js 14.x
+      - name: Use Node.js 12.x
         uses: actions/setup-node@v1
         with:
-          node-version: 14.x
-      - run: npm ci
-      - run: npm start &
-      - run: npm run wait-for-server
-      - name: ${{ matrix['test-file'] }}
+          node-version: 12.x
+      - name: Accessibility Check
         run: |
-          # Run tests up to three times
-          for i in $(seq 1 3); do npx jest -c ./jest.config.playwright.js ${{ matrix['test-file'] }} && s=0 && break || s=$? && sleep 1; done; (exit $s)
+          # Ubuntu gets mad when webpack runs too many files watchers
+          cat /proc/sys/fs/inotify/max_user_watches
+          sudo sysctl fs.inotify.max_user_watches=524288
+          sudo sysctl -p
+          npm ci
+          npm start &
+          npx wait-on -i 5000 https-get://0.0.0.0:1234/
+          node utils/accesibilityCheck.js
         shell: bash
+        env:
+          NODE_TLS_REJECT_UNAUTHORIZED: 0
+  endtoendhosted:
+    name: "End to End Hosted Tests"
+    needs: [lint, format, compile, unittest]
+    runs-on: ubuntu-latest
+    steps:
+      - uses: actions/checkout@v2
+      - name: Use Node.js 12.x
+        uses: actions/setup-node@v1
+        with:
+          node-version: 12.x
+      - name: End to End Hosted Tests
+        run: |
+          npm ci
+          npm start &
+          npm run wait-for-server
+          npm run test:e2e
+        shell: bash
+        env:
+          NODE_TLS_REJECT_UNAUTHORIZED: 0
+          PORTAL_RUNNER_SUBSCRIPTION: ${{ secrets.PORTAL_RUNNER_SUBSCRIPTION }}
+          PORTAL_RUNNER_RESOURCE_GROUP: ${{ secrets.PORTAL_RUNNER_RESOURCE_GROUP }}
+          PORTAL_RUNNER_DATABASE_ACCOUNT: ${{ secrets.PORTAL_RUNNER_DATABASE_ACCOUNT }}
+          PORTAL_RUNNER_DATABASE_ACCOUNT_KEY: ${{ secrets.PORTAL_RUNNER_DATABASE_ACCOUNT_KEY }}
+          NOTEBOOKS_TEST_RUNNER_TENANT_ID: ${{ secrets.NOTEBOOKS_TEST_RUNNER_TENANT_ID }}
+          NOTEBOOKS_TEST_RUNNER_CLIENT_ID: ${{ secrets.NOTEBOOKS_TEST_RUNNER_CLIENT_ID }}
+          NOTEBOOKS_TEST_RUNNER_CLIENT_SECRET: ${{ secrets.NOTEBOOKS_TEST_RUNNER_CLIENT_SECRET }}
+          PORTAL_RUNNER_CONNECTION_STRING: ${{ secrets.CONNECTION_STRING_SQL }}
+          MONGO_CONNECTION_STRING: ${{ secrets.CONNECTION_STRING_MONGO }}
+          CASSANDRA_CONNECTION_STRING: ${{ secrets.CONNECTION_STRING_CASSANDRA }}
+          TABLES_CONNECTION_STRING: ${{ secrets.CONNECTION_STRING_TABLE }}
+          DATA_EXPLORER_ENDPOINT: "https://localhost:1234/hostedExplorer.html"
       - uses: actions/upload-artifact@v2
         if: failure()
         with:
           name: screenshots
-          path: screenshots/
+          path: failed-*
   nuget:
     name: Publish Nuget
     if: github.ref == 'refs/heads/master' || contains(github.ref, 'hotfix/') || contains(github.ref, 'release/')
-    needs: [build]
+    needs: [lint, format, compile, build, unittest, endtoendemulator, endtoendhosted, accessibility]
     runs-on: ubuntu-latest
     env:
       NUGET_SOURCE: ${{ secrets.NUGET_SOURCE }}
@@ -184,7 +183,7 @@ jobs:
       - run: cp ./configs/prod.json config.json
       - run: nuget sources add -Name "ADO" -Source "$NUGET_SOURCE" -UserName "GitHub" -Password "$AZURE_DEVOPS_PAT"
       - run: nuget pack -Version "2.0.0-github-${GITHUB_SHA}"
-      - run: nuget push -SkipDuplicate -Source "$NUGET_SOURCE" -ApiKey Az *.nupkg
+      - run: nuget push -Source "$NUGET_SOURCE" -ApiKey Az *.nupkg
       - uses: actions/upload-artifact@v2
         name: packages
         with:
@@ -192,7 +191,7 @@ jobs:
   nugetmpac:
     name: Publish Nuget MPAC
     if: github.ref == 'refs/heads/master' || contains(github.ref, 'hotfix/') || contains(github.ref, 'release/')
-    needs: [build]
+    needs: [lint, format, compile, build, unittest, endtoendemulator, endtoendhosted, accessibility]
     runs-on: ubuntu-latest
     env:
       NUGET_SOURCE: ${{ secrets.NUGET_SOURCE }}
@@ -209,7 +208,32 @@ jobs:
       - run: sed -i 's/Azure.Cosmos.DB.Data.Explorer/Azure.Cosmos.DB.Data.Explorer.MPAC/g' DataExplorer.nuspec
       - run: nuget sources add -Name "ADO" -Source "$NUGET_SOURCE" -UserName "GitHub" -Password "$AZURE_DEVOPS_PAT"
       - run: nuget pack -Version "2.0.0-github-${GITHUB_SHA}"
-      - run: nuget push -SkipDuplicate -Source "$NUGET_SOURCE" -ApiKey Az *.nupkg
+      - run: nuget push -Source "$NUGET_SOURCE" -ApiKey Az *.nupkg
+      - uses: actions/upload-artifact@v2
+        name: packages
+        with:
+          path: "*.nupkg"
+  nugetie:
+    name: Publish Nuget IE
+    if: github.ref == 'refs/heads/master' || contains(github.ref, 'hotfix/') || contains(github.ref, 'release/')
+    needs: [lint, format, compile, build, unittest, endtoendemulator, endtoendhosted, accessibility]
+    runs-on: ubuntu-latest
+    env:
+      NUGET_SOURCE: ${{ secrets.NUGET_SOURCE }}
+      AZURE_DEVOPS_PAT: ${{ secrets.AZURE_DEVOPS_PAT }}
+    steps:
+      - uses: nuget/setup-nuget@v1
+        with:
+          nuget-api-key: ${{ secrets.NUGET_API_KEY }}
+      - name: Download Dist Folder
+        uses: actions/download-artifact@v2
+        with:
+          name: dist
+      - run: cp ./configs/prod.json config.json
+      - run: sed -i 's/Azure.Cosmos.DB.Data.Explorer/Azure.Cosmos.DB.Data.Explorer.IE/g' DataExplorer.nuspec
+      - run: nuget sources add -Name "ADO" -Source "$NUGET_SOURCE" -UserName "GitHub" -Password "$AZURE_DEVOPS_PAT"
+      - run: nuget pack -Version "2.0.0-github-${GITHUB_SHA}"
+      - run: nuget push -Source "$NUGET_SOURCE" -ApiKey Az *.nupkg
       - uses: actions/upload-artifact@v2
         name: packages
         with:

.github/workflows/cleanup.yml

@@ -1,28 +0,0 @@
-# This is a basic workflow to help you get started with Actions
-
-name: Cleanup End to End Account Resources
-
-on:
-  # Allows you to run this workflow manually from the Actions tab
-  workflow_dispatch:
-  schedule:
-    # Once every hour
-    - cron: "0 15 * * *"
-
-# A workflow run is made up of one or more jobs that can run sequentially or in parallel
-jobs:
-  # This workflow contains a single job called "build"
-  cleanupaccounts:
-    name: "Cleanup Test Database Accounts"
-    runs-on: ubuntu-latest
-    env:
-      NOTEBOOKS_TEST_RUNNER_CLIENT_ID: ${{ secrets.NOTEBOOKS_TEST_RUNNER_CLIENT_ID }}
-      NOTEBOOKS_TEST_RUNNER_CLIENT_SECRET: ${{ secrets.NOTEBOOKS_TEST_RUNNER_CLIENT_SECRET }}
-    steps:
-      - uses: actions/checkout@v2
-      - name: Use Node.js 14.x
-        uses: actions/setup-node@v1
-        with:
-          node-version: 14.x
-      - run: npm ci
-      - run: node utils/cleanupDBs.js

.gitignore

@@ -14,6 +14,4 @@ Contracts/*
 .DS_Store
 .cache/
 .env
-failure.png
-screenshots/*
-GettingStarted-ignore*.ipynb
+failure.png

.vscode/settings.json

@@ -1,26 +1,21 @@
 // Place your settings in this file to overwrite default and user settings.
 {
-  "files.exclude": {
-    ".vs": true,
-    ".vscode/**": true,
-    "*.trx": true,
-    "**/.DS_Store": true,
-    "**/.git": true,
-    "**/.hg": true,
-    "**/.svn": true,
-    "built/**": true,
-    "coverage/**": true,
-    "libs/**": true,
-    "node_modules/**": true,
-    "package-lock.json": true,
-    "quickstart/**": true,
-    "test/out/**": true,
-    "workers/libs/**": true
-  },
-  "typescript.tsdk": "node_modules/typescript/lib",
-  "editor.formatOnSave": true,
-  "editor.codeActionsOnSave": {
-    "source.fixAll.eslint": true,
-    "source.organizeImports": true
-  }
-}
+    "files.exclude": {
+        ".vs": true,
+        ".vscode/**": true,
+        "*.trx": true,
+        "**/.DS_Store": true,
+        "**/.git": true,
+        "**/.hg": true,
+        "**/.svn": true,
+        "built/**": true,
+        "coverage/**": true,
+        "libs/**": true,
+        "node_modules/**": true,
+        "package-lock.json": true,
+        "quickstart/**": true,
+        "test/out/**": true,
+        "workers/libs/**": true
+    },
+    "typescript.tsdk": "node_modules/typescript/lib"
+}

CODING_GUIDELINES.md

@@ -1,190 +0,0 @@
-# Coding Guidelines and Recommendations
-
-Cosmos Explorer has been under constant development for over 5 years. As a result, there are many different patterns and practices in the codebase. This document serves as a guide to how we write code and helps avoid propagating practices which are no longer preferred. Each requirement in this document is labeled and color-coded to show the relative importance. In order from highest to lowest importance:
-
-✅ DO this. If you feel you need an exception, engage with the project owners _prior_ to implementation.
-
-⛔️ DO NOT do this. If you feel you need an exception, engage with the project owners _prior_ to implementation.
-
-☑️ YOU SHOULD strongly consider this but it is not a requirement. If not following this advice, please comment code with why and proactively begin a discussion as part of the PR process.
-
-⚠️ YOU SHOULD NOT strongly consider not doing this. If not following this advice, please comment code with why and proactively begin a discussion as part of the PR process.
-
-💭 YOU MAY consider this advice if appropriate to your situation. Other team members may comment on this as part of PR review, but there is no need to be proactive.
-
-## Development Environment
-
-☑️ YOU SHOULD
-
-- Use VSCode and install the following extensions. This setup will catch most linting/formatting/type errors as you develop:
-  - [Prettier](https://marketplace.visualstudio.com/items?itemName=esbenp.prettier-vscode)
-  - [ESLint](https://marketplace.visualstudio.com/items?itemName=dbaeumer.vscode-eslint)
-
-💭 YOU MAY
-
-- Use the [GitHub CLI](https://cli.github.com/). It has helpful workflows for submitting PRs as well as for checking out other team member's PRs.
-- Use Windows, Linux (including WSL), or OSX. We have team members developing on all three environments.
-
-✅ DO
-
-- Maintain cross-platform compatibility when modifying any engineering or build systems
-
-## Code Formatting
-
-✅ DO
-
-- Use [Prettier](https://prettier.io/) to format your code
-  - This will occur automatically if using the recommended editor setup
-  - `npm run format` will also format code
-
-## Linting
-
-✅ DO
-
-- Use [ESLint](https://eslint.org/) to check for code errors.
-  - This will occur automatically if using the recommended editor setup
-  - `npm run lint` will also check for linting errors
-
-💭 YOU MAY
-
-- Consider adding new lint rules.
-  - If you find yourself performing "nits" as part of PR review, consider adding a lint rule that will automatically catch the error in the future
-
-⚠️ YOU SHOULD NOT
-
-- Disable lint rules
-  - Lint rules exist as guidance and to catch common mistakes
-  - You will find places we disable specific lint rules however it should be exceptional.
-  - If a rule does need to be disabled, prefer disabling a specific line instead of the entire file.
-
-⛔️ DO NOT
-
-- Add [TSLint](https://palantir.github.io/tslint/) rules
-  - TSLint has been deprecated and is on track to be removed
-  - Always prefer ESLint rules
-
-## UI Components
-
-☑️ YOU SHOULD
-
-- Write new components using [React](https://reactjs.org/). We are actively migrating Cosmos Explorer off of [Knockout](https://knockoutjs.com/).
-- Use [Fluent](https://developer.microsoft.com/en-us/fluentui#/) components.
-  - Fluent components are designed to be highly accessible and composable
-  - Using Fluent allows us to build upon the work of the Fluent team and leads to a lower total cost of ownership for UI code
-
-### React
-
-☑️ YOU SHOULD
-
-- Use pure functional components when no state is required
-
-💭 YOU MAY
-
-- Use functional (hooks) or class components
-  - The project contains examples of both
-  - Neither is strongly preferred at this time
-
-⛔️ DO NOT
-
-- Use inheritance for sharing component behavior.
-  - React documentation covers this topic in detail https://reactjs.org/docs/composition-vs-inheritance.html
-- Suffix your file or component name with "Component"
-  - Even though the code has examples of it, we are ending the practice.
-
-## Libraries
-
-⚠️ YOU SHOULD NOT
-
-- Add new libraries to package.json.
-  - Adding libraries may bring in code that explodes the bundled size or attempts to run NodeJS code in the browser
-  - Consult with project owners for help with library selection if one is needed
-
-⛔️ DO NOT
-
-- Use underscore.js
-  - Much of this library is now native to JS and will be automatically transpiled
-- Use jQuery
-  - Much of this library is not native to the DOM.
-  - We are planning to remove it
-
-## Testing
-
-⛔️ DO NOT
-
-- Decrease test coverage
-  - Unit/Functional test coverage is checked as part of the CI process
-
-### Unit Tests
-
-✅ DO
-
-- Write unit tests for non-UI and utility code.
-- Write your tests using [Jest](https://jestjs.io/)
-
-☑️ YOU SHOULD
-
-- Abstract non-UI and utility code so it can run either the NodeJS or Browser environment
-
-### Functional(Component) Tests
-
-✅ DO
-
-- Write tests for UI components
-- Write your tests using [Jest](https://jestjs.io/)
-- Use either Enzyme or React Testing Library to perform component tests.
-
-### Mocking
-
-✅ DO
-
-- Use Jest's built-in mocking helpers
-
-☑️ YOU SHOULD
-
-- Write code that does not require mocking
-- Build components that do not require mocking extremely large or difficult to mock objects (like Explorer.ts). Pass _only_ what you need.
-
-⛔️ DO NOT
-
-- Use sinon.js for mocking
-  - Sinon has been deprecated and planned for removal
-
-### End to End Tests
-
-✅ DO
-
-- Use [Playwright](https://github.com/microsoft/playwright) and [Jest](https://jestjs.io/)
-- Write or modify an existing E2E test that covers the primary use case of any major feature.
-  - Use caution. Do not try to cover every case. End to End tests can be slow and brittle.
-
-☑️ YOU SHOULD
-
-- Write tests that use accessible attributes to perform actions. Role, Title, Label, etc
-  - More information https://testing-library.com/docs/queries/about#priority
-
-⚠️ YOU SHOULD NOT
-
-- Add test specfic `data-*` attributes to dom elements
-  - This is a common current practice, but one we would like to avoid in the future
-  - End to end tests need to use semantic HTML and accesible attributes to be truely end to end
-  - No user or screen reader actually navigates an app using `data-*` attributes
-- Add arbitrary time delays to wait for page to render or element to be ready.
-  - All the time delays add up and slow down testing.
-  - Prefer using the framework's "wait for..." functionality.
-
-### Migrating Knockout to React
-
-✅ DO
-
-- Consult other team members before beginning migration work. There is a significant amount of flux in patterns we are using and it is important we do not propagate incorrect patterns.
-- Start by converting HTML to JSX: https://magic.reactjs.net/htmltojsx.htm. Add functionality as a second step.
-
-☑️ YOU SHOULD
-
-- Write React components that require no dependency on Knockout or observables to trigger rendering.
-
-## Browser Support
-
-✅ DO
-
-- Support all [browsers supported by the Azure Portal](https://docs.microsoft.com/en-us/azure/azure-portal/azure-portal-supported-browsers-devices)

CONTRIBUTING.md

@@ -1,6 +1,6 @@
 # Contribution guidelines to Data Explorer
 
-This project welcomes contributions and suggestions. Most contributions require you to agree to a
+This project welcomes contributions and suggestions.  Most contributions require you to agree to a
 Contributor License Agreement (CLA) declaring that you have the right to, and actually do, grant us
 the rights to use your contribution. For details, visit https://cla.microsoft.com.
 
@@ -13,7 +13,6 @@ For more information see the [Code of Conduct FAQ](https://opensource.microsoft.
 contact [opencode@microsoft.com](mailto:opencode@microsoft.com) with any additional questions or comments.
 
 ## Microsoft Open Source Code of Conduct
-
 This project has adopted the [Microsoft Open Source Code of Conduct](https://opensource.microsoft.com/codeofconduct/).
 
 Resources:
@@ -21,3 +20,33 @@ Resources:
 - [Microsoft Open Source Code of Conduct](https://opensource.microsoft.com/codeofconduct/)
 - [Microsoft Code of Conduct FAQ](https://opensource.microsoft.com/codeofconduct/faq/)
 - Contact [opencode@microsoft.com](mailto:opencode@microsoft.com) with questions or concerns
+
+## Browser support
+Please make sure to support all modern browsers as well as Internet Explorer 11.
+For IE support, polyfill is preferred over new usage of lodash or underscore. We already polyfill almost everything by importing babel-polyfill at the top of entry points.
+
+
+## Coding guidelines, conventions and recommendations
+### Typescript
+* Follow this [typescript style guide](https://github.com/excelmicro/typescript) which is based on [airbnb's style  guide](https://github.com/airbnb/javascript).
+* Conventions speficic to this project:
+  - Use double-quotes for string
+  - Don't use `null`, use `undefined`
+  - Pascal case for private static readonly fields
+  - Camel case for classnames in markup
+* Don't use class unless necessary
+* Code related to notebooks should be dynamically imported so that it is loaded from a separate bundle only if the account is notebook-enabled. There are already top-level notebook components which are dynamically imported and their dependencies can be statically imported from these files.
+* Prefer using [Fluent UI controls](https://developer.microsoft.com/en-us/fluentui#/controls/web) over creating your own, in order to maintain consistency and support a11y.
+
+### React
+* Prefer using React class components over function components and hooks unless you have a simple component and require no nested functions:
+  * Nested functions may be harder to test independently
+  * Switching from function component to class component later mayb be painful
+
+## Testing
+Any PR should not decrease testing coverage.
+
+## Recommended Tools and VS Code extensions
+* [Bookmarks](https://github.com/alefragnani/vscode-bookmarks)
+* [Bracket pair colorizer](https://github.com/CoenraadS/Bracket-Pair-Colorizer-2)
+* [GitHub Pull Requests and Issues](https://github.com/Microsoft/vscode-pull-request-github)

README.md

@@ -18,6 +18,7 @@ Run `npm start` to start the development server and automatically rebuild on cha
 ### Hosted Development (https://cosmos.azure.com)
 
 - Visit: `https://localhost:1234/hostedExplorer.html`
+- Local sign in via AAD will NOT work. Connection string only in dev mode. Use the Portal if you need AAD auth.
 - The default webpack dev server configuration will proxy requests to the production portal backend: `https://main.documentdb.ext.azure.com`. This will allow you to use production connection strings on your local machine.
 
 ### Emulator Development
@@ -68,10 +69,6 @@ Jest and Puppeteer are used for end to end browser based tests and are contained
 
 We generally adhere to the release strategy [documented by the Azure SDK Guidelines](https://azure.github.io/azure-sdk/policies_repobranching.html#release-branches). Most releases should happen from the master branch. If master contains commits that cannot be released, you may create a release from a `release/` or `hotfix/` branch. See linked documentation for more details.
 
-### Architecture
-
-[![](https://mermaid.ink/img/eyJjb2RlIjoiZ3JhcGggTFJcbiAgaG9zdGVkKGh0dHBzOi8vY29zbW9zLmF6dXJlLmNvbSlcbiAgcG9ydGFsKFBvcnRhbClcbiAgZW11bGF0b3IoRW11bGF0b3IpXG4gIGFhZFtBQURdXG4gIHJlc291cmNlVG9rZW5bUmVzb3VyY2UgVG9rZW5dXG4gIGNvbm5lY3Rpb25TdHJpbmdbQ29ubmVjdGlvbiBTdHJpbmddXG4gIHBvcnRhbFRva2VuW0VuY3J5cHRlZCBQb3J0YWwgVG9rZW5dXG4gIG1hc3RlcktleVtNYXN0ZXIgS2V5XVxuICBhcm1bQVJNIFJlc291cmNlIFByb3ZpZGVyXVxuICBkYXRhcGxhbmVbRGF0YSBQbGFuZV1cbiAgcHJveHlbUG9ydGFsIEFQSSBQcm94eV1cbiAgc3FsW1NRTF1cbiAgbW9uZ29bTW9uZ29dXG4gIHRhYmxlc1tUYWJsZXNdXG4gIGNhc3NhbmRyYVtDYXNzYW5kcmFdXG4gIGdyYWZbR3JhcGhdXG5cblxuICBlbXVsYXRvciAtLT4gbWFzdGVyS2V5IC0tLS0-IGRhdGFwbGFuZVxuICBwb3J0YWwgLS0-IGFhZFxuICBob3N0ZWQgLS0-IHBvcnRhbFRva2VuICYgcmVzb3VyY2VUb2tlbiAmIGNvbm5lY3Rpb25TdHJpbmcgJiBhYWRcbiAgYWFkIC0tLT4gYXJtXG4gIGFhZCAtLS0-IGRhdGFwbGFuZVxuICBhYWQgLS0tPiBwcm94eVxuICByZXNvdXJjZVRva2VuIC0tLT4gc3FsIC0tPiBkYXRhcGxhbmVcbiAgcG9ydGFsVG9rZW4gLS0tPiBwcm94eVxuICBwcm94eSAtLT4gZGF0YXBsYW5lXG4gIGNvbm5lY3Rpb25TdHJpbmcgLS0-IHNxbCAmIG1vbmdvICYgY2Fzc2FuZHJhICYgZ3JhZiAmIHRhYmxlc1xuICBzcWwgLS0-IGRhdGFwbGFuZVxuICB0YWJsZXMgLS0-IGRhdGFwbGFuZVxuICBtb25nbyAtLT4gcHJveHlcbiAgY2Fzc2FuZHJhIC0tPiBwcm94eVxuICBncmFmIC0tPiBwcm94eVxuXG5cdFx0IiwibWVybWFpZCI6eyJ0aGVtZSI6ImRlZmF1bHQifSwidXBkYXRlRWRpdG9yIjpmYWxzZX0)](https://mermaid-js.github.io/mermaid-live-editor/#/edit/eyJjb2RlIjoiZ3JhcGggTFJcbiAgaG9zdGVkKGh0dHBzOi8vY29zbW9zLmF6dXJlLmNvbSlcbiAgcG9ydGFsKFBvcnRhbClcbiAgZW11bGF0b3IoRW11bGF0b3IpXG4gIGFhZFtBQURdXG4gIHJlc291cmNlVG9rZW5bUmVzb3VyY2UgVG9rZW5dXG4gIGNvbm5lY3Rpb25TdHJpbmdbQ29ubmVjdGlvbiBTdHJpbmddXG4gIHBvcnRhbFRva2VuW0VuY3J5cHRlZCBQb3J0YWwgVG9rZW5dXG4gIG1hc3RlcktleVtNYXN0ZXIgS2V5XVxuICBhcm1bQVJNIFJlc291cmNlIFByb3ZpZGVyXVxuICBkYXRhcGxhbmVbRGF0YSBQbGFuZV1cbiAgcHJveHlbUG9ydGFsIEFQSSBQcm94eV1cbiAgc3FsW1NRTF1cbiAgbW9uZ29bTW9uZ29dXG4gIHRhYmxlc1tUYWJsZXNdXG4gIGNhc3NhbmRyYVtDYXNzYW5kcmFdXG4gIGdyYWZbR3JhcGhdXG5cblxuICBlbXVsYXRvciAtLT4gbWFzdGVyS2V5IC0tLS0-IGRhdGFwbGFuZVxuICBwb3J0YWwgLS0-IGFhZFxuICBob3N0ZWQgLS0-IHBvcnRhbFRva2VuICYgcmVzb3VyY2VUb2tlbiAmIGNvbm5lY3Rpb25TdHJpbmcgJiBhYWRcbiAgYWFkIC0tLT4gYXJtXG4gIGFhZCAtLS0-IGRhdGFwbGFuZVxuICBhYWQgLS0tPiBwcm94eVxuICByZXNvdXJjZVRva2VuIC0tLT4gc3FsIC0tPiBkYXRhcGxhbmVcbiAgcG9ydGFsVG9rZW4gLS0tPiBwcm94eVxuICBwcm94eSAtLT4gZGF0YXBsYW5lXG4gIGNvbm5lY3Rpb25TdHJpbmcgLS0-IHNxbCAmIG1vbmdvICYgY2Fzc2FuZHJhICYgZ3JhZiAmIHRhYmxlc1xuICBzcWwgLS0-IGRhdGFwbGFuZVxuICB0YWJsZXMgLS0-IGRhdGFwbGFuZVxuICBtb25nbyAtLT4gcHJveHlcbiAgY2Fzc2FuZHJhIC0tPiBwcm94eVxuICBncmFmIC0tPiBwcm94eVxuXG5cdFx0IiwibWVybWFpZCI6eyJ0aGVtZSI6ImRlZmF1bHQifSwidXBkYXRlRWRpdG9yIjpmYWxzZX0)
-
 # Contributing
 
 Please read the [contribution guidelines](./CONTRIBUTING.md).

babel.config.js

@@ -1,4 +1,3 @@
 module.exports = {
-  presets: [["@babel/preset-env", { targets: { node: "current" } }], "@babel/preset-react", "@babel/preset-typescript"],
-  plugins: [["@babel/plugin-proposal-decorators", { legacy: true }]],
+  presets: [["@babel/preset-env", { targets: { node: "current" } }], "@babel/preset-react", "@babel/preset-typescript"]
 };

canvas/README.md

@@ -1,7 +0,0 @@
-# Why?
-
-This adds a mock module for `canvas`. Nteract has a ignored require and undeclared dependency on this module. `cavnas` is a server side node module and is not used in browser side code for nteract.
-
-Installing it locally (`npm install canvas`) will resolve the problem, but it is a native module so it is flaky depending on the system, node version, processor arch, etc. This module provides a simpler, more robust solution.
-
-Remove this workaround if [this bug](https://github.com/nteract/any-vega/issues/2) ever gets resolved 

canvas/index.js

@@ -1 +0,0 @@
-module.exports = {}

canvas/package.json

@@ -1,11 +0,0 @@
-{
-  "name": "canvas",
-  "version": "1.0.0",
-  "description": "",
-  "main": "index.js",
-  "scripts": {
-    "test": "echo \"Error: no test specified\" && exit 1"
-  },
-  "author": "",
-  "license": "ISC"
-}

configs/mpac.json

@@ -1,3 +1,3 @@
 {
-  "JUNO_ENDPOINT": "https://tools-staging.cosmos.azure.com"
-}
+ "JUNO_ENDPOINT": "https://tools-staging.cosmos.azure.com"
+}

docs/classes/selfserve_selfservetypes.selfservebaseclass.html

@@ -1,306 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>SelfServeBaseClass | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
-				</li>
-				<li>
-					<a href="selfserve_selfservetypes.selfservebaseclass.html">SelfServeBaseClass</a>
-				</li>
-			</ul>
-			<h1>Class SelfServeBaseClass</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel tsd-comment">
-				<div class="tsd-comment tsd-typography">
-					<div class="lead">
-						<p>All SelfServe feature classes need to derive from the SelfServeBaseClass</p>
-					</div>
-				</div>
-			</section>
-			<section class="tsd-panel tsd-hierarchy">
-				<h3>Hierarchy</h3>
-				<ul class="tsd-hierarchy">
-					<li>
-						<span class="target">SelfServeBaseClass</span>
-					</li>
-				</ul>
-			</section>
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Constructors</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-constructor tsd-parent-kind-class"><a href="selfserve_selfservetypes.selfservebaseclass.html#constructor" class="tsd-kind-icon">constructor</a></li>
-							</ul>
-						</section>
-						<section class="tsd-index-section ">
-							<h3>Properties</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-property tsd-parent-kind-class"><a href="selfserve_selfservetypes.selfservebaseclass.html#initialize" class="tsd-kind-icon">initialize</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-class"><a href="selfserve_selfservetypes.selfservebaseclass.html#onrefresh" class="tsd-kind-icon">on<wbr>Refresh</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-class"><a href="selfserve_selfservetypes.selfservebaseclass.html#onsave" class="tsd-kind-icon">on<wbr>Save</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Constructors</h2>
-				<section class="tsd-panel tsd-member tsd-kind-constructor tsd-parent-kind-class">
-					<a name="constructor" class="tsd-anchor"></a>
-					<h3>constructor</h3>
-					<ul class="tsd-signatures tsd-kind-constructor tsd-parent-kind-class">
-						<li class="tsd-signature tsd-kind-icon">new <wbr>Self<wbr>Serve<wbr>Base<wbr>Class<span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><a href="selfserve_selfservetypes.selfservebaseclass.html" class="tsd-signature-type" data-tsd-kind="Class">SelfServeBaseClass</a></li>
-					</ul>
-					<ul class="tsd-descriptions">
-						<li class="tsd-description">
-							<aside class="tsd-sources">
-							</aside>
-							<h4 class="tsd-returns-title">Returns <a href="selfserve_selfservetypes.selfservebaseclass.html" class="tsd-signature-type" data-tsd-kind="Class">SelfServeBaseClass</a></h4>
-						</li>
-					</ul>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Properties</h2>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-class">
-					<a name="initialize" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagAbstract">Abstract</span> initialize</h3>
-					<div class="tsd-signature tsd-kind-icon">initialize<span class="tsd-signature-symbol">:</span> <a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-signature-type" data-tsd-kind="Type alias">initializeCallback</a></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Sets default values for the properties of the Self Serve Class. Typically, you can make rest calls here
-							to fetch the initial values for the properties. This is also called after the onSave callback, to reinitialize the defaults.</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-class">
-					<a name="onrefresh" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagAbstract">Abstract</span> on<wbr>Refresh</h3>
-					<div class="tsd-signature tsd-kind-icon">on<wbr>Refresh<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="../interfaces/selfserve_selfservetypes.refreshresult.html" class="tsd-signature-type" data-tsd-kind="Interface">RefreshResult</a><span class="tsd-signature-symbol">&gt;</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Callback that is triggered when the refresh button is clicked. Here, you should perform the your rest API
-							call to check if the update action is completed.</p>
-						</div>
-					</div>
-					<div class="tsd-type-declaration">
-						<h4>Type declaration</h4>
-						<ul class="tsd-parameters">
-							<li class="tsd-parameter-signature">
-								<ul class="tsd-signatures tsd-kind-type-literal tsd-parent-kind-class">
-									<li class="tsd-signature tsd-kind-icon"><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="../interfaces/selfserve_selfservetypes.refreshresult.html" class="tsd-signature-type" data-tsd-kind="Interface">RefreshResult</a><span class="tsd-signature-symbol">&gt;</span></li>
-								</ul>
-								<ul class="tsd-descriptions">
-									<li class="tsd-description">
-										<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="../interfaces/selfserve_selfservetypes.refreshresult.html" class="tsd-signature-type" data-tsd-kind="Interface">RefreshResult</a><span class="tsd-signature-symbol">&gt;</span></h4>
-									</li>
-								</ul>
-							</li>
-						</ul>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-class">
-					<a name="onsave" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagAbstract">Abstract</span> on<wbr>Save</h3>
-					<div class="tsd-signature tsd-kind-icon">on<wbr>Save<span class="tsd-signature-symbol">:</span> <a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-signature-type" data-tsd-kind="Type alias">onSaveCallback</a></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Callback that is triggerred when the submit button is clicked. You should perform your rest API
-							calls here using the data from the different inputs passed as a Map to this callback function.</p>
-						</div>
-					</div>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
-					</li>
-				</ul>
-				<ul class="current">
-					<li class="current tsd-kind-class tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
-						<ul>
-							<li class=" tsd-kind-constructor tsd-parent-kind-class">
-								<a href="selfserve_selfservetypes.selfservebaseclass.html#constructor" class="tsd-kind-icon">constructor</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-class">
-								<a href="selfserve_selfservetypes.selfservebaseclass.html#initialize" class="tsd-kind-icon">initialize</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-class">
-								<a href="selfserve_selfservetypes.selfservebaseclass.html#onrefresh" class="tsd-kind-icon">on<wbr>Refresh</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-class">
-								<a href="selfserve_selfservetypes.selfservebaseclass.html#onsave" class="tsd-kind-icon">on<wbr>Save</a>
-							</li>
-						</ul>
-					</li>
-				</ul>
-				<ul class="after-current">
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-				<li class="tsd-kind-constructor tsd-parent-kind-class"><span class="tsd-kind-icon">Constructor</span></li>
-				<li class="tsd-kind-property tsd-parent-kind-class"><span class="tsd-kind-icon">Property</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/enums/selfserve_selfservetypes.descriptiontype.html

@@ -1,245 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>DescriptionType | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
-				</li>
-				<li>
-					<a href="selfserve_selfservetypes.descriptiontype.html">DescriptionType</a>
-				</li>
-			</ul>
-			<h1>Enumeration DescriptionType</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Enumeration members</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfservetypes.descriptiontype.html#infomessagebar" class="tsd-kind-icon">Info<wbr>Message<wbr>Bar</a></li>
-								<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfservetypes.descriptiontype.html#text" class="tsd-kind-icon">Text</a></li>
-								<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfservetypes.descriptiontype.html#warningmessagebar" class="tsd-kind-icon">Warning<wbr>Message<wbr>Bar</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Enumeration members</h2>
-				<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
-					<a name="infomessagebar" class="tsd-anchor"></a>
-					<h3>Info<wbr>Message<wbr>Bar</h3>
-					<div class="tsd-signature tsd-kind-icon">Info<wbr>Message<wbr>Bar<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = 1</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Show the description as a Info Message bar.</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
-					<a name="text" class="tsd-anchor"></a>
-					<h3>Text</h3>
-					<div class="tsd-signature tsd-kind-icon">Text<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = 0</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Show the description as a text</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
-					<a name="warningmessagebar" class="tsd-anchor"></a>
-					<h3>Warning<wbr>Message<wbr>Bar</h3>
-					<div class="tsd-signature tsd-kind-icon">Warning<wbr>Message<wbr>Bar<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = 2</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Show the description as a Warning Message bar.</p>
-						</div>
-					</div>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-				</ul>
-				<ul class="current">
-					<li class="current tsd-kind-enum tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
-						<ul>
-							<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
-								<a href="selfserve_selfservetypes.descriptiontype.html#infomessagebar" class="tsd-kind-icon">Info<wbr>Message<wbr>Bar</a>
-							</li>
-							<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
-								<a href="selfserve_selfservetypes.descriptiontype.html#text" class="tsd-kind-icon">Text</a>
-							</li>
-							<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
-								<a href="selfserve_selfservetypes.descriptiontype.html#warningmessagebar" class="tsd-kind-icon">Warning<wbr>Message<wbr>Bar</a>
-							</li>
-						</ul>
-					</li>
-				</ul>
-				<ul class="after-current">
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
-					</li>
-					<li class=" tsd-kind-class tsd-parent-kind-module">
-						<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/enums/selfserve_selfservetypes.numberuitype.html

@@ -1,229 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>NumberUiType | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
-				</li>
-				<li>
-					<a href="selfserve_selfservetypes.numberuitype.html">NumberUiType</a>
-				</li>
-			</ul>
-			<h1>Enumeration NumberUiType</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Enumeration members</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfservetypes.numberuitype.html#slider" class="tsd-kind-icon">Slider</a></li>
-								<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfservetypes.numberuitype.html#spinner" class="tsd-kind-icon">Spinner</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Enumeration members</h2>
-				<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
-					<a name="slider" class="tsd-anchor"></a>
-					<h3>Slider</h3>
-					<div class="tsd-signature tsd-kind-icon">Slider<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = &quot;Slider&quot;</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>The numeric input UI element corresponding to the property is a Slider</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
-					<a name="spinner" class="tsd-anchor"></a>
-					<h3>Spinner</h3>
-					<div class="tsd-signature tsd-kind-icon">Spinner<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = &quot;Spinner&quot;</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>The numeric input UI element corresponding to the property is a Spinner</p>
-						</div>
-					</div>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
-					</li>
-				</ul>
-				<ul class="current">
-					<li class="current tsd-kind-enum tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
-						<ul>
-							<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
-								<a href="selfserve_selfservetypes.numberuitype.html#slider" class="tsd-kind-icon">Slider</a>
-							</li>
-							<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
-								<a href="selfserve_selfservetypes.numberuitype.html#spinner" class="tsd-kind-icon">Spinner</a>
-							</li>
-						</ul>
-					</li>
-				</ul>
-				<ul class="after-current">
-					<li class=" tsd-kind-class tsd-parent-kind-module">
-						<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/enums/selfserve_selfserveutils.bladetype.html

@@ -1,264 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>BladeType | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="../modules/selfserve_selfserveutils.html">SelfServe/SelfServeUtils</a>
-				</li>
-				<li>
-					<a href="selfserve_selfserveutils.bladetype.html">BladeType</a>
-				</li>
-			</ul>
-			<h1>Enumeration BladeType</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel tsd-comment">
-				<div class="tsd-comment tsd-typography">
-					<div class="lead">
-						<p>Portal Blade types</p>
-					</div>
-				</div>
-			</section>
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Enumeration members</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfserveutils.bladetype.html#cassandrakeys" class="tsd-kind-icon">Cassandra<wbr>Keys</a></li>
-								<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfserveutils.bladetype.html#gremlinkeys" class="tsd-kind-icon">Gremlin<wbr>Keys</a></li>
-								<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfserveutils.bladetype.html#metrics" class="tsd-kind-icon">Metrics</a></li>
-								<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfserveutils.bladetype.html#mongokeys" class="tsd-kind-icon">Mongo<wbr>Keys</a></li>
-								<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfserveutils.bladetype.html#sqlkeys" class="tsd-kind-icon">Sql<wbr>Keys</a></li>
-								<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfserveutils.bladetype.html#tablekeys" class="tsd-kind-icon">Table<wbr>Keys</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Enumeration members</h2>
-				<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
-					<a name="cassandrakeys" class="tsd-anchor"></a>
-					<h3>Cassandra<wbr>Keys</h3>
-					<div class="tsd-signature tsd-kind-icon">Cassandra<wbr>Keys<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = &quot;cassandraDbKeys&quot;</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Keys blade of a Cassandra API account.</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
-					<a name="gremlinkeys" class="tsd-anchor"></a>
-					<h3>Gremlin<wbr>Keys</h3>
-					<div class="tsd-signature tsd-kind-icon">Gremlin<wbr>Keys<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = &quot;keys&quot;</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Keys blade of a Gremlin API account.</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
-					<a name="metrics" class="tsd-anchor"></a>
-					<h3>Metrics</h3>
-					<div class="tsd-signature tsd-kind-icon">Metrics<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = &quot;metrics&quot;</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Metrics blade of an Azure Cosmos DB account.</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
-					<a name="mongokeys" class="tsd-anchor"></a>
-					<h3>Mongo<wbr>Keys</h3>
-					<div class="tsd-signature tsd-kind-icon">Mongo<wbr>Keys<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = &quot;mongoDbKeys&quot;</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Keys blade of a Mongo API account.</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
-					<a name="sqlkeys" class="tsd-anchor"></a>
-					<h3>Sql<wbr>Keys</h3>
-					<div class="tsd-signature tsd-kind-icon">Sql<wbr>Keys<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = &quot;keys&quot;</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Keys blade of a SQL API account.</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
-					<a name="tablekeys" class="tsd-anchor"></a>
-					<h3>Table<wbr>Keys</h3>
-					<div class="tsd-signature tsd-kind-icon">Table<wbr>Keys<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = &quot;tableKeys&quot;</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Keys blade of a Table API account.</p>
-						</div>
-					</div>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-				</ul>
-				<ul class="current">
-					<li class="current tsd-kind-enum tsd-parent-kind-module">
-						<a href="selfserve_selfserveutils.bladetype.html" class="tsd-kind-icon">Blade<wbr>Type</a>
-						<ul>
-							<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
-								<a href="selfserve_selfserveutils.bladetype.html#cassandrakeys" class="tsd-kind-icon">Cassandra<wbr>Keys</a>
-							</li>
-							<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
-								<a href="selfserve_selfserveutils.bladetype.html#gremlinkeys" class="tsd-kind-icon">Gremlin<wbr>Keys</a>
-							</li>
-							<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
-								<a href="selfserve_selfserveutils.bladetype.html#metrics" class="tsd-kind-icon">Metrics</a>
-							</li>
-							<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
-								<a href="selfserve_selfserveutils.bladetype.html#mongokeys" class="tsd-kind-icon">Mongo<wbr>Keys</a>
-							</li>
-							<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
-								<a href="selfserve_selfserveutils.bladetype.html#sqlkeys" class="tsd-kind-icon">Sql<wbr>Keys</a>
-							</li>
-							<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
-								<a href="selfserve_selfserveutils.bladetype.html#tablekeys" class="tsd-kind-icon">Table<wbr>Keys</a>
-							</li>
-						</ul>
-					</li>
-				</ul>
-				<ul class="after-current">
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="selfserve_selfserveutils.selfservetype.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfserveutils.html#generatebladelink" class="tsd-kind-icon">generate<wbr>Blade<wbr>Link</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/enums/selfserve_selfserveutils.selfservetype.html

@@ -1,201 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>SelfServeType | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="../modules/selfserve_selfserveutils.html">SelfServe/SelfServeUtils</a>
-				</li>
-				<li>
-					<a href="selfserve_selfserveutils.selfservetype.html">SelfServeType</a>
-				</li>
-			</ul>
-			<h1>Enumeration SelfServeType</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel tsd-comment">
-				<div class="tsd-comment tsd-typography">
-					<div class="lead">
-						<p>The type used to identify the Self Serve Class</p>
-					</div>
-				</div>
-			</section>
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Enumeration members</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfserveutils.selfservetype.html#example" class="tsd-kind-icon">example</a></li>
-								<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfserveutils.selfservetype.html#invalid" class="tsd-kind-icon">invalid</a></li>
-								<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfserveutils.selfservetype.html#sqlx" class="tsd-kind-icon">sqlx</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Enumeration members</h2>
-				<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
-					<a name="example" class="tsd-anchor"></a>
-					<h3>example</h3>
-					<div class="tsd-signature tsd-kind-icon">example<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = &quot;example&quot;</span></div>
-					<aside class="tsd-sources">
-					</aside>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
-					<a name="invalid" class="tsd-anchor"></a>
-					<h3>invalid</h3>
-					<div class="tsd-signature tsd-kind-icon">invalid<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = &quot;invalid&quot;</span></div>
-					<aside class="tsd-sources">
-					</aside>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
-					<a name="sqlx" class="tsd-anchor"></a>
-					<h3>sqlx</h3>
-					<div class="tsd-signature tsd-kind-icon">sqlx<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = &quot;sqlx&quot;</span></div>
-					<aside class="tsd-sources">
-					</aside>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="selfserve_selfserveutils.bladetype.html" class="tsd-kind-icon">Blade<wbr>Type</a>
-					</li>
-				</ul>
-				<ul class="current">
-					<li class="current tsd-kind-enum tsd-parent-kind-module">
-						<a href="selfserve_selfserveutils.selfservetype.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Type</a>
-						<ul>
-							<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
-								<a href="selfserve_selfserveutils.selfservetype.html#example" class="tsd-kind-icon">example</a>
-							</li>
-							<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
-								<a href="selfserve_selfserveutils.selfservetype.html#invalid" class="tsd-kind-icon">invalid</a>
-							</li>
-							<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
-								<a href="selfserve_selfserveutils.selfservetype.html#sqlx" class="tsd-kind-icon">sqlx</a>
-							</li>
-						</ul>
-					</li>
-				</ul>
-				<ul class="after-current">
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfserveutils.html#generatebladelink" class="tsd-kind-icon">generate<wbr>Blade<wbr>Link</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/index.html

@@ -1,209 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="assets/css/main.css">
-	<script async src="assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="assets/js/search.json" data-base=".">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<h1>cosmos-explorer</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<div class="tsd-panel tsd-typography">
-				<a href="#cosmos-db-explorer" id="cosmos-db-explorer" style="color: inherit; text-decoration: none;">
-					<h1>Cosmos DB Explorer</h1>
-				</a>
-				<p>UI for Azure Cosmos DB. Powers the <a href="https://portal.azure.com/">Azure Portal</a>, <a href="https://cosmos.azure.com/">https://cosmos.azure.com/</a>, and the <a href="https://docs.microsoft.com/en-us/azure/cosmos-db/local-emulator">Cosmos DB Emulator</a></p>
-				<p><img src="https://sdkctlstore.blob.core.windows.net/exe/dataexplorer.gif" alt=""></p>
-				<a href="#getting-started" id="getting-started" style="color: inherit; text-decoration: none;">
-					<h2>Getting Started</h2>
-				</a>
-				<ul>
-					<li><code>npm install</code></li>
-					<li><code>npm run build</code></li>
-				</ul>
-				<a href="#developing" id="developing" style="color: inherit; text-decoration: none;">
-					<h2>Developing</h2>
-				</a>
-				<a href="#watch-mode" id="watch-mode" style="color: inherit; text-decoration: none;">
-					<h3>Watch mode</h3>
-				</a>
-				<p>Run <code>npm start</code> to start the development server and automatically rebuild on changes</p>
-				<a href="#hosted-development-httpscosmosazurecom" id="hosted-development-httpscosmosazurecom" style="color: inherit; text-decoration: none;">
-					<h3>Hosted Development (<a href="https://cosmos.azure.com">https://cosmos.azure.com</a>)</h3>
-				</a>
-				<ul>
-					<li>Visit: <code>https://localhost:1234/hostedExplorer.html</code></li>
-					<li>The default webpack dev server configuration will proxy requests to the production portal backend: <code>https://main.documentdb.ext.azure.com</code>. This will allow you to use production connection strings on your local machine.</li>
-				</ul>
-				<a href="#emulator-development" id="emulator-development" style="color: inherit; text-decoration: none;">
-					<h3>Emulator Development</h3>
-				</a>
-				<ul>
-					<li>Start the Cosmos Emulator</li>
-					<li>Visit: <a href="https://localhost:1234/index.html">https://localhost:1234/index.html</a></li>
-				</ul>
-				<a href="#setting-up-a-remote-emulator" id="setting-up-a-remote-emulator" style="color: inherit; text-decoration: none;">
-					<h4>Setting up a Remote Emulator</h4>
-				</a>
-				<p>The Cosmos emulator currently only runs in Windows environments. You can still develop on a non-Windows machine by setting up an emulator on a windows box and exposing its ports publicly:</p>
-				<ol>
-					<li><p>Expose these ports publicly: 8081, 8900, 8979, 10250, 10251, 10252, 10253, 10254, 10255, 10256</p>
-					</li>
-					<li><p>Download and install the emulator: <a href="https://docs.microsoft.com/en-us/azure/cosmos-db/local-emulator">https://docs.microsoft.com/en-us/azure/cosmos-db/local-emulator</a></p>
-					</li>
-					<li><p>Start the emulator from PowerShell:</p>
-					</li>
-				</ol>
-				<pre><code><span style="color: #000000">&gt; </span><span style="color: #001080">cd</span><span style="color: #000000"> C:/</span>
-
-<span style="color: #000000">&gt; .\</span><span style="color: #001080">CosmosDB</span><span style="color: #000000">.</span><span style="color: #001080">Emulator</span><span style="color: #000000">.</span><span style="color: #001080">exe</span><span style="color: #000000"> -</span><span style="color: #001080">AllowNetworkAccess</span><span style="color: #000000"> -</span><span style="color: #001080">Key</span><span style="color: #000000">=</span><span style="color: #A31515">&quot;&lt;EMULATOR MASTER KEY&gt;&quot;</span>
-</code></pre>
-				<a href="#portal-development" id="portal-development" style="color: inherit; text-decoration: none;">
-					<h3>Portal Development</h3>
-				</a>
-				<ul>
-					<li>Visit: <a href="https://ms.portal.azure.com/?dataExplorerSource=https%3A%2F%2Flocalhost%3A1234%2Fexplorer.html">https://ms.portal.azure.com/?dataExplorerSource=https%3A%2F%2Flocalhost%3A1234%2Fexplorer.html</a></li>
-					<li>You may have to manually visit <a href="https://localhost:1234/explorer.html">https://localhost:1234/explorer.html</a> first and click through any SSL certificate warnings</li>
-				</ul>
-				<a href="#testing" id="testing" style="color: inherit; text-decoration: none;">
-					<h3>Testing</h3>
-				</a>
-				<a href="#unit-tests" id="unit-tests" style="color: inherit; text-decoration: none;">
-					<h4>Unit Tests</h4>
-				</a>
-				<p>Unit tests are located adjacent to the code under test and run with <a href="https://jestjs.io/">Jest</a>:</p>
-				<p><code>npm run test</code></p>
-				<a href="#end-to-end-ci-tests" id="end-to-end-ci-tests" style="color: inherit; text-decoration: none;">
-					<h4>End to End CI Tests</h4>
-				</a>
-				<p>Jest and Puppeteer are used for end to end browser based tests and are contained in <code>test/</code>. To run these tests locally:</p>
-				<ol>
-					<li>Copy .env.example to .env</li>
-					<li>Update the values in .env including your local data explorer endpoint (ask a teammate/codeowner for help with .env values)</li>
-					<li>Make sure all packages are installed <code>npm install</code></li>
-					<li>Run the server <code>npm run start</code> and wait for it to start</li>
-					<li>Run <code>npm run test:e2e</code></li>
-				</ol>
-				<a href="#releasing" id="releasing" style="color: inherit; text-decoration: none;">
-					<h3>Releasing</h3>
-				</a>
-				<p>We generally adhere to the release strategy <a href="https://azure.github.io/azure-sdk/policies_repobranching.html#release-branches">documented by the Azure SDK Guidelines</a>. Most releases should happen from the master branch. If master contains commits that cannot be released, you may create a release from a <code>release/</code> or <code>hotfix/</code> branch. See linked documentation for more details.</p>
-				<a href="#architecture" id="architecture" style="color: inherit; text-decoration: none;">
-					<h3>Architecture</h3>
-				</a>
-				<p><a href="https://mermaid-js.github.io/mermaid-live-editor/#/edit/eyJjb2RlIjoiZ3JhcGggTFJcbiAgaG9zdGVkKGh0dHBzOi8vY29zbW9zLmF6dXJlLmNvbSlcbiAgcG9ydGFsKFBvcnRhbClcbiAgZW11bGF0b3IoRW11bGF0b3IpXG4gIGFhZFtBQURdXG4gIHJlc291cmNlVG9rZW5bUmVzb3VyY2UgVG9rZW5dXG4gIGNvbm5lY3Rpb25TdHJpbmdbQ29ubmVjdGlvbiBTdHJpbmddXG4gIHBvcnRhbFRva2VuW0VuY3J5cHRlZCBQb3J0YWwgVG9rZW5dXG4gIG1hc3RlcktleVtNYXN0ZXIgS2V5XVxuICBhcm1bQVJNIFJlc291cmNlIFByb3ZpZGVyXVxuICBkYXRhcGxhbmVbRGF0YSBQbGFuZV1cbiAgcHJveHlbUG9ydGFsIEFQSSBQcm94eV1cbiAgc3FsW1NRTF1cbiAgbW9uZ29bTW9uZ29dXG4gIHRhYmxlc1tUYWJsZXNdXG4gIGNhc3NhbmRyYVtDYXNzYW5kcmFdXG4gIGdyYWZbR3JhcGhdXG5cblxuICBlbXVsYXRvciAtLT4gbWFzdGVyS2V5IC0tLS0-IGRhdGFwbGFuZVxuICBwb3J0YWwgLS0-IGFhZFxuICBob3N0ZWQgLS0-IHBvcnRhbFRva2VuICYgcmVzb3VyY2VUb2tlbiAmIGNvbm5lY3Rpb25TdHJpbmcgJiBhYWRcbiAgYWFkIC0tLT4gYXJtXG4gIGFhZCAtLS0-IGRhdGFwbGFuZVxuICBhYWQgLS0tPiBwcm94eVxuICByZXNvdXJjZVRva2VuIC0tLT4gc3FsIC0tPiBkYXRhcGxhbmVcbiAgcG9ydGFsVG9rZW4gLS0tPiBwcm94eVxuICBwcm94eSAtLT4gZGF0YXBsYW5lXG4gIGNvbm5lY3Rpb25TdHJpbmcgLS0-IHNxbCAmIG1vbmdvICYgY2Fzc2FuZHJhICYgZ3JhZiAmIHRhYmxlc1xuICBzcWwgLS0-IGRhdGFwbGFuZVxuICB0YWJsZXMgLS0-IGRhdGFwbGFuZVxuICBtb25nbyAtLT4gcHJveHlcbiAgY2Fzc2FuZHJhIC0tPiBwcm94eVxuICBncmFmIC0tPiBwcm94eVxuXG5cdFx0IiwibWVybWFpZCI6eyJ0aGVtZSI6ImRlZmF1bHQifSwidXBkYXRlRWRpdG9yIjpmYWxzZX0"><img src="https://mermaid.ink/img/eyJjb2RlIjoiZ3JhcGggTFJcbiAgaG9zdGVkKGh0dHBzOi8vY29zbW9zLmF6dXJlLmNvbSlcbiAgcG9ydGFsKFBvcnRhbClcbiAgZW11bGF0b3IoRW11bGF0b3IpXG4gIGFhZFtBQURdXG4gIHJlc291cmNlVG9rZW5bUmVzb3VyY2UgVG9rZW5dXG4gIGNvbm5lY3Rpb25TdHJpbmdbQ29ubmVjdGlvbiBTdHJpbmddXG4gIHBvcnRhbFRva2VuW0VuY3J5cHRlZCBQb3J0YWwgVG9rZW5dXG4gIG1hc3RlcktleVtNYXN0ZXIgS2V5XVxuICBhcm1bQVJNIFJlc291cmNlIFByb3ZpZGVyXVxuICBkYXRhcGxhbmVbRGF0YSBQbGFuZV1cbiAgcHJveHlbUG9ydGFsIEFQSSBQcm94eV1cbiAgc3FsW1NRTF1cbiAgbW9uZ29bTW9uZ29dXG4gIHRhYmxlc1tUYWJsZXNdXG4gIGNhc3NhbmRyYVtDYXNzYW5kcmFdXG4gIGdyYWZbR3JhcGhdXG5cblxuICBlbXVsYXRvciAtLT4gbWFzdGVyS2V5IC0tLS0-IGRhdGFwbGFuZVxuICBwb3J0YWwgLS0-IGFhZFxuICBob3N0ZWQgLS0-IHBvcnRhbFRva2VuICYgcmVzb3VyY2VUb2tlbiAmIGNvbm5lY3Rpb25TdHJpbmcgJiBhYWRcbiAgYWFkIC0tLT4gYXJtXG4gIGFhZCAtLS0-IGRhdGFwbGFuZVxuICBhYWQgLS0tPiBwcm94eVxuICByZXNvdXJjZVRva2VuIC0tLT4gc3FsIC0tPiBkYXRhcGxhbmVcbiAgcG9ydGFsVG9rZW4gLS0tPiBwcm94eVxuICBwcm94eSAtLT4gZGF0YXBsYW5lXG4gIGNvbm5lY3Rpb25TdHJpbmcgLS0-IHNxbCAmIG1vbmdvICYgY2Fzc2FuZHJhICYgZ3JhZiAmIHRhYmxlc1xuICBzcWwgLS0-IGRhdGFwbGFuZVxuICB0YWJsZXMgLS0-IGRhdGFwbGFuZVxuICBtb25nbyAtLT4gcHJveHlcbiAgY2Fzc2FuZHJhIC0tPiBwcm94eVxuICBncmFmIC0tPiBwcm94eVxuXG5cdFx0IiwibWVybWFpZCI6eyJ0aGVtZSI6ImRlZmF1bHQifSwidXBkYXRlRWRpdG9yIjpmYWxzZX0" alt=""></a></p>
-				<a href="#contributing" id="contributing" style="color: inherit; text-decoration: none;">
-					<h1>Contributing</h1>
-				</a>
-				<p>Please read the <a href="./CONTRIBUTING.md">contribution guidelines</a>.</p>
-			</div>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="modules/selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="assets/js/main.js"></script>
-</body>
-</html>

docs/interfaces/selfserve_decorators.booleaninputoptions.html

@@ -1,255 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>BooleanInputOptions | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="../modules/selfserve_decorators.html">SelfServe/Decorators</a>
-				</li>
-				<li>
-					<a href="selfserve_decorators.booleaninputoptions.html">BooleanInputOptions</a>
-				</li>
-			</ul>
-			<h1>Interface BooleanInputOptions</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel tsd-comment">
-				<div class="tsd-comment tsd-typography">
-					<div class="lead">
-						<p>Toggle is rendered.</p>
-					</div>
-				</div>
-			</section>
-			<section class="tsd-panel tsd-hierarchy">
-				<h3>Hierarchy</h3>
-				<ul class="tsd-hierarchy">
-					<li>
-						<span class="tsd-signature-type">InputOptionsBase</span>
-						<ul class="tsd-hierarchy">
-							<li>
-								<span class="target">BooleanInputOptions</span>
-							</li>
-						</ul>
-					</li>
-				</ul>
-			</section>
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Properties</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.booleaninputoptions.html#falselabeltkey" class="tsd-kind-icon">false<wbr>LabelTKey</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-interface tsd-is-inherited"><a href="selfserve_decorators.booleaninputoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.booleaninputoptions.html#truelabeltkey" class="tsd-kind-icon">true<wbr>LabelTKey</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Properties</h2>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="falselabeltkey" class="tsd-anchor"></a>
-					<h3>false<wbr>LabelTKey</h3>
-					<div class="tsd-signature tsd-kind-icon">false<wbr>LabelTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Key used to pickup the string corresponding to the false label of the toggle, from the strings JSON file.</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface tsd-is-inherited">
-					<a name="labeltkey" class="tsd-anchor"></a>
-					<h3>labelTKey</h3>
-					<div class="tsd-signature tsd-kind-icon">labelTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
-					<aside class="tsd-sources">
-						<p>Inherited from InputOptionsBase.labelTKey</p>
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Key used to pickup the string corresponding to the label of the UI element, from the strings JSON file.</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="truelabeltkey" class="tsd-anchor"></a>
-					<h3>true<wbr>LabelTKey</h3>
-					<div class="tsd-signature tsd-kind-icon">true<wbr>LabelTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Key used to pickup the string corresponding to the true label of the toggle, from the strings JSON file.</p>
-						</div>
-					</div>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-				</ul>
-				<ul class="current">
-					<li class="current tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.booleaninputoptions.html" class="tsd-kind-icon">Boolean<wbr>Input<wbr>Options</a>
-						<ul>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_decorators.booleaninputoptions.html#falselabeltkey" class="tsd-kind-icon">false<wbr>LabelTKey</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-interface tsd-is-inherited">
-								<a href="selfserve_decorators.booleaninputoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_decorators.booleaninputoptions.html#truelabeltkey" class="tsd-kind-icon">true<wbr>LabelTKey</a>
-							</li>
-						</ul>
-					</li>
-				</ul>
-				<ul class="after-current">
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.choiceinputoptions.html" class="tsd-kind-icon">Choice<wbr>Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.descriptiondisplayoptions.html" class="tsd-kind-icon">Description<wbr>Display<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.numberinputoptions.html" class="tsd-kind-icon">Number<wbr>Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.stringinputoptions.html" class="tsd-kind-icon">String<wbr>Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#inputoptions" class="tsd-kind-icon">Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#isdisplayable" class="tsd-kind-icon">Is<wbr>Displayable</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#onchange" class="tsd-kind-icon">On<wbr>Change</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#propertyinfo" class="tsd-kind-icon">Property<wbr>Info</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#refreshoptions" class="tsd-kind-icon">Refresh<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#values" class="tsd-kind-icon">Values</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-				<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/interfaces/selfserve_decorators.choiceinputoptions.html

@@ -1,255 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>ChoiceInputOptions | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="../modules/selfserve_decorators.html">SelfServe/Decorators</a>
-				</li>
-				<li>
-					<a href="selfserve_decorators.choiceinputoptions.html">ChoiceInputOptions</a>
-				</li>
-			</ul>
-			<h1>Interface ChoiceInputOptions</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel tsd-comment">
-				<div class="tsd-comment tsd-typography">
-					<div class="lead">
-						<p>Dropdown is rendered.</p>
-					</div>
-				</div>
-			</section>
-			<section class="tsd-panel tsd-hierarchy">
-				<h3>Hierarchy</h3>
-				<ul class="tsd-hierarchy">
-					<li>
-						<span class="tsd-signature-type">InputOptionsBase</span>
-						<ul class="tsd-hierarchy">
-							<li>
-								<span class="target">ChoiceInputOptions</span>
-							</li>
-						</ul>
-					</li>
-				</ul>
-			</section>
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Properties</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.choiceinputoptions.html#choices" class="tsd-kind-icon">choices</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-interface tsd-is-inherited"><a href="selfserve_decorators.choiceinputoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.choiceinputoptions.html#placeholdertkey" class="tsd-kind-icon">placeholderTKey</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Properties</h2>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="choices" class="tsd-anchor"></a>
-					<h3>choices</h3>
-					<div class="tsd-signature tsd-kind-icon">choices<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-signature-type" data-tsd-kind="Type alias">ChoiceItem</a><span class="tsd-signature-symbol">[]</span><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> | </span><a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-signature-type" data-tsd-kind="Type alias">ChoiceItem</a><span class="tsd-signature-symbol">[]</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Choices to be shown in the dropdown</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface tsd-is-inherited">
-					<a name="labeltkey" class="tsd-anchor"></a>
-					<h3>labelTKey</h3>
-					<div class="tsd-signature tsd-kind-icon">labelTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
-					<aside class="tsd-sources">
-						<p>Inherited from InputOptionsBase.labelTKey</p>
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Key used to pickup the string corresponding to the label of the UI element, from the strings JSON file.</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="placeholdertkey" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagOptional">Optional</span> placeholderTKey</h3>
-					<div class="tsd-signature tsd-kind-icon">placeholderTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Key used to pickup the string corresponding to the placeholder text of the dropdown, from the strings JSON file.</p>
-						</div>
-					</div>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.booleaninputoptions.html" class="tsd-kind-icon">Boolean<wbr>Input<wbr>Options</a>
-					</li>
-				</ul>
-				<ul class="current">
-					<li class="current tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.choiceinputoptions.html" class="tsd-kind-icon">Choice<wbr>Input<wbr>Options</a>
-						<ul>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_decorators.choiceinputoptions.html#choices" class="tsd-kind-icon">choices</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-interface tsd-is-inherited">
-								<a href="selfserve_decorators.choiceinputoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_decorators.choiceinputoptions.html#placeholdertkey" class="tsd-kind-icon">placeholderTKey</a>
-							</li>
-						</ul>
-					</li>
-				</ul>
-				<ul class="after-current">
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.descriptiondisplayoptions.html" class="tsd-kind-icon">Description<wbr>Display<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.numberinputoptions.html" class="tsd-kind-icon">Number<wbr>Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.stringinputoptions.html" class="tsd-kind-icon">String<wbr>Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#inputoptions" class="tsd-kind-icon">Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#isdisplayable" class="tsd-kind-icon">Is<wbr>Displayable</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#onchange" class="tsd-kind-icon">On<wbr>Change</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#propertyinfo" class="tsd-kind-icon">Property<wbr>Info</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#refreshoptions" class="tsd-kind-icon">Refresh<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#values" class="tsd-kind-icon">Values</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-				<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/interfaces/selfserve_decorators.descriptiondisplayoptions.html

@@ -1,249 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>DescriptionDisplayOptions | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="../modules/selfserve_decorators.html">SelfServe/Decorators</a>
-				</li>
-				<li>
-					<a href="selfserve_decorators.descriptiondisplayoptions.html">DescriptionDisplayOptions</a>
-				</li>
-			</ul>
-			<h1>Interface DescriptionDisplayOptions</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel tsd-comment">
-				<div class="tsd-comment tsd-typography">
-					<div class="lead">
-						<p>Text is rendered.</p>
-					</div>
-				</div>
-			</section>
-			<section class="tsd-panel tsd-hierarchy">
-				<h3>Hierarchy</h3>
-				<ul class="tsd-hierarchy">
-					<li>
-						<span class="target">DescriptionDisplayOptions</span>
-					</li>
-				</ul>
-			</section>
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Properties</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.descriptiondisplayoptions.html#description" class="tsd-kind-icon">description</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.descriptiondisplayoptions.html#isdynamicdescription" class="tsd-kind-icon">is<wbr>Dynamic<wbr>Description</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.descriptiondisplayoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Properties</h2>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="description" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagOptional">Optional</span> description</h3>
-					<div class="tsd-signature tsd-kind-icon">description<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="selfserve_selfservetypes.description.html" class="tsd-signature-type" data-tsd-kind="Interface">Description</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> | </span><a href="selfserve_selfservetypes.description.html" class="tsd-signature-type" data-tsd-kind="Interface">Description</a></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Static description to be shown as text.</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="isdynamicdescription" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagOptional">Optional</span> is<wbr>Dynamic<wbr>Description</h3>
-					<div class="tsd-signature tsd-kind-icon">is<wbr>Dynamic<wbr>Description<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">boolean</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>If true, Indicates that the Description will be populated dynamically and that it may not be present in some scenarios.</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="labeltkey" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagOptional">Optional</span> labelTKey</h3>
-					<div class="tsd-signature tsd-kind-icon">labelTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Optional heading for the text displayed by this description element.</p>
-						</div>
-					</div>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.booleaninputoptions.html" class="tsd-kind-icon">Boolean<wbr>Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.choiceinputoptions.html" class="tsd-kind-icon">Choice<wbr>Input<wbr>Options</a>
-					</li>
-				</ul>
-				<ul class="current">
-					<li class="current tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.descriptiondisplayoptions.html" class="tsd-kind-icon">Description<wbr>Display<wbr>Options</a>
-						<ul>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_decorators.descriptiondisplayoptions.html#description" class="tsd-kind-icon">description</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_decorators.descriptiondisplayoptions.html#isdynamicdescription" class="tsd-kind-icon">is<wbr>Dynamic<wbr>Description</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_decorators.descriptiondisplayoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a>
-							</li>
-						</ul>
-					</li>
-				</ul>
-				<ul class="after-current">
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.numberinputoptions.html" class="tsd-kind-icon">Number<wbr>Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.stringinputoptions.html" class="tsd-kind-icon">String<wbr>Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#inputoptions" class="tsd-kind-icon">Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#isdisplayable" class="tsd-kind-icon">Is<wbr>Displayable</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#onchange" class="tsd-kind-icon">On<wbr>Change</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#propertyinfo" class="tsd-kind-icon">Property<wbr>Info</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#refreshoptions" class="tsd-kind-icon">Refresh<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#values" class="tsd-kind-icon">Values</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-				<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/interfaces/selfserve_decorators.numberinputoptions.html

@@ -1,287 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>NumberInputOptions | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="../modules/selfserve_decorators.html">SelfServe/Decorators</a>
-				</li>
-				<li>
-					<a href="selfserve_decorators.numberinputoptions.html">NumberInputOptions</a>
-				</li>
-			</ul>
-			<h1>Interface NumberInputOptions</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel tsd-comment">
-				<div class="tsd-comment tsd-typography">
-					<div class="lead">
-						<p>Numeric input UI element is rendered. The current options are to render it as a slider or a spinner.</p>
-					</div>
-				</div>
-			</section>
-			<section class="tsd-panel tsd-hierarchy">
-				<h3>Hierarchy</h3>
-				<ul class="tsd-hierarchy">
-					<li>
-						<span class="tsd-signature-type">InputOptionsBase</span>
-						<ul class="tsd-hierarchy">
-							<li>
-								<span class="target">NumberInputOptions</span>
-							</li>
-						</ul>
-					</li>
-				</ul>
-			</section>
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Properties</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-property tsd-parent-kind-interface tsd-is-inherited"><a href="selfserve_decorators.numberinputoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.numberinputoptions.html#max" class="tsd-kind-icon">max</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.numberinputoptions.html#min" class="tsd-kind-icon">min</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.numberinputoptions.html#step" class="tsd-kind-icon">step</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.numberinputoptions.html#uitype" class="tsd-kind-icon">ui<wbr>Type</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Properties</h2>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface tsd-is-inherited">
-					<a name="labeltkey" class="tsd-anchor"></a>
-					<h3>labelTKey</h3>
-					<div class="tsd-signature tsd-kind-icon">labelTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
-					<aside class="tsd-sources">
-						<p>Inherited from InputOptionsBase.labelTKey</p>
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Key used to pickup the string corresponding to the label of the UI element, from the strings JSON file.</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="max" class="tsd-anchor"></a>
-					<h3>max</h3>
-					<div class="tsd-signature tsd-kind-icon">max<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">number</span><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">number</span><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Max value of the numeric input UI element</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="min" class="tsd-anchor"></a>
-					<h3>min</h3>
-					<div class="tsd-signature tsd-kind-icon">min<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">number</span><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">number</span><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Min value of the numeric input UI element</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="step" class="tsd-anchor"></a>
-					<h3>step</h3>
-					<div class="tsd-signature tsd-kind-icon">step<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">number</span><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">number</span><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Value by which the numeric input is incremented or decremented in the UI.</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="uitype" class="tsd-anchor"></a>
-					<h3>ui<wbr>Type</h3>
-					<div class="tsd-signature tsd-kind-icon">ui<wbr>Type<span class="tsd-signature-symbol">:</span> <a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-signature-type" data-tsd-kind="Enumeration">NumberUiType</a></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>The type of the numeric input UI element</p>
-						</div>
-					</div>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.booleaninputoptions.html" class="tsd-kind-icon">Boolean<wbr>Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.choiceinputoptions.html" class="tsd-kind-icon">Choice<wbr>Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.descriptiondisplayoptions.html" class="tsd-kind-icon">Description<wbr>Display<wbr>Options</a>
-					</li>
-				</ul>
-				<ul class="current">
-					<li class="current tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.numberinputoptions.html" class="tsd-kind-icon">Number<wbr>Input<wbr>Options</a>
-						<ul>
-							<li class=" tsd-kind-property tsd-parent-kind-interface tsd-is-inherited">
-								<a href="selfserve_decorators.numberinputoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_decorators.numberinputoptions.html#max" class="tsd-kind-icon">max</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_decorators.numberinputoptions.html#min" class="tsd-kind-icon">min</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_decorators.numberinputoptions.html#step" class="tsd-kind-icon">step</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_decorators.numberinputoptions.html#uitype" class="tsd-kind-icon">ui<wbr>Type</a>
-							</li>
-						</ul>
-					</li>
-				</ul>
-				<ul class="after-current">
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.stringinputoptions.html" class="tsd-kind-icon">String<wbr>Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#inputoptions" class="tsd-kind-icon">Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#isdisplayable" class="tsd-kind-icon">Is<wbr>Displayable</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#onchange" class="tsd-kind-icon">On<wbr>Change</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#propertyinfo" class="tsd-kind-icon">Property<wbr>Info</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#refreshoptions" class="tsd-kind-icon">Refresh<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#values" class="tsd-kind-icon">Values</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-				<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/interfaces/selfserve_decorators.stringinputoptions.html

@@ -1,239 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>StringInputOptions | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="../modules/selfserve_decorators.html">SelfServe/Decorators</a>
-				</li>
-				<li>
-					<a href="selfserve_decorators.stringinputoptions.html">StringInputOptions</a>
-				</li>
-			</ul>
-			<h1>Interface StringInputOptions</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel tsd-comment">
-				<div class="tsd-comment tsd-typography">
-					<div class="lead">
-						<p>Text box is rendered.</p>
-					</div>
-				</div>
-			</section>
-			<section class="tsd-panel tsd-hierarchy">
-				<h3>Hierarchy</h3>
-				<ul class="tsd-hierarchy">
-					<li>
-						<span class="tsd-signature-type">InputOptionsBase</span>
-						<ul class="tsd-hierarchy">
-							<li>
-								<span class="target">StringInputOptions</span>
-							</li>
-						</ul>
-					</li>
-				</ul>
-			</section>
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Properties</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-property tsd-parent-kind-interface tsd-is-inherited"><a href="selfserve_decorators.stringinputoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.stringinputoptions.html#placeholdertkey" class="tsd-kind-icon">placeholderTKey</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Properties</h2>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface tsd-is-inherited">
-					<a name="labeltkey" class="tsd-anchor"></a>
-					<h3>labelTKey</h3>
-					<div class="tsd-signature tsd-kind-icon">labelTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
-					<aside class="tsd-sources">
-						<p>Inherited from InputOptionsBase.labelTKey</p>
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Key used to pickup the string corresponding to the label of the UI element, from the strings JSON file.</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="placeholdertkey" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagOptional">Optional</span> placeholderTKey</h3>
-					<div class="tsd-signature tsd-kind-icon">placeholderTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Key used to pickup the string corresponding to the place holder text of the text box, from the strings JSON file.</p>
-						</div>
-					</div>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.booleaninputoptions.html" class="tsd-kind-icon">Boolean<wbr>Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.choiceinputoptions.html" class="tsd-kind-icon">Choice<wbr>Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.descriptiondisplayoptions.html" class="tsd-kind-icon">Description<wbr>Display<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.numberinputoptions.html" class="tsd-kind-icon">Number<wbr>Input<wbr>Options</a>
-					</li>
-				</ul>
-				<ul class="current">
-					<li class="current tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_decorators.stringinputoptions.html" class="tsd-kind-icon">String<wbr>Input<wbr>Options</a>
-						<ul>
-							<li class=" tsd-kind-property tsd-parent-kind-interface tsd-is-inherited">
-								<a href="selfserve_decorators.stringinputoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_decorators.stringinputoptions.html#placeholdertkey" class="tsd-kind-icon">placeholderTKey</a>
-							</li>
-						</ul>
-					</li>
-				</ul>
-				<ul class="after-current">
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#inputoptions" class="tsd-kind-icon">Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#isdisplayable" class="tsd-kind-icon">Is<wbr>Displayable</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#onchange" class="tsd-kind-icon">On<wbr>Change</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#propertyinfo" class="tsd-kind-icon">Property<wbr>Info</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#refreshoptions" class="tsd-kind-icon">Refresh<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="../modules/selfserve_decorators.html#values" class="tsd-kind-icon">Values</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-				<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/interfaces/selfserve_selfservetypes.description.html

@@ -1,277 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>Description | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
-				</li>
-				<li>
-					<a href="selfserve_selfservetypes.description.html">Description</a>
-				</li>
-			</ul>
-			<h1>Interface Description</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel tsd-comment">
-				<div class="tsd-comment tsd-typography">
-					<div class="lead">
-						<p>Data to be shown as a description.</p>
-					</div>
-				</div>
-			</section>
-			<section class="tsd-panel tsd-hierarchy">
-				<h3>Hierarchy</h3>
-				<ul class="tsd-hierarchy">
-					<li>
-						<span class="target">Description</span>
-					</li>
-				</ul>
-			</section>
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Properties</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.description.html#link" class="tsd-kind-icon">link</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.description.html#texttkey-1" class="tsd-kind-icon">textTKey</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.description.html#type" class="tsd-kind-icon">type</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Properties</h2>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="link" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagOptional">Optional</span> link</h3>
-					<div class="tsd-signature tsd-kind-icon">link<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">{ </span>href<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">; </span>textTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> }</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Optional link to be shown as part of the description, after the text.</p>
-						</div>
-					</div>
-					<div class="tsd-type-declaration">
-						<h4>Type declaration</h4>
-						<ul class="tsd-parameters">
-							<li class="tsd-parameter">
-								<h5>href<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
-								<div class="tsd-comment tsd-typography">
-									<div class="lead">
-										<p>The URL of the link</p>
-									</div>
-								</div>
-							</li>
-							<li class="tsd-parameter">
-								<h5>textTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
-								<div class="tsd-comment tsd-typography">
-									<div class="lead">
-										<p>Key used to pickup the string corresponding to the text of the link, from the strings JSON file.</p>
-									</div>
-								</div>
-							</li>
-						</ul>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="texttkey-1" class="tsd-anchor"></a>
-					<h3>textTKey</h3>
-					<div class="tsd-signature tsd-kind-icon">textTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Key used to pickup the string corresponding to the text to be shown as part of the description, from the strings JSON file.</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="type" class="tsd-anchor"></a>
-					<h3>type</h3>
-					<div class="tsd-signature tsd-kind-icon">type<span class="tsd-signature-symbol">:</span> <a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-signature-type" data-tsd-kind="Enumeration">DescriptionType</a></div>
-					<aside class="tsd-sources">
-					</aside>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
-					</li>
-					<li class=" tsd-kind-class tsd-parent-kind-module">
-						<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
-					</li>
-				</ul>
-				<ul class="current">
-					<li class="current tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
-						<ul>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_selfservetypes.description.html#link" class="tsd-kind-icon">link</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_selfservetypes.description.html#texttkey-1" class="tsd-kind-icon">textTKey</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_selfservetypes.description.html#type" class="tsd-kind-icon">type</a>
-							</li>
-						</ul>
-					</li>
-				</ul>
-				<ul class="after-current">
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-				<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/interfaces/selfserve_selfservetypes.info.html

@@ -1,266 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>Info | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
-				</li>
-				<li>
-					<a href="selfserve_selfservetypes.info.html">Info</a>
-				</li>
-			</ul>
-			<h1>Interface Info</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel tsd-comment">
-				<div class="tsd-comment tsd-typography">
-					<div class="lead">
-						<p>Data to be shown within the info bubble of the property.</p>
-					</div>
-				</div>
-			</section>
-			<section class="tsd-panel tsd-hierarchy">
-				<h3>Hierarchy</h3>
-				<ul class="tsd-hierarchy">
-					<li>
-						<span class="target">Info</span>
-					</li>
-				</ul>
-			</section>
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Properties</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.info.html#link" class="tsd-kind-icon">link</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.info.html#messagetkey" class="tsd-kind-icon">messageTKey</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Properties</h2>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="link" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagOptional">Optional</span> link</h3>
-					<div class="tsd-signature tsd-kind-icon">link<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">{ </span>href<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">; </span>textTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> }</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Optional link to be shown within the info bubble, after the text.</p>
-						</div>
-					</div>
-					<div class="tsd-type-declaration">
-						<h4>Type declaration</h4>
-						<ul class="tsd-parameters">
-							<li class="tsd-parameter">
-								<h5>href<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
-								<div class="tsd-comment tsd-typography">
-									<div class="lead">
-										<p>The URL of the link</p>
-									</div>
-								</div>
-							</li>
-							<li class="tsd-parameter">
-								<h5>textTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
-								<div class="tsd-comment tsd-typography">
-									<div class="lead">
-										<p>Key used to pickup the string corresponding to the text of the link, from the strings JSON file.</p>
-									</div>
-								</div>
-							</li>
-						</ul>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="messagetkey" class="tsd-anchor"></a>
-					<h3>messageTKey</h3>
-					<div class="tsd-signature tsd-kind-icon">messageTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Key used to pickup the string corresponding to the text to be shown within the info bubble, from the strings JSON file.</p>
-						</div>
-					</div>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
-					</li>
-					<li class=" tsd-kind-class tsd-parent-kind-module">
-						<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
-					</li>
-				</ul>
-				<ul class="current">
-					<li class="current tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
-						<ul>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_selfservetypes.info.html#link" class="tsd-kind-icon">link</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_selfservetypes.info.html#messagetkey" class="tsd-kind-icon">messageTKey</a>
-							</li>
-						</ul>
-					</li>
-				</ul>
-				<ul class="after-current">
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-				<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/interfaces/selfserve_selfservetypes.onsaveresult.html

@@ -1,321 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>OnSaveResult | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
-				</li>
-				<li>
-					<a href="selfserve_selfservetypes.onsaveresult.html">OnSaveResult</a>
-				</li>
-			</ul>
-			<h1>Interface OnSaveResult</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel tsd-hierarchy">
-				<h3>Hierarchy</h3>
-				<ul class="tsd-hierarchy">
-					<li>
-						<span class="target">OnSaveResult</span>
-					</li>
-				</ul>
-			</section>
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Properties</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.onsaveresult.html#operationstatusurl" class="tsd-kind-icon">operation<wbr>Status<wbr>Url</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.onsaveresult.html#portalnotification" class="tsd-kind-icon">portal<wbr>Notification</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Properties</h2>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="operationstatusurl" class="tsd-anchor"></a>
-					<h3>operation<wbr>Status<wbr>Url</h3>
-					<div class="tsd-signature tsd-kind-icon">operation<wbr>Status<wbr>Url<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>The polling url returned by the RP call.</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="portalnotification" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagOptional">Optional</span> portal<wbr>Notification</h3>
-					<div class="tsd-signature tsd-kind-icon">portal<wbr>Notification<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">{ </span>failure<span class="tsd-signature-symbol">: </span><span class="tsd-signature-symbol">{ </span>messageTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">; </span>titleTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> }</span><span class="tsd-signature-symbol">; </span>initialize<span class="tsd-signature-symbol">: </span><span class="tsd-signature-symbol">{ </span>messageTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">; </span>titleTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> }</span><span class="tsd-signature-symbol">; </span>success<span class="tsd-signature-symbol">: </span><span class="tsd-signature-symbol">{ </span>messageTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">; </span>titleTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> }</span><span class="tsd-signature-symbol"> }</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Notifications that need to be shown on the portal for different stages of a scenario (initialized, success/failure).</p>
-						</div>
-					</div>
-					<div class="tsd-type-declaration">
-						<h4>Type declaration</h4>
-						<ul class="tsd-parameters">
-							<li class="tsd-parameter">
-								<h5>failure<span class="tsd-signature-symbol">: </span><span class="tsd-signature-symbol">{ </span>messageTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">; </span>titleTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> }</span></h5>
-								<div class="tsd-comment tsd-typography">
-									<div class="lead">
-										<p>Notification that need to be shown when the save operation failed.</p>
-									</div>
-								</div>
-								<ul class="tsd-parameters">
-									<li class="tsd-parameter">
-										<h5>messageTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
-										<div class="tsd-comment tsd-typography">
-											<div class="lead">
-												<p>Key used to pickup the string corresponding to the notification message, from the strings JSON file.</p>
-											</div>
-										</div>
-									</li>
-									<li class="tsd-parameter">
-										<h5>titleTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
-										<div class="tsd-comment tsd-typography">
-											<div class="lead">
-												<p>Key used to pickup the string corresponding to the notification title, from the strings JSON file.</p>
-											</div>
-										</div>
-									</li>
-								</ul>
-							</li>
-							<li class="tsd-parameter">
-								<h5>initialize<span class="tsd-signature-symbol">: </span><span class="tsd-signature-symbol">{ </span>messageTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">; </span>titleTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> }</span></h5>
-								<div class="tsd-comment tsd-typography">
-									<div class="lead">
-										<p>Notification that need to be shown when the save operation has been triggered.</p>
-									</div>
-								</div>
-								<ul class="tsd-parameters">
-									<li class="tsd-parameter">
-										<h5>messageTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
-										<div class="tsd-comment tsd-typography">
-											<div class="lead">
-												<p>Key used to pickup the string corresponding to the notification message, from the strings JSON file.</p>
-											</div>
-										</div>
-									</li>
-									<li class="tsd-parameter">
-										<h5>titleTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
-										<div class="tsd-comment tsd-typography">
-											<div class="lead">
-												<p>Key used to pickup the string corresponding to the notification title, from the strings JSON file.</p>
-											</div>
-										</div>
-									</li>
-								</ul>
-							</li>
-							<li class="tsd-parameter">
-								<h5>success<span class="tsd-signature-symbol">: </span><span class="tsd-signature-symbol">{ </span>messageTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">; </span>titleTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> }</span></h5>
-								<div class="tsd-comment tsd-typography">
-									<div class="lead">
-										<p>Notification that need to be shown when the save operation has successfully completed.</p>
-									</div>
-								</div>
-								<ul class="tsd-parameters">
-									<li class="tsd-parameter">
-										<h5>messageTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
-										<div class="tsd-comment tsd-typography">
-											<div class="lead">
-												<p>Key used to pickup the string corresponding to the notification message, from the strings JSON file.</p>
-											</div>
-										</div>
-									</li>
-									<li class="tsd-parameter">
-										<h5>titleTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
-										<div class="tsd-comment tsd-typography">
-											<div class="lead">
-												<p>Key used to pickup the string corresponding to the notification title, from the strings JSON file.</p>
-											</div>
-										</div>
-									</li>
-								</ul>
-							</li>
-						</ul>
-					</div>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
-					</li>
-					<li class=" tsd-kind-class tsd-parent-kind-module">
-						<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
-					</li>
-				</ul>
-				<ul class="current">
-					<li class="current tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
-						<ul>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_selfservetypes.onsaveresult.html#operationstatusurl" class="tsd-kind-icon">operation<wbr>Status<wbr>Url</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_selfservetypes.onsaveresult.html#portalnotification" class="tsd-kind-icon">portal<wbr>Notification</a>
-							</li>
-						</ul>
-					</li>
-				</ul>
-				<ul class="after-current">
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-				<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/interfaces/selfserve_selfservetypes.refreshparams.html

@@ -1,222 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>RefreshParams | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
-				</li>
-				<li>
-					<a href="selfserve_selfservetypes.refreshparams.html">RefreshParams</a>
-				</li>
-			</ul>
-			<h1>Interface RefreshParams</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel tsd-hierarchy">
-				<h3>Hierarchy</h3>
-				<ul class="tsd-hierarchy">
-					<li>
-						<span class="target">RefreshParams</span>
-					</li>
-				</ul>
-			</section>
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Properties</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.refreshparams.html#retryintervalinms" class="tsd-kind-icon">retry<wbr>Interval<wbr>InMs</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Properties</h2>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="retryintervalinms" class="tsd-anchor"></a>
-					<h3>retry<wbr>Interval<wbr>InMs</h3>
-					<div class="tsd-signature tsd-kind-icon">retry<wbr>Interval<wbr>InMs<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">number</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>The time interval between refresh attempts when an update in ongoing</p>
-						</div>
-					</div>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
-					</li>
-					<li class=" tsd-kind-class tsd-parent-kind-module">
-						<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
-					</li>
-				</ul>
-				<ul class="current">
-					<li class="current tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
-						<ul>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_selfservetypes.refreshparams.html#retryintervalinms" class="tsd-kind-icon">retry<wbr>Interval<wbr>InMs</a>
-							</li>
-						</ul>
-					</li>
-				</ul>
-				<ul class="after-current">
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-				<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/interfaces/selfserve_selfservetypes.refreshresult.html

@@ -1,239 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>RefreshResult | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
-				</li>
-				<li>
-					<a href="selfserve_selfservetypes.refreshresult.html">RefreshResult</a>
-				</li>
-			</ul>
-			<h1>Interface RefreshResult</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel tsd-hierarchy">
-				<h3>Hierarchy</h3>
-				<ul class="tsd-hierarchy">
-					<li>
-						<span class="target">RefreshResult</span>
-					</li>
-				</ul>
-			</section>
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Properties</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.refreshresult.html#isupdateinprogress" class="tsd-kind-icon">is<wbr>Update<wbr>InProgress</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.refreshresult.html#updateinprogressmessagetkey" class="tsd-kind-icon">update<wbr>InProgress<wbr>MessageTKey</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Properties</h2>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="isupdateinprogress" class="tsd-anchor"></a>
-					<h3>is<wbr>Update<wbr>InProgress</h3>
-					<div class="tsd-signature tsd-kind-icon">is<wbr>Update<wbr>InProgress<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">boolean</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Indicate if the update is still ongoing</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="updateinprogressmessagetkey" class="tsd-anchor"></a>
-					<h3>update<wbr>InProgress<wbr>MessageTKey</h3>
-					<div class="tsd-signature tsd-kind-icon">update<wbr>InProgress<wbr>MessageTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Key used to pickup the string corresponding to the message that will be shown on the UI if the update is still ongoing, from the strings JSON file.
-							Will be shown only if <a href="selfserve_selfservetypes.refreshresult.html#isupdateinprogress"><code>isUpdateInProgress</code></a> is true.</p>
-						</div>
-					</div>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
-					</li>
-					<li class=" tsd-kind-class tsd-parent-kind-module">
-						<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
-					</li>
-				</ul>
-				<ul class="current">
-					<li class="current tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
-						<ul>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_selfservetypes.refreshresult.html#isupdateinprogress" class="tsd-kind-icon">is<wbr>Update<wbr>InProgress</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_selfservetypes.refreshresult.html#updateinprogressmessagetkey" class="tsd-kind-icon">update<wbr>InProgress<wbr>MessageTKey</a>
-							</li>
-						</ul>
-					</li>
-				</ul>
-				<ul class="after-current">
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-				<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html

@@ -1,227 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>SelfServeTelemetryMessage | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
-				</li>
-				<li>
-					<a href="selfserve_selfservetypes.selfservetelemetrymessage.html">SelfServeTelemetryMessage</a>
-				</li>
-			</ul>
-			<h1>Interface SelfServeTelemetryMessage</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel tsd-hierarchy">
-				<h3>Hierarchy</h3>
-				<ul class="tsd-hierarchy">
-					<li>
-						<span class="tsd-signature-type">TelemetryData</span>
-						<ul class="tsd-hierarchy">
-							<li>
-								<span class="target">SelfServeTelemetryMessage</span>
-							</li>
-						</ul>
-					</li>
-				</ul>
-			</section>
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Properties</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.selfservetelemetrymessage.html#selfserveclassname" class="tsd-kind-icon">self<wbr>Serve<wbr>Class<wbr>Name</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Properties</h2>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="selfserveclassname" class="tsd-anchor"></a>
-					<h3>self<wbr>Serve<wbr>Class<wbr>Name</h3>
-					<div class="tsd-signature tsd-kind-icon">self<wbr>Serve<wbr>Class<wbr>Name<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>The className used to identify a SelfServe telemetry record</p>
-						</div>
-					</div>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
-					</li>
-					<li class=" tsd-kind-class tsd-parent-kind-module">
-						<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
-					</li>
-				</ul>
-				<ul class="current">
-					<li class="current tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
-						<ul>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_selfservetypes.selfservetelemetrymessage.html#selfserveclassname" class="tsd-kind-icon">self<wbr>Serve<wbr>Class<wbr>Name</a>
-							</li>
-						</ul>
-					</li>
-				</ul>
-				<ul class="after-current">
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-				<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/interfaces/selfserve_selfservetypes.smartuiinput.html

@@ -1,254 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>SmartUiInput | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
-				</li>
-				<li>
-					<a href="selfserve_selfservetypes.smartuiinput.html">SmartUiInput</a>
-				</li>
-			</ul>
-			<h1>Interface SmartUiInput</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel tsd-hierarchy">
-				<h3>Hierarchy</h3>
-				<ul class="tsd-hierarchy">
-					<li>
-						<span class="target">SmartUiInput</span>
-					</li>
-				</ul>
-			</section>
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Properties</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.smartuiinput.html#disabled" class="tsd-kind-icon">disabled</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.smartuiinput.html#hidden" class="tsd-kind-icon">hidden</a></li>
-								<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.smartuiinput.html#value" class="tsd-kind-icon">value</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Properties</h2>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="disabled" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagOptional">Optional</span> disabled</h3>
-					<div class="tsd-signature tsd-kind-icon">disabled<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">boolean</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Indicates whether the UI element corresponding to the property is disabled</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="hidden" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagOptional">Optional</span> hidden</h3>
-					<div class="tsd-signature tsd-kind-icon">hidden<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">boolean</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Indicates whether the UI element corresponding to the property is hidden</p>
-						</div>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
-					<a name="value" class="tsd-anchor"></a>
-					<h3>value</h3>
-					<div class="tsd-signature tsd-kind-icon">value<span class="tsd-signature-symbol">:</span> <a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-signature-type" data-tsd-kind="Type alias">InputType</a></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>The value to be set for the UI element corresponding to the property</p>
-						</div>
-					</div>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
-					</li>
-					<li class=" tsd-kind-class tsd-parent-kind-module">
-						<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
-					</li>
-				</ul>
-				<ul class="current">
-					<li class="current tsd-kind-interface tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
-						<ul>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_selfservetypes.smartuiinput.html#disabled" class="tsd-kind-icon">disabled</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_selfservetypes.smartuiinput.html#hidden" class="tsd-kind-icon">hidden</a>
-							</li>
-							<li class=" tsd-kind-property tsd-parent-kind-interface">
-								<a href="selfserve_selfservetypes.smartuiinput.html#value" class="tsd-kind-icon">value</a>
-							</li>
-						</ul>
-					</li>
-				</ul>
-				<ul class="after-current">
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-				<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/modules.html

@@ -1,138 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="assets/css/main.css">
-	<script async src="assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="assets/js/search.json" data-base=".">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<h1>cosmos-explorer</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Modules</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-module"><a href="modules/selfserve.html" class="tsd-kind-icon">Self<wbr>Serve</a></li>
-								<li class="tsd-kind-module"><a href="modules/selfserve___what_is_currently_supported_.html" class="tsd-kind-icon">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a></li>
-								<li class="tsd-kind-module"><a href="modules/selfserve_decorators.html" class="tsd-kind-icon">Self<wbr>Serve/<wbr>Decorators</a></li>
-								<li class="tsd-kind-module"><a href="modules/selfserve_selfservetelemetryprocessor.html" class="tsd-kind-icon">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a></li>
-								<li class="tsd-kind-module"><a href="modules/selfserve_selfservetypes.html" class="tsd-kind-icon">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a></li>
-								<li class="tsd-kind-module"><a href="modules/selfserve_selfserveutils.html" class="tsd-kind-icon">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class="current ">
-						<a href="modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="modules/selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="assets/js/main.js"></script>
-</body>
-</html>

docs/modules/selfserve.html

@@ -1,498 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>SelfServe | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="selfserve.html">SelfServe</a>
-				</li>
-			</ul>
-			<h1>Module SelfServe</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel tsd-comment">
-				<div class="tsd-comment tsd-typography">
-					<div class="lead">
-						<a href="#self-serve-model" id="self-serve-model" style="color: inherit; text-decoration: none;">
-							<h1>Self Serve Model</h1>
-						</a>
-						<p>The Self Serve Model allows you to write classes that auto generate UI components for your feature. The idea is to allow developers from other feature teams, who may not be familiar with writing UI, to develop and own UX components. This is accomplished by just writing simpler TypeScript classes for their features. </p>
-						<p>What this means for the feature team </p>
-						<ul>
-							<li>Can concentrate just on the logic behind showing, hiding and disabling UI components </li>
-							<li>Need not worry about specifics of the UI language or UX requirements (Accessibility, Localization, Themes, etc.)</li>
-							<li>Can own the REST API calls made as part of the feature, which can change in the future</li>
-							<li>Quicker turn around time for development and bug fixes since they have deeper knowledge of the feature</li>
-						</ul>
-						<p>What this means for the UI team</p>
-						<ul>
-							<li>No need to ramp up on the intricacies of every feature which requires UI changes</li>
-							<li>Own only the framework and not every feature, giving more bandwidth to prioritize inhouse features as well</li>
-						</ul>
-						<a href="#getting-started" id="getting-started" style="color: inherit; text-decoration: none;">
-							<h2>Getting Started</h2>
-						</a>
-						<p>Clone the cosmos-explorer repo and run</p>
-						<ul>
-							<li><code>npm install</code></li>
-							<li><code>npm run build</code></li>
-						</ul>
-						<p><a href="../index.html">Click here</a> for more info on setting up the cosmos-explorer repo.</p>
-						<a href="#code-changes" id="code-changes" style="color: inherit; text-decoration: none;">
-							<h2>Code Changes</h2>
-						</a>
-						<p>Code changes need to be made only in the following files</p>
-						<ul>
-							<li>A JSON file - for strings to be displayed</li>
-							<li>A Types File - for defining the data models</li>
-							<li>A RP file - for defining the REST calls</li>
-							<li>A Class file - for defining the UI</li>
-							<li><a href="https://github.com/Azure/cosmos-explorer/blob/master/src/SelfServe/SelfServeUtils.tsx">SelfServeUtils.tsx</a> and <a href="https://github.com/Azure/cosmos-explorer/blob/master/src/SelfServe/SelfServe.tsx">SelfServe.tsx</a> - for defning the entrypoint for the UI</li>
-						</ul>
-						<a href="#1-json-file-for-ui-strings" id="1-json-file-for-ui-strings" style="color: inherit; text-decoration: none;">
-							<h3>1. JSON file for UI strings</h3>
-						</a>
-						<a href="#naming-convention" id="naming-convention" style="color: inherit; text-decoration: none;">
-							<h4>Naming Convention</h4>
-						</a>
-						<p><code>Localization/en/&lt;FEATURE_NAME&gt;.json</code><br>Please place your files only under &quot;Localization/en&quot; folder. If not, the UI strings will not be picked up by the framework.</p>
-						<a href="#example" id="example" style="color: inherit; text-decoration: none;">
-							<h4>Example</h4>
-						</a>
-						<p><a href="https://github.com/Azure/cosmos-explorer/blob/master/src/Localization/en/SelfServeExample.json">SelfServeExample.json</a></p>
-						<a href="#description" id="description" style="color: inherit; text-decoration: none;">
-							<h4>Description</h4>
-						</a>
-						<p>This is a JSON file where the values are the strings that needs to be displayed in the UI. These strings are referenced using their corresponding unique keys.</p>
-						<p>For example, If your class file defines properties as follows</p>
-						<pre><code class="language-ts"><span style="color: #000000">  @</span><span style="color: #795E26">Values</span><span style="color: #000000">({</span>
-<span style="color: #000000">    </span><span style="color: #001080">labelTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;stringPropertylabel&quot;</span>
-<span style="color: #000000">  })</span>
-<span style="color: #000000">  stringProperty: </span><span style="color: #001080">string</span><span style="color: #000000">;</span>
-
-<span style="color: #000000">  @</span><span style="color: #795E26">Values</span><span style="color: #000000">({</span>
-<span style="color: #000000">    </span><span style="color: #001080">labelTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;booleanPropertyLabel&quot;</span><span style="color: #000000">,</span>
-<span style="color: #000000">    </span><span style="color: #001080">trueLabelTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;trueLabel&quot;</span><span style="color: #000000">,</span>
-<span style="color: #000000">    </span><span style="color: #001080">falseLabelTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;falseLabel&quot;</span><span style="color: #000000">,</span>
-<span style="color: #000000">  })</span>
-<span style="color: #000000">  booleanProperty: </span><span style="color: #001080">boolean</span><span style="color: #000000">;</span>
-</code></pre>
-						<p>Then the content of <code>Localization/en/FeatureName.json</code> should be </p>
-						<pre><code class="language-json"><span style="color: #000000">{</span>
-<span style="color: #000000">    </span><span style="color: #CD3131">stringPropertyLabel</span><span style="color: #000000">: </span><span style="color: #A31515">&quot;string property&quot;</span><span style="color: #000000">,</span>
-<span style="color: #000000">    </span><span style="color: #CD3131">booleanPropertyLabel</span><span style="color: #000000">: </span><span style="color: #A31515">&quot;boolean property&quot;</span><span style="color: #000000">,</span>
-<span style="color: #000000">    </span><span style="color: #CD3131">trueLabel</span><span style="color: #000000">: </span><span style="color: #A31515">&quot;Enable&quot;</span><span style="color: #000000">,</span>
-<span style="color: #000000">    </span><span style="color: #CD3131">falseLabel</span><span style="color: #000000">: </span><span style="color: #A31515">&quot;Disable&quot;</span>
-<span style="color: #000000">}</span>
-</code></pre>
-						<p>You can learn more on how to define the class file <a href="./selfserve.html#4-class-file">here</a>.</p>
-						<a href="#2-types-file" id="2-types-file" style="color: inherit; text-decoration: none;">
-							<h3>2. Types file</h3>
-						</a>
-						<a href="#naming-convention-1" id="naming-convention-1" style="color: inherit; text-decoration: none;">
-							<h4>Naming Convention</h4>
-						</a>
-						<p><code>&lt;FEATURE_NAME&gt;.types.ts</code></p>
-						<a href="#example-1" id="example-1" style="color: inherit; text-decoration: none;">
-							<h4>Example</h4>
-						</a>
-						<p><a href="https://github.com/Azure/cosmos-explorer/blob/master/src/SelfServe/Example/SelfServeExample.types.ts">SelfServeExample.types.ts</a></p>
-						<a href="#description-1" id="description-1" style="color: inherit; text-decoration: none;">
-							<h4>Description</h4>
-						</a>
-						<p>This file contains the definitions of all the data models to be used in your Class file and RP file.</p>
-						<p>For example, if your RP call takes/returns the <code>stringProperty</code> and <code>booleanProperty</code> of your SelfServe class, then you can define an interface in your <code>FeatureName.types.ts</code> file like this.</p>
-						<pre><code class="language-ts"><span style="color: #AF00DB">export</span><span style="color: #000000"> </span><span style="color: #001080">RpDataModel</span><span style="color: #000000"> {</span>
-<span style="color: #000000">  </span><span style="color: #001080">stringProperty</span><span style="color: #000000">: </span><span style="color: #001080">string</span><span style="color: #000000">,</span>
-<span style="color: #000000">  </span><span style="color: #001080">booleanProperty</span><span style="color: #000000">: </span><span style="color: #001080">boolean</span>
-<span style="color: #000000">}</span>
-</code></pre>
-						<a href="#3-rp-file" id="3-rp-file" style="color: inherit; text-decoration: none;">
-							<h3>3. RP file</h3>
-						</a>
-						<a href="#naming-convention-2" id="naming-convention-2" style="color: inherit; text-decoration: none;">
-							<h4>Naming Convention</h4>
-						</a>
-						<p><code>&lt;FEATURE_NAME&gt;.rp.ts</code></p>
-						<a href="#example-2" id="example-2" style="color: inherit; text-decoration: none;">
-							<h4>Example</h4>
-						</a>
-						<p><a href="https://github.com/Azure/cosmos-explorer/blob/master/src/SelfServe/Example/SelfServeExample.rp.ts">SelfServeExample.rp.ts</a></p>
-						<a href="#description-2" id="description-2" style="color: inherit; text-decoration: none;">
-							<h4>Description</h4>
-						</a>
-						<p>The RP file will host the REST calls needed for the initialize, save and refresh functions. This decouples the view and the model of the feature.</p>
-						<p>To make the ARM call, we need some information about the Azure Cosmos DB databaseAccount - the subscription id, resource group name and database account name. These are readily available through the <code>userContext</code> object, exposed through</p>
-						<ul>
-							<li><code>userContext.subscriptionId</code></li>
-							<li><code>userContext.resourceGroup</code></li>
-							<li><code>userContext.databaseAccount.name</code></li>
-						</ul>
-						<p>You can use the <code>armRequestWithoutPolling</code> function to make the ARM api call.</p>
-						<p>Your <code>FeatureName.rp.ts</code> file can look like the following.</p>
-						<pre><code class="language-ts"><span style="color: #AF00DB">import</span><span style="color: #000000"> { </span><span style="color: #001080">userContext</span><span style="color: #000000"> } </span><span style="color: #AF00DB">from</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;../../UserContext&quot;</span><span style="color: #000000">;</span>
-<span style="color: #AF00DB">import</span><span style="color: #000000"> { </span><span style="color: #001080">armRequestWithoutPolling</span><span style="color: #000000"> } </span><span style="color: #AF00DB">from</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;../../Utils/arm/request&quot;</span><span style="color: #000000">;</span>
-<span style="color: #AF00DB">import</span><span style="color: #000000"> { </span><span style="color: #001080">configContext</span><span style="color: #000000"> } </span><span style="color: #AF00DB">from</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;../../ConfigContext&quot;</span><span style="color: #000000">;</span>
-
-<span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">apiVersion</span><span style="color: #000000"> = </span><span style="color: #A31515">&quot;2020-06-01-preview&quot;</span><span style="color: #000000">;</span>
-
-<span style="color: #AF00DB">export</span><span style="color: #000000"> </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #795E26">saveData</span><span style="color: #000000"> = </span><span style="color: #0000FF">async</span><span style="color: #000000"> (</span><span style="color: #001080">properties</span><span style="color: #000000">: </span><span style="color: #267F99">RpDataModel</span><span style="color: #000000">): </span><span style="color: #267F99">Promise</span><span style="color: #000000">&lt;</span><span style="color: #267F99">string</span><span style="color: #000000">&gt; </span><span style="color: #0000FF">=&gt;</span><span style="color: #000000"> {</span>
-<span style="color: #000000">  </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">path</span><span style="color: #000000"> = </span><span style="color: #A31515">`/subscriptions/</span><span style="color: #0000FF">${</span><span style="color: #001080">userContext</span><span style="color: #000000FF">.</span><span style="color: #001080">subscriptionId</span><span style="color: #0000FF">}</span><span style="color: #A31515">/resourceGroups/</span><span style="color: #0000FF">${</span><span style="color: #001080">userContext</span><span style="color: #000000FF">.</span><span style="color: #001080">resourceGroup</span><span style="color: #0000FF">}</span><span style="color: #A31515">/providers/Microsoft.DocumentDB/databaseAccounts/</span><span style="color: #0000FF">${</span><span style="color: #001080">userContext</span><span style="color: #000000FF">.</span><span style="color: #001080">databaseAccount</span><span style="color: #000000FF">.</span><span style="color: #001080">name</span><span style="color: #0000FF">}</span><span style="color: #A31515">/&lt;REST_OF_THE_PATH&gt;`</span>
-<span style="color: #000000">  </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">body</span><span style="color: #000000"> = {</span>
-<span style="color: #000000">      </span><span style="color: #001080">data :</span><span style="color: #000000"> </span><span style="color: #001080">properties</span>
-<span style="color: #000000">  }</span>
-<span style="color: #000000">  </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">armRequestResult</span><span style="color: #000000"> = </span><span style="color: #AF00DB">await</span><span style="color: #000000"> </span><span style="color: #795E26">armRequestWithoutPolling</span><span style="color: #000000">({</span>
-<span style="color: #000000">    </span><span style="color: #001080">host:</span><span style="color: #000000"> </span><span style="color: #001080">configContext</span><span style="color: #000000">.</span><span style="color: #0070C1">ARM_ENDPOINT</span><span style="color: #000000">,</span>
-<span style="color: #000000">    </span><span style="color: #001080">path</span><span style="color: #000000">,</span>
-<span style="color: #000000">    </span><span style="color: #001080">method:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;PUT&quot;</span><span style="color: #000000">,</span>
-<span style="color: #000000">    </span><span style="color: #001080">apiVersion</span><span style="color: #000000">,</span>
-<span style="color: #000000">    </span><span style="color: #001080">body</span><span style="color: #000000">,</span>
-<span style="color: #000000">  });</span>
-
-<span style="color: #000000">  </span><span style="color: #AF00DB">return</span><span style="color: #000000"> </span><span style="color: #001080">armRequestResult</span><span style="color: #000000">.</span><span style="color: #001080">operationStatusUrl</span><span style="color: #000000">;</span>
-<span style="color: #000000">};</span>
-
-</code></pre>
-						<a href="#4-class-file" id="4-class-file" style="color: inherit; text-decoration: none;">
-							<h3>4. Class file</h3>
-						</a>
-						<a href="#naming-convention-3" id="naming-convention-3" style="color: inherit; text-decoration: none;">
-							<h4>Naming Convention</h4>
-						</a>
-						<p><code>&lt;FEATURE_NAME&gt;.tsx</code></p>
-						<a href="#example-3" id="example-3" style="color: inherit; text-decoration: none;">
-							<h4>Example</h4>
-						</a>
-						<p><a href="https://github.com/Azure/cosmos-explorer/blob/master/src/SelfServe/Example/SelfServeExample.tsx">SelfServeExample.tsx</a></p>
-						<a href="#description-3" id="description-3" style="color: inherit; text-decoration: none;">
-							<h4>Description</h4>
-						</a>
-						<p>This file will contain the actual code that is translated into the UI component by the Self Serve framework.</p>
-						<ul>
-							<li><p>Each Self Serve class</p>
-								<ul>
-									<li>Needs to extends the <a href="../classes/selfserve_selfservetypes.selfservebaseclass.html">SelfServeBase</a> class.</li>
-									<li>Needs to have the <a href="./selfserve_decorators.html#isdisplayable">@IsDisplayable()</a> decorator to tell the compiler that UI needs to be generated from this class.</li>
-									<li>Needs to define an <a href="../classes/selfserve_selfservetypes.selfservebaseclass.html#initialize">initialize()</a> function, to set default values for the inputs.</li>
-									<li>Needs to define an <a href="../classes/selfserve_selfservetypes.selfservebaseclass.html#onsave">onSave()</a> function, a callback for when the save button is clicked.</li>
-									<li>Needs to define an <a href="../classes/selfserve_selfservetypes.selfservebaseclass.html#onrefresh">onRefresh()</a> function, a callback for when the refresh button is clicked.</li>
-									<li>Can have an optional <a href="./selfserve_decorators.html#refreshoptions">@RefreshOptions()</a> decorator that determines how often the auto refresh of the UI component should take place.</li>
-								</ul>
-							</li>
-							<li><p>For every UI element needed, add a property to the Self Serve class. Each of these properties</p>
-								<ul>
-									<li>Needs to have a <a href="./selfserve_decorators.html#values">@Values()</a> decorator.</li>
-									<li>Can have an optional <a href="./selfserve_decorators.html#propertyinfo">@PropertyInfo()</a> decorator that describes it&#39;s info bubble.</li>
-									<li>Can have an optional <a href="./selfserve_decorators.html#onchange">@OnChange()</a> decorator that dictates the effects of the change of the UI element tied to this property.</li>
-								</ul>
-							</li>
-						</ul>
-						<p>Your <code>FeatureName.tsx</code> file will look like the following.</p>
-						<pre><code class="language-ts"><span style="color: #000000">@</span><span style="color: #795E26">IsDisplayable</span><span style="color: #000000">()</span>
-<span style="color: #000000">@</span><span style="color: #795E26">RefreshOptions</span><span style="color: #000000">({ </span><span style="color: #001080">retryIntervalInMs:</span><span style="color: #000000"> </span><span style="color: #098658">2000</span><span style="color: #000000"> })</span>
-<span style="color: #AF00DB">export</span><span style="color: #000000"> </span><span style="color: #AF00DB">default</span><span style="color: #000000"> </span><span style="color: #0000FF">class</span><span style="color: #000000"> </span><span style="color: #267F99">FeatureName</span><span style="color: #000000"> </span><span style="color: #0000FF">extends</span><span style="color: #000000"> </span><span style="color: #267F99">SelfServeBaseClass</span><span style="color: #000000"> {</span>
-
-<span style="color: #000000">  </span><span style="color: #0000FF">public</span><span style="color: #000000"> </span><span style="color: #795E26">initialize</span><span style="color: #000000"> = </span><span style="color: #0000FF">async</span><span style="color: #000000"> (): </span><span style="color: #267F99">Promise</span><span style="color: #000000">&lt;</span><span style="color: #267F99">Map</span><span style="color: #000000">&lt;</span><span style="color: #267F99">string</span><span style="color: #000000">, </span><span style="color: #267F99">SmartUiInput</span><span style="color: #000000">&gt;&gt; </span><span style="color: #0000FF">=&gt;</span><span style="color: #000000"> {</span>
-<span style="color: #000000">      </span><span style="color: #008000">// initialize RP call and processing logic</span>
-<span style="color: #000000">  }</span>
-
-<span style="color: #000000">  </span><span style="color: #0000FF">public</span><span style="color: #000000"> </span><span style="color: #795E26">onSave</span><span style="color: #000000"> = </span><span style="color: #0000FF">async</span><span style="color: #000000"> (</span>
-<span style="color: #000000">    </span><span style="color: #001080">currentValues</span><span style="color: #000000">: </span><span style="color: #267F99">Map</span><span style="color: #000000">&lt;</span><span style="color: #267F99">string</span><span style="color: #000000">, </span><span style="color: #267F99">SmartUiInput</span><span style="color: #000000">&gt;,</span>
-<span style="color: #000000">    </span><span style="color: #001080">baselineValues</span><span style="color: #000000">: </span><span style="color: #267F99">ReadonlyMap</span><span style="color: #000000">&lt;</span><span style="color: #267F99">string</span><span style="color: #000000">, </span><span style="color: #267F99">SmartUiInput</span><span style="color: #000000">&gt;</span>
-<span style="color: #000000">  ): </span><span style="color: #267F99">Promise</span><span style="color: #000000">&lt;</span><span style="color: #267F99">OnSaveResult</span><span style="color: #000000">&gt; </span><span style="color: #0000FF">=&gt;</span><span style="color: #000000"> {</span>
-<span style="color: #000000">      </span><span style="color: #008000">// onSave RP call and processing logic</span>
-<span style="color: #000000">  }</span>
-
-<span style="color: #000000">  </span><span style="color: #0000FF">public</span><span style="color: #000000"> </span><span style="color: #795E26">onRefresh</span><span style="color: #000000"> = </span><span style="color: #0000FF">async</span><span style="color: #000000"> (): </span><span style="color: #267F99">Promise</span><span style="color: #000000">&lt;</span><span style="color: #267F99">RefreshResult</span><span style="color: #000000">&gt; </span><span style="color: #0000FF">=&gt;</span><span style="color: #000000"> {</span>
-<span style="color: #000000">      </span><span style="color: #008000">// refresh RP call and processing logic</span>
-<span style="color: #000000">  };</span>
-
-<span style="color: #000000">  @</span><span style="color: #795E26">Values</span><span style="color: #000000">(...)</span>
-<span style="color: #000000">  </span><span style="color: #001080">stringProperty</span><span style="color: #000000">: </span><span style="color: #267F99">string</span><span style="color: #000000">;</span>
-
-<span style="color: #000000">  @</span><span style="color: #795E26">OnChange</span><span style="color: #000000">(...)</span>
-<span style="color: #000000">  @</span><span style="color: #795E26">PropertyInfo</span><span style="color: #000000">(...)</span>
-<span style="color: #000000">  @</span><span style="color: #795E26">Values</span><span style="color: #000000">(...)</span>
-<span style="color: #000000">  </span><span style="color: #001080">booleanProperty</span><span style="color: #000000">: </span><span style="color: #267F99">boolean</span><span style="color: #000000">;</span>
-<span style="color: #000000">}</span>
-</code></pre>
-						<a href="#5-update-selfservetype" id="5-update-selfservetype" style="color: inherit; text-decoration: none;">
-							<h3>5. Update SelfServeType</h3>
-						</a>
-						<p>Once you have written your Self Serve Class, add a corresponding type to <a href="../enums/selfserve_selfserveutils.selfservetype.html">SelfServeType</a></p>
-						<pre><code class="language-ts"><span style="color: #AF00DB">export</span><span style="color: #000000"> </span><span style="color: #0000FF">enum</span><span style="color: #000000"> </span><span style="color: #267F99">SelfServeType</span><span style="color: #000000"> {</span>
-<span style="color: #000000">  </span><span style="color: #0070C1">invalid</span><span style="color: #000000"> = </span><span style="color: #A31515">&quot;invalid&quot;</span><span style="color: #000000">,</span>
-<span style="color: #000000">  </span><span style="color: #0070C1">example</span><span style="color: #000000"> = </span><span style="color: #A31515">&quot;example&quot;</span><span style="color: #000000">,</span>
-<span style="color: #000000">  ...</span>
-<span style="color: #000000">  </span><span style="color: #008000">// Add the type for your new feature</span>
-<span style="color: #000000">  </span><span style="color: #0070C1">featureName</span><span style="color: #000000"> = </span><span style="color: #A31515">&quot;featurename&quot;</span>
-<span style="color: #000000">}</span>
-</code></pre>
-						<a href="#6-update-selfservetsx-landing-page" id="6-update-selfservetsx-landing-page" style="color: inherit; text-decoration: none;">
-							<h3>6. Update SelfServe.tsx (landing page)</h3>
-						</a>
-						<p>Once the SelfServeType has been updated, update <a href="https://github.com/Azure/cosmos-explorer/blob/master/src/SelfServe/SelfServe.tsx">SelfServe.tsx</a> for your feature. This ensures that the framework picks up your SelfServe Class.</p>
-						<pre><code class="language-ts"><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #795E26">getDescriptor</span><span style="color: #000000"> = </span><span style="color: #0000FF">async</span><span style="color: #000000"> (</span><span style="color: #001080">selfServeType</span><span style="color: #000000">: </span><span style="color: #267F99">SelfServeType</span><span style="color: #000000">): </span><span style="color: #267F99">Promise</span><span style="color: #000000">&lt;</span><span style="color: #267F99">SelfServeDescriptor</span><span style="color: #000000">&gt; </span><span style="color: #0000FF">=&gt;</span><span style="color: #000000"> {</span>
-<span style="color: #000000">  </span><span style="color: #AF00DB">switch</span><span style="color: #000000"> (</span><span style="color: #001080">selfServeType</span><span style="color: #000000">) {</span>
-<span style="color: #000000">    </span><span style="color: #AF00DB">case</span><span style="color: #000000"> </span><span style="color: #001080">SelfServeType</span><span style="color: #000000">.</span><span style="color: #001080">example</span><span style="color: #000000">: {</span>
-<span style="color: #000000">        ....</span>
-<span style="color: #000000">    }</span>
-<span style="color: #000000">    ...</span>
-<span style="color: #000000">    ...</span>
-<span style="color: #000000">    ...</span>
-<span style="color: #000000">    </span><span style="color: #008000">// Add this for your new feature</span>
-<span style="color: #000000">    </span><span style="color: #AF00DB">case</span><span style="color: #000000"> </span><span style="color: #001080">SelfServeType</span><span style="color: #000000">.</span><span style="color: #001080">featureName</span><span style="color: #000000">: {</span>
-<span style="color: #000000">      </span><span style="color: #008000">// The &#039;webpackChunkName&#039; is used during debugging, to identify if the correct class has been loaded</span>
-<span style="color: #000000">      </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">FeatureName</span><span style="color: #000000"> = </span><span style="color: #AF00DB">await</span><span style="color: #000000"> </span><span style="color: #795E26">import</span><span style="color: #000000">(</span><span style="color: #008000">/* webpackChunkName: &quot;FeatureName&quot; */</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;./FeatureName/FeatureName&quot;</span><span style="color: #000000">);</span>
-<span style="color: #000000">      </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">featureName</span><span style="color: #000000"> = </span><span style="color: #0000FF">new</span><span style="color: #000000"> </span><span style="color: #001080">FeatureName</span><span style="color: #000000">.</span><span style="color: #795E26">default</span><span style="color: #000000">();</span>
-<span style="color: #000000">      </span><span style="color: #AF00DB">await</span><span style="color: #000000"> </span><span style="color: #795E26">loadTranslations</span><span style="color: #000000">(</span><span style="color: #001080">featureName</span><span style="color: #000000">.</span><span style="color: #001080">constructor</span><span style="color: #000000">.</span><span style="color: #001080">name</span><span style="color: #000000">);</span>
-<span style="color: #000000">      </span><span style="color: #AF00DB">return</span><span style="color: #000000"> </span><span style="color: #001080">featureName</span><span style="color: #000000">.</span><span style="color: #795E26">toSelfServeDescriptor</span><span style="color: #000000">();</span>
-<span style="color: #000000">    }</span>
-<span style="color: #000000">    ...</span>
-<span style="color: #000000">    ...</span>
-<span style="color: #000000">    </span><span style="color: #AF00DB">default</span><span style="color: #000000">:</span>
-<span style="color: #000000">      </span><span style="color: #AF00DB">return</span><span style="color: #000000"> </span><span style="color: #0000FF">undefined</span><span style="color: #000000">;</span>
-<span style="color: #000000">  }</span>
-<span style="color: #000000">};</span>
-
-</code></pre>
-						<a href="#telemetry" id="telemetry" style="color: inherit; text-decoration: none;">
-							<h2>Telemetry</h2>
-						</a>
-						<p>You can add telemetry for your feature using the functions in <a href="./selfserve_selfservetelemetryprocessor.html">SelfServeTelemetryProcessor</a></p>
-						<p>For example, in your SelfServe class, you can call the trace method in your <code>onSave</code> function.</p>
-						<pre><code class="language-ts"><span style="color: #AF00DB">import</span><span style="color: #000000"> { </span><span style="color: #001080">saveData</span><span style="color: #000000"> } </span><span style="color: #AF00DB">from</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;./FeatureName.rp&quot;</span>
-<span style="color: #AF00DB">import</span><span style="color: #000000"> { </span><span style="color: #001080">RpDataModel</span><span style="color: #000000"> } </span><span style="color: #AF00DB">from</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;./FeatureName.types&quot;</span>
-
-<span style="color: #000000">@</span><span style="color: #795E26">IsDisplayable</span><span style="color: #000000">()</span>
-<span style="color: #AF00DB">export</span><span style="color: #000000"> </span><span style="color: #AF00DB">default</span><span style="color: #000000"> </span><span style="color: #0000FF">class</span><span style="color: #000000"> </span><span style="color: #267F99">FeatureName</span><span style="color: #000000"> </span><span style="color: #0000FF">extends</span><span style="color: #000000"> </span><span style="color: #267F99">SelfServeBaseClass</span><span style="color: #000000"> {</span>
-
-<span style="color: #000000">  .</span>
-<span style="color: #000000">  .</span>
-<span style="color: #000000">  .</span>
-
-<span style="color: #000000">  </span><span style="color: #0000FF">public</span><span style="color: #000000"> </span><span style="color: #795E26">onSave</span><span style="color: #000000"> = </span><span style="color: #0000FF">async</span><span style="color: #000000"> (</span>
-<span style="color: #000000">    </span><span style="color: #001080">currentValues</span><span style="color: #000000">: </span><span style="color: #267F99">Map</span><span style="color: #000000">&lt;</span><span style="color: #267F99">string</span><span style="color: #000000">, </span><span style="color: #267F99">SmartUiInput</span><span style="color: #000000">&gt;,</span>
-<span style="color: #000000">    </span><span style="color: #001080">baselineValues</span><span style="color: #000000">: </span><span style="color: #267F99">ReadonlyMap</span><span style="color: #000000">&lt;</span><span style="color: #267F99">string</span><span style="color: #000000">, </span><span style="color: #267F99">SmartUiInput</span><span style="color: #000000">&gt;</span>
-<span style="color: #000000">  ): </span><span style="color: #267F99">Promise</span><span style="color: #000000">&lt;</span><span style="color: #267F99">OnSaveResult</span><span style="color: #000000">&gt; </span><span style="color: #0000FF">=&gt;</span><span style="color: #000000"> {</span>
-
-<span style="color: #000000">    </span><span style="color: #001080">stringPropertyValue</span><span style="color: #000000"> = </span><span style="color: #001080">currentValues</span><span style="color: #000000">.</span><span style="color: #795E26">get</span><span style="color: #000000">(</span><span style="color: #A31515">&quot;stringProperty&quot;</span><span style="color: #000000">)</span>
-<span style="color: #000000">    </span><span style="color: #001080">booleanPropertyValue</span><span style="color: #000000"> = </span><span style="color: #001080">currentValues</span><span style="color: #000000">.</span><span style="color: #795E26">get</span><span style="color: #000000">(</span><span style="color: #A31515">&quot;booleanProperty&quot;</span><span style="color: #000000">)</span>
-<span style="color: #000000">    </span>
-<span style="color: #000000">    </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">propertiesToSave</span><span style="color: #000000"> : </span><span style="color: #267F99">RpDataModel</span><span style="color: #000000"> = { </span>
-<span style="color: #000000">      </span><span style="color: #001080">stringProperty:</span><span style="color: #000000"> </span><span style="color: #001080">stringPropertyValue</span><span style="color: #000000">,</span>
-<span style="color: #000000">      </span><span style="color: #001080">booleanProperty:</span><span style="color: #000000"> </span><span style="color: #001080">booleanPropertyValue</span>
-<span style="color: #000000">    }</span>
-<span style="color: #000000">    </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">telemetryData</span><span style="color: #000000"> = { ...</span><span style="color: #001080">propertiesToSave</span><span style="color: #000000">, </span><span style="color: #001080">selfServeClassName:</span><span style="color: #000000"> </span><span style="color: #001080">FeatureName</span><span style="color: #000000">.</span><span style="color: #001080">name</span><span style="color: #000000"> }</span>
-<span style="color: #000000">    </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">onSaveTimeStamp</span><span style="color: #000000"> = </span><span style="color: #795E26">selfServeTraceStart</span><span style="color: #000000">(</span><span style="color: #001080">telemetryData</span><span style="color: #000000">)</span>
-
-<span style="color: #000000">    </span><span style="color: #AF00DB">await</span><span style="color: #000000"> </span><span style="color: #795E26">saveData</span><span style="color: #000000">(</span><span style="color: #001080">propertiesToSave</span><span style="color: #000000">)</span>
-
-<span style="color: #000000">    </span><span style="color: #795E26">selfServeTraceSuccess</span><span style="color: #000000">(</span><span style="color: #001080">telemetryData</span><span style="color: #000000">, </span><span style="color: #001080">onSaveTimeStamp</span><span style="color: #000000">)</span>
-
-<span style="color: #000000">    </span><span style="color: #008000">// return required values</span>
-<span style="color: #000000">  }</span>
-
-<span style="color: #000000">  .</span>
-<span style="color: #000000">  .</span>
-<span style="color: #000000">  .</span>
-
-<span style="color: #000000">  @</span><span style="color: #795E26">Values</span><span style="color: #000000">(...)</span>
-<span style="color: #000000">  </span><span style="color: #001080">stringProperty</span><span style="color: #000000">: </span><span style="color: #267F99">string</span><span style="color: #000000">;</span>
-
-<span style="color: #000000">  @</span><span style="color: #795E26">Values</span><span style="color: #000000">(...)</span>
-<span style="color: #000000">  </span><span style="color: #001080">booleanProperty</span><span style="color: #000000">: </span><span style="color: #267F99">boolean</span><span style="color: #000000">;</span>
-<span style="color: #000000">}</span>
-</code></pre>
-						<a href="#portal-notifications" id="portal-notifications" style="color: inherit; text-decoration: none;">
-							<h2>Portal Notifications</h2>
-						</a>
-						<p>You can enable portal notifications for your feature by passing in the required strings as part of the <a href="../interfaces/selfserve_selfservetypes.onsaveresult.html#portalnotification">portalNotification</a> property of the <a href="../interfaces/selfserve_selfservetypes.onsaveresult.html">onSaveResult</a>.</p>
-						<pre><code class="language-ts"><span style="color: #000000">@</span><span style="color: #795E26">IsDisplayable</span><span style="color: #000000">()</span>
-<span style="color: #AF00DB">export</span><span style="color: #000000"> </span><span style="color: #AF00DB">default</span><span style="color: #000000"> </span><span style="color: #0000FF">class</span><span style="color: #000000"> </span><span style="color: #267F99">SqlX</span><span style="color: #000000"> </span><span style="color: #0000FF">extends</span><span style="color: #000000"> </span><span style="color: #267F99">SelfServeBaseClass</span><span style="color: #000000"> {</span>
-
-<span style="color: #000000">.</span>
-<span style="color: #000000">.</span>
-<span style="color: #000000">.</span>
-
-<span style="color: #000000">  </span><span style="color: #0000FF">public</span><span style="color: #000000"> </span><span style="color: #795E26">onSave</span><span style="color: #000000"> = </span><span style="color: #0000FF">async</span><span style="color: #000000"> (</span>
-<span style="color: #000000">      </span><span style="color: #001080">currentValues</span><span style="color: #000000">: </span><span style="color: #267F99">Map</span><span style="color: #000000">&lt;</span><span style="color: #267F99">string</span><span style="color: #000000">, </span><span style="color: #267F99">SmartUiInput</span><span style="color: #000000">&gt;,</span>
-<span style="color: #000000">      </span><span style="color: #001080">baselineValues</span><span style="color: #000000">: </span><span style="color: #267F99">Map</span><span style="color: #000000">&lt;</span><span style="color: #267F99">string</span><span style="color: #000000">, </span><span style="color: #267F99">SmartUiInput</span><span style="color: #000000">&gt;</span>
-<span style="color: #000000">  ): </span><span style="color: #267F99">Promise</span><span style="color: #000000">&lt;</span><span style="color: #267F99">OnSaveResult</span><span style="color: #000000">&gt; </span><span style="color: #0000FF">=&gt;</span><span style="color: #000000"> {</span>
-
-<span style="color: #000000">    </span><span style="color: #001080">stringPropertyValue</span><span style="color: #000000"> = </span><span style="color: #001080">currentValues</span><span style="color: #000000">.</span><span style="color: #795E26">get</span><span style="color: #000000">(</span><span style="color: #A31515">&quot;stringProperty&quot;</span><span style="color: #000000">)</span>
-<span style="color: #000000">    </span><span style="color: #001080">booleanPropertyValue</span><span style="color: #000000"> = </span><span style="color: #001080">currentValues</span><span style="color: #000000">.</span><span style="color: #795E26">get</span><span style="color: #000000">(</span><span style="color: #A31515">&quot;booleanProperty&quot;</span><span style="color: #000000">)</span>
-<span style="color: #000000">    </span>
-<span style="color: #000000">    </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">propertiesToSave</span><span style="color: #000000"> : </span><span style="color: #267F99">RpDataModel</span><span style="color: #000000"> = { </span>
-<span style="color: #000000">      </span><span style="color: #001080">stringProperty:</span><span style="color: #000000"> </span><span style="color: #001080">stringPropertyValue</span><span style="color: #000000">,</span>
-<span style="color: #000000">      </span><span style="color: #001080">booleanProperty:</span><span style="color: #000000"> </span><span style="color: #001080">booleanPropertyValue</span>
-<span style="color: #000000">    }</span>
-
-<span style="color: #000000">    </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">operationStatusUrl</span><span style="color: #000000"> = </span><span style="color: #AF00DB">await</span><span style="color: #000000"> </span><span style="color: #795E26">saveData</span><span style="color: #000000">(</span><span style="color: #001080">propertiesToSave</span><span style="color: #000000">);</span>
-<span style="color: #000000">    </span><span style="color: #AF00DB">return</span><span style="color: #000000"> {</span>
-<span style="color: #000000">      </span><span style="color: #001080">operationStatusUrl:</span><span style="color: #000000"> </span><span style="color: #001080">operationStatusUrl</span><span style="color: #000000">,</span>
-<span style="color: #000000">      </span><span style="color: #001080">portalNotification:</span><span style="color: #000000"> {</span>
-<span style="color: #000000">        </span><span style="color: #001080">initialize:</span><span style="color: #000000"> {</span>
-<span style="color: #000000">          </span><span style="color: #001080">titleTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;DeleteInitializeTitle&quot;</span><span style="color: #000000">,</span>
-<span style="color: #000000">          </span><span style="color: #001080">messageTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;DeleteInitializeMessage&quot;</span><span style="color: #000000">,</span>
-<span style="color: #000000">        },</span>
-<span style="color: #000000">        </span><span style="color: #001080">success:</span><span style="color: #000000"> {</span>
-<span style="color: #000000">          </span><span style="color: #001080">titleTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;DeleteSuccessTitle&quot;</span><span style="color: #000000">,</span>
-<span style="color: #000000">          </span><span style="color: #001080">messageTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;DeleteSuccesseMessage&quot;</span><span style="color: #000000">,</span>
-<span style="color: #000000">        },</span>
-<span style="color: #000000">        </span><span style="color: #001080">failure:</span><span style="color: #000000"> {</span>
-<span style="color: #000000">          </span><span style="color: #001080">titleTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;DeleteFailureTitle&quot;</span><span style="color: #000000">,</span>
-<span style="color: #000000">          </span><span style="color: #001080">messageTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;DeleteFailureMessage&quot;</span><span style="color: #000000">,</span>
-<span style="color: #000000">        },</span>
-<span style="color: #000000">      },</span>
-<span style="color: #000000">    };</span>
-<span style="color: #000000">  }</span>
-
-<span style="color: #000000">  .</span>
-<span style="color: #000000">  .</span>
-<span style="color: #000000">  .</span>
-
-<span style="color: #000000">  @</span><span style="color: #795E26">Values</span><span style="color: #000000">(...)</span>
-<span style="color: #000000">  </span><span style="color: #001080">stringProperty</span><span style="color: #000000">: </span><span style="color: #267F99">string</span><span style="color: #000000">;</span>
-
-<span style="color: #000000">  @</span><span style="color: #795E26">Values</span><span style="color: #000000">(...)</span>
-<span style="color: #000000">  </span><span style="color: #001080">booleanProperty</span><span style="color: #000000">: </span><span style="color: #267F99">boolean</span><span style="color: #000000">;</span>
-<span style="color: #000000">}</span>
-</code></pre>
-						<a href="#execution" id="execution" style="color: inherit; text-decoration: none;">
-							<h2>Execution</h2>
-						</a>
-						<a href="#watch-mode" id="watch-mode" style="color: inherit; text-decoration: none;">
-							<h3>Watch mode</h3>
-						</a>
-						<p>Run <code>npm start</code> to start the development server and automatically rebuild on changes</p>
-						<a href="#local-development" id="local-development" style="color: inherit; text-decoration: none;">
-							<h3>Local Development</h3>
-						</a>
-						<p>Ensure that you have made the <a href="./selfserve.html#code-changes">Code changes</a>.</p>
-						<ul>
-							<li>Go to <code>https://ms.portal.azure.com/</code></li>
-							<li>Add the query string <code>feature.showSelfServeExample=true&amp;feature.selfServeSource=https://localhost:1234/selfServe.html?selfServeType%3D&lt;SELF_SERVE_TYPE&gt;</code></li>
-							<li>Click on the <code>Self Serve Example</code> menu item on the left panel.</li>
-						</ul>
-						<p>For example, if you want to open up the the UI of a class with the type <code>sqlx</code>, then visit <code>https://ms.portal.azure.com/?feature.showSelfServeExample=true&amp;feature.selfServeSource=https://localhost:1234/selfServe.html?selfServeType%3Dsqlx</code></p>
-						<p><img src="https://sdkctlstore.blob.core.windows.net/exe/selfserveDev.PNG" alt=""></p>
-					</div>
-				</div>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/modules/selfserve___what_is_currently_supported_.html

@@ -1,149 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>SelfServe - What is currently supported? | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="selfserve___what_is_currently_supported_.html">SelfServe - What is currently supported?</a>
-				</li>
-			</ul>
-			<h1>Module SelfServe - What is currently supported?</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel tsd-comment">
-				<div class="tsd-comment tsd-typography">
-					<div class="lead">
-						<p>The Self Serve framework has integrated support for</p>
-						<ol>
-							<li><a href="./selfserve.html#portal-notifications">Portal Notifications</a></li>
-							<li><a href="./selfserve.html#telemetry">Telemetry</a></li>
-							<li>the following UI controls:<ul>
-									<li><a href="https://developer.microsoft.com/en-us/fluentui#/controls/web/slider">Slider</a></li>
-									<li><a href="https://developer.microsoft.com/en-us/fluentui#/controls/web/spinbutton">SpinButton</a></li>
-									<li><a href="https://developer.microsoft.com/en-us/fluentui#/controls/web/textfield">TextField</a></li>
-									<li><a href="https://developer.microsoft.com/en-us/fluentui#/controls/web/toggle">Toggle</a></li>
-									<li><a href="https://developer.microsoft.com/en-us/fluentui#/controls/web/dropdown">Dropdown</a></li>
-									<li><a href="https://developer.microsoft.com/en-us/fluentui#/controls/web/link">Link</a></li>
-									<li><a href="https://developer.microsoft.com/en-us/fluentui#/controls/web/messagebar">MessageBar</a></li>
-								</ul>
-							</li>
-						</ol>
-					</div>
-				</div>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/modules/selfserve_decorators.html

@@ -1,341 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>SelfServe/Decorators | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="selfserve_decorators.html">SelfServe/Decorators</a>
-				</li>
-			</ul>
-			<h1>Module SelfServe/Decorators</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Interfaces</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_decorators.booleaninputoptions.html" class="tsd-kind-icon">Boolean<wbr>Input<wbr>Options</a></li>
-								<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_decorators.choiceinputoptions.html" class="tsd-kind-icon">Choice<wbr>Input<wbr>Options</a></li>
-								<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_decorators.descriptiondisplayoptions.html" class="tsd-kind-icon">Description<wbr>Display<wbr>Options</a></li>
-								<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_decorators.numberinputoptions.html" class="tsd-kind-icon">Number<wbr>Input<wbr>Options</a></li>
-								<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_decorators.stringinputoptions.html" class="tsd-kind-icon">String<wbr>Input<wbr>Options</a></li>
-							</ul>
-						</section>
-						<section class="tsd-index-section ">
-							<h3>Type aliases</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-type-alias tsd-parent-kind-module"><a href="selfserve_decorators.html#inputoptions" class="tsd-kind-icon">Input<wbr>Options</a></li>
-							</ul>
-						</section>
-						<section class="tsd-index-section ">
-							<h3>Functions</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_decorators.html#isdisplayable" class="tsd-kind-icon">Is<wbr>Displayable</a></li>
-								<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_decorators.html#onchange" class="tsd-kind-icon">On<wbr>Change</a></li>
-								<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_decorators.html#propertyinfo" class="tsd-kind-icon">Property<wbr>Info</a></li>
-								<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_decorators.html#refreshoptions" class="tsd-kind-icon">Refresh<wbr>Options</a></li>
-								<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_decorators.html#values" class="tsd-kind-icon">Values</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Type aliases</h2>
-				<section class="tsd-panel tsd-member tsd-kind-type-alias tsd-parent-kind-module">
-					<a name="inputoptions" class="tsd-anchor"></a>
-					<h3>Input<wbr>Options</h3>
-					<div class="tsd-signature tsd-kind-icon">Input<wbr>Options<span class="tsd-signature-symbol">:</span> <a href="../interfaces/selfserve_decorators.numberinputoptions.html" class="tsd-signature-type" data-tsd-kind="Interface">NumberInputOptions</a><span class="tsd-signature-symbol"> | </span><a href="../interfaces/selfserve_decorators.stringinputoptions.html" class="tsd-signature-type" data-tsd-kind="Interface">StringInputOptions</a><span class="tsd-signature-symbol"> | </span><a href="../interfaces/selfserve_decorators.booleaninputoptions.html" class="tsd-signature-type" data-tsd-kind="Interface">BooleanInputOptions</a><span class="tsd-signature-symbol"> | </span><a href="../interfaces/selfserve_decorators.choiceinputoptions.html" class="tsd-signature-type" data-tsd-kind="Interface">ChoiceInputOptions</a><span class="tsd-signature-symbol"> | </span><a href="../interfaces/selfserve_decorators.descriptiondisplayoptions.html" class="tsd-signature-type" data-tsd-kind="Interface">DescriptionDisplayOptions</a></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Interprets the type of the UI element and correspondingly renders</p>
-							<ul>
-								<li>slider or spinner</li>
-								<li>text box</li>
-								<li>toggle</li>
-								<li>drop down</li>
-								<li>plain text or message bar</li>
-							</ul>
-						</div>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Functions</h2>
-				<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
-					<a name="isdisplayable" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagConst">Const</span> Is<wbr>Displayable</h3>
-					<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
-						<li class="tsd-signature tsd-kind-icon">Is<wbr>Displayable<span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">ClassDecorator</span></li>
-					</ul>
-					<ul class="tsd-descriptions">
-						<li class="tsd-description">
-							<aside class="tsd-sources">
-							</aside>
-							<div class="tsd-comment tsd-typography">
-								<div class="lead">
-									<p>Indicates to the compiler that UI should be generated from this class.</p>
-								</div>
-							</div>
-							<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">ClassDecorator</span></h4>
-						</li>
-					</ul>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
-					<a name="onchange" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagConst">Const</span> On<wbr>Change</h3>
-					<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
-						<li class="tsd-signature tsd-kind-icon">On<wbr>Change<span class="tsd-signature-symbol">(</span>onChange<span class="tsd-signature-symbol">: </span><a href="selfserve_selfservetypes.html#onchangecallback" class="tsd-signature-type" data-tsd-kind="Type alias">OnChangeCallback</a><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">PropertyDecorator</span></li>
-					</ul>
-					<ul class="tsd-descriptions">
-						<li class="tsd-description">
-							<aside class="tsd-sources">
-							</aside>
-							<div class="tsd-comment tsd-typography">
-								<div class="lead">
-									<p>Indicates the callback to be fired when the UI element corresponding to the property is changed.</p>
-								</div>
-							</div>
-							<h4 class="tsd-parameters-title">Parameters</h4>
-							<ul class="tsd-parameters">
-								<li>
-									<h5>onChange: <a href="selfserve_selfservetypes.html#onchangecallback" class="tsd-signature-type" data-tsd-kind="Type alias">OnChangeCallback</a></h5>
-								</li>
-							</ul>
-							<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">PropertyDecorator</span></h4>
-						</li>
-					</ul>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
-					<a name="propertyinfo" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagConst">Const</span> Property<wbr>Info</h3>
-					<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
-						<li class="tsd-signature tsd-kind-icon">Property<wbr>Info<span class="tsd-signature-symbol">(</span>info<span class="tsd-signature-symbol">: </span><a href="../interfaces/selfserve_selfservetypes.info.html" class="tsd-signature-type" data-tsd-kind="Interface">Info</a><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="../interfaces/selfserve_selfservetypes.info.html" class="tsd-signature-type" data-tsd-kind="Interface">Info</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">PropertyDecorator</span></li>
-					</ul>
-					<ul class="tsd-descriptions">
-						<li class="tsd-description">
-							<aside class="tsd-sources">
-							</aside>
-							<div class="tsd-comment tsd-typography">
-								<div class="lead">
-									<p>Indicates that the UI element corresponding to the property should have an Info bubble. The Info
-									bubble is the icon that looks like an &quot;i&quot; which users click on to get more information about the UI element.</p>
-								</div>
-							</div>
-							<h4 class="tsd-parameters-title">Parameters</h4>
-							<ul class="tsd-parameters">
-								<li>
-									<h5>info: <a href="../interfaces/selfserve_selfservetypes.info.html" class="tsd-signature-type" data-tsd-kind="Interface">Info</a><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="../interfaces/selfserve_selfservetypes.info.html" class="tsd-signature-type" data-tsd-kind="Interface">Info</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span></h5>
-								</li>
-							</ul>
-							<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">PropertyDecorator</span></h4>
-						</li>
-					</ul>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
-					<a name="refreshoptions" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagConst">Const</span> Refresh<wbr>Options</h3>
-					<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
-						<li class="tsd-signature tsd-kind-icon">Refresh<wbr>Options<span class="tsd-signature-symbol">(</span>refreshParams<span class="tsd-signature-symbol">: </span><a href="../interfaces/selfserve_selfservetypes.refreshparams.html" class="tsd-signature-type" data-tsd-kind="Interface">RefreshParams</a><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">ClassDecorator</span></li>
-					</ul>
-					<ul class="tsd-descriptions">
-						<li class="tsd-description">
-							<aside class="tsd-sources">
-							</aside>
-							<div class="tsd-comment tsd-typography">
-								<div class="lead">
-									<p>If there is a long running operation in your page after the <a href="../classes/selfserve_selfservetypes.selfservebaseclass.html#onsave"><code>onSave</code></a> action, the page can
-										optionally auto refresh itself using the <a href="../classes/selfserve_selfservetypes.selfservebaseclass.html#onrefresh"><code>onRefresh</code></a> action. The &#39;RefreshOptions&#39; indicate
-									how often the auto refresh of the page occurs.</p>
-								</div>
-							</div>
-							<h4 class="tsd-parameters-title">Parameters</h4>
-							<ul class="tsd-parameters">
-								<li>
-									<h5>refreshParams: <a href="../interfaces/selfserve_selfservetypes.refreshparams.html" class="tsd-signature-type" data-tsd-kind="Interface">RefreshParams</a></h5>
-								</li>
-							</ul>
-							<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">ClassDecorator</span></h4>
-						</li>
-					</ul>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
-					<a name="values" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagConst">Const</span> Values</h3>
-					<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
-						<li class="tsd-signature tsd-kind-icon">Values<span class="tsd-signature-symbol">(</span>inputOptions<span class="tsd-signature-symbol">: </span><a href="selfserve_decorators.html#inputoptions" class="tsd-signature-type" data-tsd-kind="Type alias">InputOptions</a><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">PropertyDecorator</span></li>
-					</ul>
-					<ul class="tsd-descriptions">
-						<li class="tsd-description">
-							<aside class="tsd-sources">
-							</aside>
-							<div class="tsd-comment tsd-typography">
-								<div class="lead">
-									<p>Indicates that this property should correspond to a UI element with the given parameters.</p>
-								</div>
-							</div>
-							<h4 class="tsd-parameters-title">Parameters</h4>
-							<ul class="tsd-parameters">
-								<li>
-									<h5>inputOptions: <a href="selfserve_decorators.html#inputoptions" class="tsd-signature-type" data-tsd-kind="Type alias">InputOptions</a></h5>
-								</li>
-							</ul>
-							<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">PropertyDecorator</span></h4>
-						</li>
-					</ul>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_decorators.booleaninputoptions.html" class="tsd-kind-icon">Boolean<wbr>Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_decorators.choiceinputoptions.html" class="tsd-kind-icon">Choice<wbr>Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_decorators.descriptiondisplayoptions.html" class="tsd-kind-icon">Description<wbr>Display<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_decorators.numberinputoptions.html" class="tsd-kind-icon">Number<wbr>Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_decorators.stringinputoptions.html" class="tsd-kind-icon">String<wbr>Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="selfserve_decorators.html#inputoptions" class="tsd-kind-icon">Input<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="selfserve_decorators.html#isdisplayable" class="tsd-kind-icon">Is<wbr>Displayable</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="selfserve_decorators.html#onchange" class="tsd-kind-icon">On<wbr>Change</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="selfserve_decorators.html#propertyinfo" class="tsd-kind-icon">Property<wbr>Info</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="selfserve_decorators.html#refreshoptions" class="tsd-kind-icon">Refresh<wbr>Options</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="selfserve_decorators.html#values" class="tsd-kind-icon">Values</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/modules/selfserve_selfservetelemetryprocessor.html

@@ -1,323 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>SelfServe/SelfServeTelemetryProcessor | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="selfserve_selfservetelemetryprocessor.html">SelfServe/SelfServeTelemetryProcessor</a>
-				</li>
-			</ul>
-			<h1>Module SelfServe/SelfServeTelemetryProcessor</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Functions</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_selfservetelemetryprocessor.html#selfservetrace" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace</a></li>
-								<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_selfservetelemetryprocessor.html#selfservetracecancel" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Cancel</a></li>
-								<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_selfservetelemetryprocessor.html#selfservetracefailure" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Failure</a></li>
-								<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_selfservetelemetryprocessor.html#selfservetracestart" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Start</a></li>
-								<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_selfservetelemetryprocessor.html#selfservetracesuccess" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Success</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Functions</h2>
-				<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
-					<a name="selfservetrace" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagConst">Const</span> self<wbr>Serve<wbr>Trace</h3>
-					<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
-						<li class="tsd-signature tsd-kind-icon">self<wbr>Serve<wbr>Trace<span class="tsd-signature-symbol">(</span>data<span class="tsd-signature-symbol">: </span><a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">void</span></li>
-					</ul>
-					<ul class="tsd-descriptions">
-						<li class="tsd-description">
-							<aside class="tsd-sources">
-							</aside>
-							<div class="tsd-comment tsd-typography">
-								<div class="lead">
-									<p>Log an action.</p>
-								</div>
-							</div>
-							<h4 class="tsd-parameters-title">Parameters</h4>
-							<ul class="tsd-parameters">
-								<li>
-									<h5>data: <a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a></h5>
-									<div class="tsd-comment tsd-typography">
-										<p>Data to be sent as part of the Self Serve Telemetry.</p>
-									</div>
-								</li>
-							</ul>
-							<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">void</span></h4>
-						</li>
-					</ul>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
-					<a name="selfservetracecancel" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagConst">Const</span> self<wbr>Serve<wbr>Trace<wbr>Cancel</h3>
-					<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
-						<li class="tsd-signature tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Cancel<span class="tsd-signature-symbol">(</span>data<span class="tsd-signature-symbol">: </span><a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a>, timestamp<span class="tsd-signature-symbol">?: </span><span class="tsd-signature-type">number</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">void</span></li>
-					</ul>
-					<ul class="tsd-descriptions">
-						<li class="tsd-description">
-							<aside class="tsd-sources">
-							</aside>
-							<div class="tsd-comment tsd-typography">
-								<div class="lead">
-									<p>Log an action as cancelled.</p>
-								</div>
-							</div>
-							<h4 class="tsd-parameters-title">Parameters</h4>
-							<ul class="tsd-parameters">
-								<li>
-									<h5>data: <a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a></h5>
-									<div class="tsd-comment tsd-typography">
-										<p>Data to be sent as part of the Self Serve Telemetry.</p>
-									</div>
-								</li>
-								<li>
-									<h5><span class="tsd-flag ts-flagOptional">Optional</span> timestamp: <span class="tsd-signature-type">number</span></h5>
-									<div class="tsd-comment tsd-typography">
-										<p>Timestamp of the action&#39;s start trace.</p>
-									</div>
-								</li>
-							</ul>
-							<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">void</span></h4>
-						</li>
-					</ul>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
-					<a name="selfservetracefailure" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagConst">Const</span> self<wbr>Serve<wbr>Trace<wbr>Failure</h3>
-					<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
-						<li class="tsd-signature tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Failure<span class="tsd-signature-symbol">(</span>data<span class="tsd-signature-symbol">: </span><a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a>, timestamp<span class="tsd-signature-symbol">?: </span><span class="tsd-signature-type">number</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">void</span></li>
-					</ul>
-					<ul class="tsd-descriptions">
-						<li class="tsd-description">
-							<aside class="tsd-sources">
-							</aside>
-							<div class="tsd-comment tsd-typography">
-								<div class="lead">
-									<p>Log an action as a failure.</p>
-								</div>
-							</div>
-							<h4 class="tsd-parameters-title">Parameters</h4>
-							<ul class="tsd-parameters">
-								<li>
-									<h5>data: <a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a></h5>
-									<div class="tsd-comment tsd-typography">
-										<p>Data to be sent as part of the Self Serve Telemetry.</p>
-									</div>
-								</li>
-								<li>
-									<h5><span class="tsd-flag ts-flagOptional">Optional</span> timestamp: <span class="tsd-signature-type">number</span></h5>
-									<div class="tsd-comment tsd-typography">
-										<p>Timestamp of the action&#39;s start trace.</p>
-									</div>
-								</li>
-							</ul>
-							<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">void</span></h4>
-						</li>
-					</ul>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
-					<a name="selfservetracestart" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagConst">Const</span> self<wbr>Serve<wbr>Trace<wbr>Start</h3>
-					<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
-						<li class="tsd-signature tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Start<span class="tsd-signature-symbol">(</span>data<span class="tsd-signature-symbol">: </span><a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">number</span></li>
-					</ul>
-					<ul class="tsd-descriptions">
-						<li class="tsd-description">
-							<aside class="tsd-sources">
-							</aside>
-							<div class="tsd-comment tsd-typography">
-								<div class="lead">
-									<p>Start logging an action.</p>
-								</div>
-							</div>
-							<h4 class="tsd-parameters-title">Parameters</h4>
-							<ul class="tsd-parameters">
-								<li>
-									<h5>data: <a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a></h5>
-									<div class="tsd-comment tsd-typography">
-										<p>Data to be sent as part of the Self Serve Telemetry.</p>
-									</div>
-								</li>
-							</ul>
-							<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">number</span></h4>
-							<p>Timestamp of the trace start, that can be used in other trace actions.
-							The timestamp is used to identify all the logs associated with an action.</p>
-						</li>
-					</ul>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
-					<a name="selfservetracesuccess" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagConst">Const</span> self<wbr>Serve<wbr>Trace<wbr>Success</h3>
-					<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
-						<li class="tsd-signature tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Success<span class="tsd-signature-symbol">(</span>data<span class="tsd-signature-symbol">: </span><a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a>, timestamp<span class="tsd-signature-symbol">?: </span><span class="tsd-signature-type">number</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">void</span></li>
-					</ul>
-					<ul class="tsd-descriptions">
-						<li class="tsd-description">
-							<aside class="tsd-sources">
-							</aside>
-							<div class="tsd-comment tsd-typography">
-								<div class="lead">
-									<p>Log an action as a success.</p>
-								</div>
-							</div>
-							<h4 class="tsd-parameters-title">Parameters</h4>
-							<ul class="tsd-parameters">
-								<li>
-									<h5>data: <a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a></h5>
-									<div class="tsd-comment tsd-typography">
-										<p>Data to be sent as part of the Self Serve Telemetry.</p>
-									</div>
-								</li>
-								<li>
-									<h5><span class="tsd-flag ts-flagOptional">Optional</span> timestamp: <span class="tsd-signature-type">number</span></h5>
-									<div class="tsd-comment tsd-typography">
-										<p>Timestamp of the action&#39;s start trace.</p>
-									</div>
-								</li>
-							</ul>
-							<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">void</span></h4>
-						</li>
-					</ul>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="selfserve_selfservetelemetryprocessor.html#selfservetrace" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="selfserve_selfservetelemetryprocessor.html#selfservetracecancel" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Cancel</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="selfserve_selfservetelemetryprocessor.html#selfservetracefailure" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Failure</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="selfserve_selfservetelemetryprocessor.html#selfservetracestart" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Start</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="selfserve_selfservetelemetryprocessor.html#selfservetracesuccess" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Success</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/modules/selfserve_selfservetypes.html

@@ -1,363 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>SelfServe/SelfServeTypes | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
-				</li>
-			</ul>
-			<h1>Module SelfServe/SelfServeTypes</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Enumerations</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-enum tsd-parent-kind-module"><a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a></li>
-								<li class="tsd-kind-enum tsd-parent-kind-module"><a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a></li>
-							</ul>
-						</section>
-						<section class="tsd-index-section ">
-							<h3>Classes</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-class tsd-parent-kind-module"><a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a></li>
-							</ul>
-						</section>
-						<section class="tsd-index-section ">
-							<h3>Interfaces</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a></li>
-								<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a></li>
-								<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a></li>
-								<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a></li>
-								<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a></li>
-								<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a></li>
-								<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a></li>
-							</ul>
-						</section>
-						<section class="tsd-index-section ">
-							<h3>Type aliases</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-type-alias tsd-parent-kind-module"><a href="selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a></li>
-								<li class="tsd-kind-type-alias tsd-parent-kind-module"><a href="selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a></li>
-								<li class="tsd-kind-type-alias tsd-parent-kind-module"><a href="selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a></li>
-								<li class="tsd-kind-type-alias tsd-parent-kind-module"><a href="selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a></li>
-								<li class="tsd-kind-type-alias tsd-parent-kind-module"><a href="selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Type aliases</h2>
-				<section class="tsd-panel tsd-member tsd-kind-type-alias tsd-parent-kind-module">
-					<a name="choiceitem" class="tsd-anchor"></a>
-					<h3>Choice<wbr>Item</h3>
-					<div class="tsd-signature tsd-kind-icon">Choice<wbr>Item<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">{ </span>key<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">; </span>labelTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> }</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-type-declaration">
-						<h4>Type declaration</h4>
-						<ul class="tsd-parameters">
-							<li class="tsd-parameter">
-								<h5>key<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
-								<div class="tsd-comment tsd-typography">
-									<div class="lead">
-										<p>Key used to pickup the string that uniquely identifies the dropdown choice item, from the strings JSON file.</p>
-									</div>
-								</div>
-							</li>
-							<li class="tsd-parameter">
-								<h5>labelTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
-								<div class="tsd-comment tsd-typography">
-									<div class="lead">
-										<p>Key used to pickup the string corresponding to the label of the dropdown choice item, from the strings JSON file.</p>
-									</div>
-								</div>
-							</li>
-						</ul>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-type-alias tsd-parent-kind-module">
-					<a name="inputtype" class="tsd-anchor"></a>
-					<h3>Input<wbr>Type</h3>
-					<div class="tsd-signature tsd-kind-icon">Input<wbr>Type<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">number</span><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-type">boolean</span><span class="tsd-signature-symbol"> | </span><a href="selfserve_selfservetypes.html#choiceitem" class="tsd-signature-type" data-tsd-kind="Type alias">ChoiceItem</a><span class="tsd-signature-symbol"> | </span><a href="../interfaces/selfserve_selfservetypes.description.html" class="tsd-signature-type" data-tsd-kind="Interface">Description</a></div>
-					<aside class="tsd-sources">
-					</aside>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-type-alias tsd-parent-kind-module">
-					<a name="onchangecallback" class="tsd-anchor"></a>
-					<h3>On<wbr>Change<wbr>Callback</h3>
-					<div class="tsd-signature tsd-kind-icon">On<wbr>Change<wbr>Callback<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">(</span>newValue<span class="tsd-signature-symbol">: </span><a href="selfserve_selfservetypes.html#inputtype" class="tsd-signature-type" data-tsd-kind="Type alias">InputType</a>, currentValues<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span>, baselineValues<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">ReadonlyMap</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-comment tsd-typography">
-						<div class="lead">
-							<p>Function that dictates how the overall UI should transform when the UI element corresponding to a property, say prop1, is changed.
-							The callback can be used to<br>          * Change the value (and reflect it in the UI) for another property, say prop2<br>          * Change the visibility for prop2 in the UI<br>          * Disable or enable the UI element corresponding to prop2<br>depending on logic based on the newValue of prop1, the currentValues Map and baselineValues Map.</p>
-						</div>
-					</div>
-					<div class="tsd-type-declaration">
-						<h4>Type declaration</h4>
-						<ul class="tsd-parameters">
-							<li class="tsd-parameter-signature">
-								<ul class="tsd-signatures tsd-kind-type-literal tsd-parent-kind-type-alias">
-									<li class="tsd-signature tsd-kind-icon"><span class="tsd-signature-symbol">(</span>newValue<span class="tsd-signature-symbol">: </span><a href="selfserve_selfservetypes.html#inputtype" class="tsd-signature-type" data-tsd-kind="Type alias">InputType</a>, currentValues<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span>, baselineValues<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">ReadonlyMap</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span></li>
-								</ul>
-								<ul class="tsd-descriptions">
-									<li class="tsd-description">
-										<h4 class="tsd-parameters-title">Parameters</h4>
-										<ul class="tsd-parameters">
-											<li>
-												<h5>newValue: <a href="selfserve_selfservetypes.html#inputtype" class="tsd-signature-type" data-tsd-kind="Type alias">InputType</a></h5>
-												<div class="tsd-comment tsd-typography">
-													<p>The newValue that the property needs to be set to, after the change in the UI element corresponding to this property.</p>
-												</div>
-											</li>
-											<li>
-												<h5>currentValues: <span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span></h5>
-												<div class="tsd-comment tsd-typography">
-													<p>The map of propertyName =&gt; <a href="../interfaces/selfserve_selfservetypes.smartuiinput.html"><code>SmartUiInput</code></a> corresponding to the current state of the UI.</p>
-												</div>
-											</li>
-											<li>
-												<h5>baselineValues: <span class="tsd-signature-type">ReadonlyMap</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span></h5>
-												<div class="tsd-comment tsd-typography">
-													<p>The map of propertyName =&gt; <a href="../interfaces/selfserve_selfservetypes.smartuiinput.html"><code>SmartUiInput</code></a> corresponding to the initial state of the UI.</p>
-												</div>
-											</li>
-										</ul>
-										<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span></h4>
-										<p>A new Map of propertyName =&gt; <a href="../interfaces/selfserve_selfservetypes.smartuiinput.html"><code>SmartUiInput</code></a> corresponding to the new state of the overall UI</p>
-									</li>
-								</ul>
-							</li>
-						</ul>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-type-alias tsd-parent-kind-module">
-					<a name="initializecallback" class="tsd-anchor"></a>
-					<h3>initialize<wbr>Callback</h3>
-					<div class="tsd-signature tsd-kind-icon">initialize<wbr>Callback<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">&gt;</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-type-declaration">
-						<h4>Type declaration</h4>
-						<ul class="tsd-parameters">
-							<li class="tsd-parameter-signature">
-								<ul class="tsd-signatures tsd-kind-type-literal tsd-parent-kind-type-alias">
-									<li class="tsd-signature tsd-kind-icon"><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">&gt;</span></li>
-								</ul>
-								<ul class="tsd-descriptions">
-									<li class="tsd-description">
-										<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">&gt;</span></h4>
-										<p>Promise of Map of propertyName =&gt; <a href="../interfaces/selfserve_selfservetypes.smartuiinput.html"><code>SmartUiInput</code></a> which will become the current state of the UI.</p>
-									</li>
-								</ul>
-							</li>
-						</ul>
-					</div>
-				</section>
-				<section class="tsd-panel tsd-member tsd-kind-type-alias tsd-parent-kind-module">
-					<a name="onsavecallback" class="tsd-anchor"></a>
-					<h3>on<wbr>Save<wbr>Callback</h3>
-					<div class="tsd-signature tsd-kind-icon">on<wbr>Save<wbr>Callback<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">(</span>currentValues<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span>, baselineValues<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">ReadonlyMap</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="../interfaces/selfserve_selfservetypes.onsaveresult.html" class="tsd-signature-type" data-tsd-kind="Interface">OnSaveResult</a><span class="tsd-signature-symbol">&gt;</span></div>
-					<aside class="tsd-sources">
-					</aside>
-					<div class="tsd-type-declaration">
-						<h4>Type declaration</h4>
-						<ul class="tsd-parameters">
-							<li class="tsd-parameter-signature">
-								<ul class="tsd-signatures tsd-kind-type-literal tsd-parent-kind-type-alias">
-									<li class="tsd-signature tsd-kind-icon"><span class="tsd-signature-symbol">(</span>currentValues<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span>, baselineValues<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">ReadonlyMap</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="../interfaces/selfserve_selfservetypes.onsaveresult.html" class="tsd-signature-type" data-tsd-kind="Interface">OnSaveResult</a><span class="tsd-signature-symbol">&gt;</span></li>
-								</ul>
-								<ul class="tsd-descriptions">
-									<li class="tsd-description">
-										<h4 class="tsd-parameters-title">Parameters</h4>
-										<ul class="tsd-parameters">
-											<li>
-												<h5>currentValues: <span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span></h5>
-												<div class="tsd-comment tsd-typography">
-													<p>The map of propertyName =&gt; <a href="../interfaces/selfserve_selfservetypes.smartuiinput.html"><code>SmartUiInput</code></a> corresponding to the current state of the UI</p>
-												</div>
-											</li>
-											<li>
-												<h5>baselineValues: <span class="tsd-signature-type">ReadonlyMap</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span></h5>
-												<div class="tsd-comment tsd-typography">
-													<p>The map of propertyName =&gt; <a href="../interfaces/selfserve_selfservetypes.smartuiinput.html"><code>SmartUiInput</code></a> corresponding to the initial state of the UI</p>
-												</div>
-											</li>
-										</ul>
-										<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="../interfaces/selfserve_selfservetypes.onsaveresult.html" class="tsd-signature-type" data-tsd-kind="Interface">OnSaveResult</a><span class="tsd-signature-symbol">&gt;</span></h4>
-									</li>
-								</ul>
-							</li>
-						</ul>
-					</div>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
-					</li>
-					<li class=" tsd-kind-class tsd-parent-kind-module">
-						<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
-					</li>
-					<li class=" tsd-kind-interface tsd-parent-kind-module">
-						<a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
-					</li>
-					<li class=" tsd-kind-type-alias tsd-parent-kind-module">
-						<a href="selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

docs/modules/selfserve_selfserveutils.html

@@ -1,185 +0,0 @@
-<!doctype html>
-<html class="default no-js">
-<head>
-	<meta charset="utf-8">
-	<meta http-equiv="X-UA-Compatible" content="IE=edge">
-	<title>SelfServe/SelfServeUtils | cosmos-explorer</title>
-	<meta name="description" content="Documentation for cosmos-explorer">
-	<meta name="viewport" content="width=device-width, initial-scale=1">
-	<link rel="stylesheet" href="../assets/css/main.css">
-	<script async src="../assets/js/search.js" id="search-script"></script>
-</head>
-<body>
-<header>
-	<div class="tsd-page-toolbar">
-		<div class="container">
-			<div class="table-wrap">
-				<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
-					<div class="field">
-						<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
-						<input id="tsd-search-field" type="text" />
-					</div>
-					<ul class="results">
-						<li class="state loading">Preparing search index...</li>
-						<li class="state failure">The search index is not available</li>
-					</ul>
-					<a href="../index.html" class="title">cosmos-explorer</a>
-				</div>
-				<div class="table-cell" id="tsd-widgets">
-					<div id="tsd-filter">
-						<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
-						<div class="tsd-filter-group">
-							<div class="tsd-select" id="tsd-filter-visibility">
-								<span class="tsd-select-label">All</span>
-								<ul class="tsd-select-list">
-									<li data-value="public">Public</li>
-									<li data-value="protected">Public/Protected</li>
-									<li data-value="private" class="selected">All</li>
-								</ul>
-							</div>
-							<input type="checkbox" id="tsd-filter-inherited" checked />
-							<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
-							<input type="checkbox" id="tsd-filter-externals" checked />
-							<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
-						</div>
-					</div>
-					<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
-				</div>
-			</div>
-		</div>
-	</div>
-	<div class="tsd-page-title">
-		<div class="container">
-			<ul class="tsd-breadcrumb">
-				<li>
-					<a href="../modules.html">cosmos-explorer</a>
-				</li>
-				<li>
-					<a href="selfserve_selfserveutils.html">SelfServe/SelfServeUtils</a>
-				</li>
-			</ul>
-			<h1>Module SelfServe/SelfServeUtils</h1>
-		</div>
-	</div>
-</header>
-<div class="container container-main">
-	<div class="row">
-		<div class="col-8 col-content">
-			<section class="tsd-panel-group tsd-index-group">
-				<h2>Index</h2>
-				<section class="tsd-panel tsd-index-panel">
-					<div class="tsd-index-content">
-						<section class="tsd-index-section ">
-							<h3>Enumerations</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-enum tsd-parent-kind-module"><a href="../enums/selfserve_selfserveutils.bladetype.html" class="tsd-kind-icon">Blade<wbr>Type</a></li>
-								<li class="tsd-kind-enum tsd-parent-kind-module"><a href="../enums/selfserve_selfserveutils.selfservetype.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Type</a></li>
-							</ul>
-						</section>
-						<section class="tsd-index-section ">
-							<h3>Functions</h3>
-							<ul class="tsd-index-list">
-								<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_selfserveutils.html#generatebladelink" class="tsd-kind-icon">generate<wbr>Blade<wbr>Link</a></li>
-							</ul>
-						</section>
-					</div>
-				</section>
-			</section>
-			<section class="tsd-panel-group tsd-member-group ">
-				<h2>Functions</h2>
-				<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
-					<a name="generatebladelink" class="tsd-anchor"></a>
-					<h3><span class="tsd-flag ts-flagConst">Const</span> generate<wbr>Blade<wbr>Link</h3>
-					<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
-						<li class="tsd-signature tsd-kind-icon">generate<wbr>Blade<wbr>Link<span class="tsd-signature-symbol">(</span>blade<span class="tsd-signature-symbol">: </span><a href="../enums/selfserve_selfserveutils.bladetype.html" class="tsd-signature-type" data-tsd-kind="Enumeration">BladeType</a><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></li>
-					</ul>
-					<ul class="tsd-descriptions">
-						<li class="tsd-description">
-							<aside class="tsd-sources">
-							</aside>
-							<div class="tsd-comment tsd-typography">
-								<div class="lead">
-									<p>Generate the URL corresponding to the portal blade for the current Azure Cosmos DB account</p>
-								</div>
-							</div>
-							<h4 class="tsd-parameters-title">Parameters</h4>
-							<ul class="tsd-parameters">
-								<li>
-									<h5>blade: <a href="../enums/selfserve_selfserveutils.bladetype.html" class="tsd-signature-type" data-tsd-kind="Enumeration">BladeType</a></h5>
-								</li>
-							</ul>
-							<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">string</span></h4>
-						</li>
-					</ul>
-				</section>
-			</section>
-		</div>
-		<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
-			<nav class="tsd-navigation primary">
-				<ul>
-					<li class=" ">
-						<a href="../modules.html">Modules</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve.html">Self<wbr>Serve</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
-					</li>
-					<li class=" tsd-kind-module">
-						<a href="selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
-					</li>
-					<li class="current tsd-kind-module">
-						<a href="selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
-					</li>
-				</ul>
-			</nav>
-			<nav class="tsd-navigation secondary menu-sticky">
-				<ul class="before-current">
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfserveutils.bladetype.html" class="tsd-kind-icon">Blade<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-enum tsd-parent-kind-module">
-						<a href="../enums/selfserve_selfserveutils.selfservetype.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Type</a>
-					</li>
-					<li class=" tsd-kind-function tsd-parent-kind-module">
-						<a href="selfserve_selfserveutils.html#generatebladelink" class="tsd-kind-icon">generate<wbr>Blade<wbr>Link</a>
-					</li>
-				</ul>
-			</nav>
-		</div>
-	</div>
-</div>
-<footer class="with-border-bottom">
-	<div class="container">
-		<h2>Legend</h2>
-		<div class="tsd-legend-group">
-			<ul class="tsd-legend">
-				<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
-				<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
-			</ul>
-			<ul class="tsd-legend">
-				<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
-			</ul>
-		</div>
-	</div>
-</footer>
-<div class="container tsd-generator">
-	<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
-</div>
-<div class="overlay"></div>
-<script src="../assets/js/main.js"></script>
-</body>
-</html>

images/notebook/publish_content.svg

@@ -1,3 +0,0 @@
-<svg width="16" height="16" viewBox="0 0 16 16" fill="none" xmlns="http://www.w3.org/2000/svg">
-<path d="M7.31449 2.01439L4.00103 5.31963L3.26105 4.57965L7.8407 0L12.4203 4.57965L11.6804 5.31963L8.36691 2.01439V12.8428H7.31449V2.01439ZM13.629 12.8428H14.6814V16H1V12.8428H2.05242V14.9476H13.629V12.8428Z" fill="#0078D4"/>
-</svg>

jest-playwright.config.js

@@ -1,13 +0,0 @@
-const isCI = require("is-ci");
-
-module.exports = {
-  exitOnPageError: false,
-  launchOptions: {
-    headless: isCI,
-    slowMo: 10,
-    timeout: 60000,
-  },
-  contextOptions: {
-    ignoreHTTPSErrors: true,
-  },
-};

jest-puppeteer.config.js

@@ -0,0 +1,11 @@
+const isCI = require("is-ci");
+
+module.exports = {
+  launch: {
+    headless: isCI,
+    slowMo: 55,
+    defaultViewport: null,
+    ignoreHTTPSErrors: true,
+    args: ["--disable-web-security"]
+  }
+};

jest.config.e2e.js

@@ -0,0 +1,5 @@
+module.exports = {
+  preset: "jest-puppeteer",
+  testMatch: ["<rootDir>/test/**/*.spec.[jt]s?(x)"],
+  setupFiles: ["dotenv/config"]
+};

jest.config.js

@@ -21,13 +21,17 @@ module.exports = {
   collectCoverage: true,
 
   // An array of glob patterns indicating a set of files for which coverage information should be collected
-  collectCoverageFrom: ["src/**/*.{js,jsx,ts,tsx}"],
+  // collectCoverageFrom: [
+  //   "src/Common/Headers*"
+  // ],
 
   // The directory where Jest should output its coverage files
   coverageDirectory: "coverage",
 
   // An array of regexp pattern strings used to skip coverage collection
-  coveragePathIgnorePatterns: ["/node_modules/"],
+  // coveragePathIgnorePatterns: [
+  //   "/node_modules/"
+  // ],
 
   // A list of reporter names that Jest uses when writing coverage reports
   coverageReporters: ["json", "text", "cobertura"],
@@ -35,11 +39,11 @@ module.exports = {
   // An object that configures minimum threshold enforcement for coverage results
   coverageThreshold: {
     global: {
-      branches: 25,
-      functions: 25,
+      branches: 20,
+      functions: 24,
       lines: 30,
-      statements: 30,
-    },
+      statements: 29.0
+    }
   },
 
   // Make calling deprecated APIs throw helpful error messages
@@ -67,13 +71,12 @@ module.exports = {
 
   // A map from regular expressions to module names that allow to stub out resources with a single module
   moduleNameMapper: {
-    "^.*[.](svg|png|gif|less|css)$": "<rootDir>/mockModule",
-    "@nteract/stateful-components/(.*)$": "<rootDir>/mockModule",
-    "@fluentui/react/lib/(.*)$": "@fluentui/react/lib-commonjs/$1", // https://github.com/microsoft/fluentui/wiki/Version-8-release-notes
-    "monaco-editor/(.*)$": "<rootDir>/__mocks__/monaco-editor",
+    "^.*[.](svg|png|gif|less)$": "<rootDir>/mockModule",
+    "worker-loader": "<rootDir>/mockModule",
+    "office-ui-fabric-react/lib/(.*)$": "office-ui-fabric-react/lib-commonjs/$1", // https://github.com/OfficeDev/office-ui-fabric-react/wiki/Fabric-6-Release-Notes
     "^dnd-core$": "dnd-core/dist/cjs",
     "^react-dnd$": "react-dnd/dist/cjs",
-    "^react-dnd-html5-backend$": "react-dnd-html5-backend/dist/cjs",
+    "^react-dnd-html5-backend$": "react-dnd-html5-backend/dist/cjs"
   },
 
   // An array of regexp pattern strings, matched against all module paths before considered 'visible' to the module loader
@@ -161,11 +164,11 @@ module.exports = {
   // A map from regular expressions to paths to transformers
   transform: {
     "^.+\\.html?$": "html-loader-jest",
-    "^.+\\.[t|j]sx?$": "babel-jest",
+    "^.+\\.[t|j]sx?$": "babel-jest"
   },
 
   // An array of regexp pattern strings that are matched against all source file paths, matched files will skip transformation
-  transformIgnorePatterns: ["/node_modules/", "/externals/"],
+  transformIgnorePatterns: ["/node_modules/", "/externals/"]
 
   // An array of regexp pattern strings that are matched against all modules before the module loader will automatically return a mock for them
   // unmockedModulePathPatterns: undefined,

jest.config.playwright.js

@@ -1,7 +0,0 @@
-module.exports = {
-  preset: "jest-playwright-preset",
-  testMatch: ["<rootDir>/test/**/*.spec.[jt]s?(x)"],
-  setupFiles: ["dotenv/config"],
-  testEnvironment: "./test/playwrightEnv.js",
-  setupFilesAfterEnv: ["expect-playwright"],
-};

less/Common/Constants.less

@@ -3,8 +3,8 @@
 /******************************************************************************/
 
 @font-face {
-  font-family: wf_segoe-ui_normal;
-  src: local("Segoe UI"), url("../../fonts/segoe-ui/west-european/normal/latest.woff");
+    font-family: wf_segoe-ui_normal;
+    src: url('../../fonts/segoe-ui/west-european/normal/latest.woff');
 }
 
 @DataExplorerFont: wf_segoe-ui_normal, "Segoe UI", "Segoe WP", Tahoma, Arial, sans-serif;
@@ -20,26 +20,26 @@
                                 COLORS
 /******************************************************************************/
 
-@AccentMediumHigh: #0058ad;
-@AccentMedium: #004e87;
-@AccentHigh: #1ebaed;
-@AccentExtraHigh: #55b3ff;
-@AccentLow: #edf6ff;
-@AccentMediumLow: #ddeefe;
-@AccentLight: #eef7ff;
-@AccentExtra: #ddf0ff;
+@AccentMediumHigh: #0058AD;
+@AccentMedium: #004E87;
+@AccentHigh: #1EBAED;
+@AccentExtraHigh: #55B3FF;
+@AccentLow: #EDF6FF;
+@AccentMediumLow: #DDEEFE;
+@AccentLight: #EEF7FF;
+@AccentExtra: #DDF0FF;
 
-@SelectionHigh: #b91f26;
-@BaseLight: #ffffff;
+@SelectionHigh: #B91F26;
+@BaseLight: #FFFFFF;
 @BaseDark: #000000;
-@NotificationLow: #fff4ce;
-@NotificationHigh: #f9e9b0;
-@Purple1: #8a2da5;
+@NotificationLow: #FFF4CE;
+@NotificationHigh: #F9E9B0;
+@Purple1: #8A2DA5;
 @Dirty: #9b4f96;
 
-@BaseLow: #f2f2f2;
-@BaseMediumLow: #e6e6e6;
-@BaseMedium: #cccccc;
+@BaseLow: #F2F2F2;
+@BaseMediumLow: #E6E6E6;
+@BaseMedium: #CCCCCC;
 @BaseMediumHigh: #767676;
 @BaseHigh: #393939;
 
@@ -53,17 +53,10 @@
 
 @ErrorColor: @SelectionHigh;
 
-@SelectionColor: #3074b0;
+@SelectionColor: #3074B0;
 
 @FocusColor: #605e5c;
 
-@GalleryBackgroundColor: #fdfdfd;
-
-//Icons
-@InfoIconColor: #0072c6;
-@WarningIconColor: #db7500;
-@ErrorIconColor: #b91f26;
-
 /******************************************************************************
                                 METRICS
 /******************************************************************************/
@@ -87,7 +80,7 @@
 @ImgWidth: 14px;
 @ImgHeight: 14px;
 
-@toggleFontWeight: 700;
+@toggleFontWeight:700;
 
 //Resource Tree
 @TreeLineHeight: 17px;
@@ -151,16 +144,16 @@
 /**********************************************************************************/
 
 .flex-display(@display: flex) {
-  display: ~"-webkit-@{display}";
-  display: ~"-ms-@{display}box"; // IE10 uses -ms-flexbox
-  display: ~"-ms-@{display}"; // IE11
-  display: @display;
+	display: ~"-webkit-@{display}";
+	display: ~"-ms-@{display}box"; // IE10 uses -ms-flexbox
+	display: ~"-ms-@{display}"; // IE11
+	display: @display;
 }
 
 .flex-direction(@direction: column) {
   -webkit-flex-direction: @direction;
-  -ms-flex-direction: @direction;
-  flex-direction: @direction;
+      -ms-flex-direction: @direction;
+          flex-direction: @direction;
 }
 
 /*************************************************************************************
@@ -168,31 +161,32 @@
 **************************************************************************************/
 
 @media all and (-ms-high-contrast: none), (-ms-high-contrast: active) {
-  .selectedRadio,
-  .selectedRadio:hover,
-  .selectedRadio:active,
-  .selectedRadio.dirty,
-  .tab [type="radio"]:checked ~ label,
-  .tab [type="radio"]:checked ~ label:hover {
-    -ms-high-contrast-adjust: none;
-    -webkit-text-fill-color: HighlightText;
-    color: HighlightText;
-    border-color: HighlightText;
-    background-color: Highlight;
-  }
-
-  .queryMetricsSummaryTuple {
-    th,
-    td {
-      &:nth-child(2) {
-        width: @IETableDataWidth;
-      }
-
-      &:nth-child(3) {
-        width: 50%;
-      }
+    .selectedRadio,
+    .selectedRadio:hover,
+    .selectedRadio:active,
+    .selectedRadio.dirty,
+    .tab [type=radio]:checked ~ label,
+    .tab [type=radio]:checked ~ label:hover {
+        -ms-high-contrast-adjust: none;
+        -webkit-text-fill-color: HighlightText;
+        color: HighlightText;
+        border-color: HighlightText;
+        background-color: Highlight;
+    }
+
+    .queryMetricsSummaryTuple {
+
+        th, td {
+
+            &:nth-child(2) {
+                width: @IETableDataWidth;
+            }
+
+            &:nth-child(3) {
+                width: 50%;
+            }
+        }
     }
-  }
 }
 
 /********************************************************************************************
@@ -200,15 +194,15 @@
 *********************************************************************************************/
 
 .hover() {
-  background-color: @AccentLight;
+    background-color: @AccentLight;
 }
 
 .active() {
-  background-color: @AccentExtra;
+    background-color: @AccentExtra;
 }
 
 .focus() {
-  outline: 1px dashed @FocusColor;
+    outline: 1px dashed @FocusColor;
 }
 
 /************************************************************************************************
@@ -218,87 +212,63 @@
 @ToggleWidth: 180px;
 
 .toggleSwitch() {
-  max-width: 100%;
-  margin-bottom: @SmallSpace;
-  padding: @SmallSpace;
-  cursor: pointer;
-  color: @BaseHigh;
-  font-weight: 400;
-  font-size: @mediumFontSize;
-  font-family: @DataExplorerFont;
+    max-width: 100%;
+    margin-bottom: @SmallSpace;
+    padding: @SmallSpace;
+    cursor: pointer;
+    color: @BaseHigh;
+    font-weight: 400;
+    font-size: @mediumFontSize;
+    font-family: @DataExplorerFont;
 }
 
 .selectedToggle() {
-  border-bottom: 2px solid @BaseHigh;
+    border-bottom: 2px solid @BaseHigh;
 }
 
 .unselectedToggle() {
-  color: @AccentMediumHigh;
+    color: @AccentMediumHigh;
 }
 
 /********************************************************************************************************
                              Common Data Explorer Icons
 *********************************************************************************************************/
 .dataExplorerIcons() {
-  cursor: pointer;
-  width: @ImgWidth;
-  height: @ImgHeight;
+    cursor: pointer;
+    width: @ImgWidth;
+    height: @ImgHeight;
 }
 
 /*********************************************************************************************************
                             Info Tooltip
 **********************************************************************************************************/
 .infoTooltip() {
-  position: relative;
-  display: inline-block;
+    position: relative;
+    display: inline-block;
 }
 
 .tooltipText(@textColor: @BaseLight, @backgroundColor: @BaseHigh) {
-  visibility: hidden;
-  background-color: @backgroundColor;
-  color: @textColor;
-  position: absolute;
-  z-index: 1;
-  left: @MediumSpace;
-  padding: @MediumSpace;
+    visibility: hidden;
+    background-color: @backgroundColor;
+    color: @textColor;
+    position: absolute;
+    z-index: 1;
+    left: @MediumSpace;
+    padding: @MediumSpace;
 }
 
 .tooltipTextAfter(@color: @BaseDark) {
-  content: "";
-  position: absolute;
-  right: 100%;
-  border-style: solid;
-  border-color: transparent @color transparent transparent;
-  left: 0px;
-  width: 0;
-  height: 0;
-  border-color: @InfoPointerColor transparent;
+    content: "";
+    position: absolute;
+    right: 100%;
+    border-style: solid;
+    border-color: transparent @color transparent transparent;
+    left: 0px;
+    width: 0;
+    height: 0;
+    border-color: @InfoPointerColor transparent;
 }
 
 .tooltipVisible() {
-  visibility: visible;
-}
-
-.inputTooltip() {
-  position: relative;
-}
-
-.inputTooltipText(@textColor: @BaseLight, @backgroundColor: @BaseHigh) {
-  background-color: @backgroundColor;
-  color: @textColor;
-  position: absolute;
-  z-index: 1;
-  padding: @MediumSpace;
-}
-
-.inputTooltipTextAfter(@color: @BaseDark) {
-  content: "";
-  position: absolute;
-  right: 100%;
-  border-style: solid;
-  border-color: transparent @color transparent transparent;
-  left: 10px;
-  width: 0;
-  height: 0;
-  border-color: @InfoPointerColor transparent;
+    visibility: visible;
 }

less/forms.less

@@ -200,12 +200,4 @@
 
 .migration:disabled {
     background-color: #ccc;
-}
-
-.trigger-field {
-    width: 40%;
-    margin-top: 10px
-}
-.trigger-form {
-    padding: 10px 30px 10px 30px;
 }

less/hostedexplorer.less

@@ -13,11 +13,6 @@
 @NavMediumSpace: 10px;
 @NavLargeSpace: 15px;
 
-.skip-link {
-    position: fixed;
-    top: -200px;
-}
-
 html {
     font-family: wf_segoe-ui_normal, "Segoe UI", "Segoe WP", Tahoma, Arial, sans-serif;
     padding: 0px;

less/resourceTree.less

@@ -2,7 +2,6 @@
 
 .dataResourceTree {
   margin-left: @MediumSpace;
-  overflow: auto;
 
   .databaseHeader {
     font-size: 14px;

less/tree.less

@@ -1,270 +1,280 @@
 @import "./Common/Constants";
 
-.resourceTree {
-  height: 100%;
-  flex: 0 0 auto;
-  .main {
+.main {
+    width: 100%;
+    float: left;
+    transition: all .0s ease-in-out;
+    -ms-transition: all 0s ease-in-out;
+    -webkit-transition: all 0s ease-in-out;
+    -moz-transition: all .0s ease-in-out;
     height: 100%;
-  }
+    background-color: white;
+    border-left: 0px solid white;
+}
+
+.resourceTree {
+    height: 100%;
+    flex: 0 0 auto;
 }
 
 .resourceTreeScroll {
-  height: 100%;
-  display: flex;
-  overflow-y: auto;
-  overflow-x: hidden;
-  padding-right: 10px;
+    height: 100%;
+    display: flex;
+    overflow-y: auto;
+    overflow-x: hidden;
+    padding-right: 10px;
 }
 
 .userSelectNone {
-  -webkit-user-select: none;
-  -moz-user-select: none;
-  -ms-user-select: none;
+    -webkit-user-select: none;
+    -moz-user-select: none;
+    -ms-user-select: none;
 }
 
 .treeHovermargin {
-  margin-left: 16px;
+    margin-left: 16px;
 }
 
 .highlight {
-  padding: @SmallSpace 2px;
-  outline: 0;
+    padding: @SmallSpace 2px;
+    outline: 0;
 
-  &:hover {
-    .hover();
-  }
+    &:hover {
+        .hover();
+    }
 
-  &:active {
-    .active();
-  }
+    &:active {
+        .active();
+    }
 
-  &:focus {
-    .focus();
-  }
+    &:focus {
+        .focus();
+    }
 }
 
 .contextmenushowing {
-  background-color: #eee;
+    background-color: #EEE;
 }
 
 .collectionstree {
-  width: 100%;
-  margin-top: @DefaultSpace;
+    width: 100%;
+    margin-top: @DefaultSpace;
 
-  .databaseList {
-    list-style-type: none;
-    padding-left: 0px;
 
-    .collectionList {
-      padding-left: (2 * @MediumSpace);
+    .databaseList {
+        list-style-type: none;
+        padding-left: 0px;
+
+        .collectionList {
+            padding-left:(2 * @MediumSpace);
+        }
+
+        .collectionChildList {
+            padding-left: @LargeSpace;
+        }
+
+        .databaseDocuments {
+            padding-left: (5 * @MediumSpace);
+        }
     }
-
-    .collectionChildList {
-      padding-left: @LargeSpace;
-    }
-
-    .databaseDocuments {
-      padding-left: (5 * @MediumSpace);
-    }
-  }
 }
 
 .pointerCursor {
-  cursor: pointer;
+    cursor: pointer;
 }
 
 .menuEllipsis {
-  padding-right: 6px;
-  font-weight: bold;
-  font-size: 18px;
-  position: relative;
-  top: -5px;
-  left: 0px;
-  float: right;
-  display: none;
-  padding-left: 6px !important;
-  line-height: @TreeLineHeight;
+    padding-right: 6px;
+    font-weight: bold;
+    font-size: 18px;
+    position: relative;
+    top: -5px;
+    left: 0px;
+    float: right;
+    display: none;
+    padding-left: 6px!important;
+    line-height: @TreeLineHeight;
 }
 
 .databaseMenu {
-  .flex-display();
+    .flex-display();
 }
 
 .databaseMenu:hover .menuEllipsis,
 .databaseMenu:focus .menuEllipsis {
-  display: block;
+    display: block;
 }
 
 .databaseCollChildTextOverflow {
-  text-overflow: ellipsis;
-  white-space: nowrap;
-  overflow: hidden;
-  flex: 1;
+    text-overflow: ellipsis;
+    white-space: nowrap;
+    overflow: hidden;
+    flex: 1;
 }
 
 .collectionMenu {
-  .flex-display();
+    .flex-display();
 }
 
 .collectionMenu:hover .menuEllipsis,
 .collectionMenu:focus .menuEllipsis {
-  display: block;
+    display: block;
 }
 
 .documentsMenu:hover .menuEllipsis,
 .documentsMenu:focus .menuEllipsis {
-  display: block;
+    display: block;
 }
 
 .treeChildMenu {
-  display: flex;
+    display: flex;
 }
 
 .storedProcedureMenu:hover .menuEllipsis,
 .storedProcedureMenu:focus .menuEllipsis {
-  display: block;
+    display: block;
 }
 
 .childMenu {
-  overflow: hidden;
-  text-overflow: ellipsis;
-  white-space: nowrap;
-  padding-left: (6 * @MediumSpace);
-  width: 100%;
+    overflow: hidden;
+    text-overflow: ellipsis;
+    white-space: nowrap;
+    padding-left: (6 * @MediumSpace);
+    width: 100%;
 }
 
 .storedChildMenu:hover .menuEllipsis,
 .storedChildMenu:focus .menuEllipsis {
-  display: block;
+    display: block;
 }
 
 .contextmenu6 {
-  top: -29px;
+    top: -29px;
 }
 
 .userDefinedMenu:hover .contextmenu6 {
-  display: block;
+    display: block;
 }
 
 .userDefinedchildMenu:hover .menuEllipsis,
 .userDefinedchildMenu:focus .menuEllipsis {
-  display: block;
+    display: block;
 }
 
 .triggersMenu:hover .menuEllipsis,
 .triggersMenu:focus .menuEllipsis {
-  display: block;
+    display: block;
 }
 
 .triggersChildMenu:hover .menuEllipsis,
 .triggersChildMenu:focus .menuEllipsis {
-  display: block;
+    display: block;
 }
 
 .databaseId {
-  font-size: 14px;
+    font-size: 14px;
 }
 
 .storedUdfTriggerMenu {
-  padding-left: 0px;
+    padding-left: 0px;
 }
 
 .collectionstree img {
-  width: 16px;
-  height: 16px;
-  vertical-align: text-top;
+    width: 16px;
+    height: 16px;
+    vertical-align: text-top;
 }
 
 img.collectionsTreeCollapseExpand {
-  width: 10px;
-  height: 10px;
-  vertical-align: middle;
-  margin-bottom: 5px;
+    width: 10px;
+    height: 10px;
+    vertical-align: middle;
+    margin-bottom: 5px;
 }
 
 .collapsed::before {
-  content: "\23F5";
-  margin-left: 0px;
-  font-size: 15px;
+    content: "\23F5";
+    margin-left: 0px;
+    font-size: 15px;
 }
 
 .expanded::before {
-  content: "\23F7";
-  margin-left: 0px;
-  font-size: 15px;
+    content: '\23F7';
+    margin-left: 0px;
+    font-size: 15px;
 }
 
 .collectionMenuChildren {
-  padding-left: 42px;
+    padding-left: 42px;
 }
 
 .main-nav {
-  width: 100vh;
-  height: 40px;
-  background: white;
-  transform-origin: left top;
-  -webkit-transform-origin: left top;
-  -ms-transform-origin: left top;
-  transform: rotate(-90deg) translateX(-100%);
-  -webkit-transform: rotate(-90deg) translateX(-100%);
-  -ms-transform: rotate(-90deg) translateX(-100%);
-  border-bottom: 1px solid #ccc;
+    width: 100vh;
+    height: 40px;
+    background: white;
+    transform-origin: left top;
+    -webkit-transform-origin: left top;
+    -ms-transform-origin: left top;
+    transform: rotate(-90deg) translateX(-100%);
+    -webkit-transform: rotate(-90deg) translateX(-100%);
+    -ms-transform: rotate(-90deg) translateX(-100%);
+    border-bottom: 1px solid #CCC;
 }
 
 .main-nav-img {
-  width: 16px;
-  height: 16px;
-  margin: -32px 0 0 0;
-  transform: rotate(-90deg) translateX(-100%);
-  -webkit-transform: rotate(-90deg) translateX(-100%);
-  -ms-transform: rotate(-90deg) translateX(-100%);
+    width: 16px;
+    height: 16px;
+    margin: -32px 0 0 0;
+    transform: rotate(-90deg) translateX(-100%);
+    -webkit-transform: rotate(-90deg) translateX(-100%);
+    -ms-transform: rotate(-90deg) translateX(-100%);
 }
 
 .main-nav-img.main-nav-sub-img {
-  width: 16px;
-  height: 16px;
-  margin: 0px 0px 0 0;
-  transform: rotate(180deg) translateX(0%);
-  -webkit-transform: rotate(180deg) translateX(0%);
-  -ms-transform: rotate(180deg) translateX(0%);
-  position: absolute;
-  right: -8px;
-  top: 16px;
+    width: 16px;
+    height: 16px;
+    margin: 0px 0px 0 0;
+    transform: rotate(180deg) translateX(0%);
+    -webkit-transform: rotate(180deg) translateX(0%);
+    -ms-transform: rotate(180deg) translateX(0%);
+    position: absolute;
+    right: -8px;
+    top: 16px;
 }
 
 ul.nav {
-  margin: 0 auto;
-  margin-top: 0px;
-  margin-left: 0px;
+    margin: 0 auto;
+    margin-top: 0px;
+    margin-left: 0px;
 }
 
 .mini ul.nav li {
-  float: right;
-  line-height: 25px;
-  height: auto;
-  margin-top: 3px;
+    float: right;
+    line-height: 25px;
+    height: auto;
+    margin-top: 3px;
 }
 
 .spancolchildstyle {
-  padding: 4px;
+    padding: 4px;
 }
 
 .contextmenubutton {
-  float: right;
-  display: none;
+    float: right;
+    display: none;
 }
 
-.highlight:hover > .contextmenubutton {
-  display: unset;
+.highlight:hover>.contextmenubutton {
+    display: unset;
 }
 
-.highlight:hover > .contextmenubutton::after {
-  content: "\2026";
-  font-size: 12px;
+.highlight:hover>.contextmenubutton::after {
+    content: "\2026";
+    font-size: 12px;
 }
 
 .showEllipsis {
-  text-overflow: ellipsis;
-  white-space: nowrap;
-  overflow: hidden;
-}
+    text-overflow: ellipsis;
+    white-space: nowrap;
+    overflow: hidden;
+}

package.json

@@ -5,29 +5,24 @@
   "main": "index.js",
   "dependencies": {
     "@azure/arm-cosmosdb": "9.1.0",
-    "@azure/cosmos": "3.10.5",
+    "@azure/cosmos": "3.9.0",
     "@azure/cosmos-language-service": "0.0.5",
-    "@azure/identity": "1.2.1",
-    "@azure/ms-rest-nodeauth": "3.0.7",
-    "@azure/msal-browser": "2.14.2",
-    "@babel/plugin-proposal-class-properties": "7.12.1",
-    "@babel/plugin-proposal-decorators": "7.12.12",
-    "@fluentui/react": "8.14.3",
-    "@jupyterlab/services": "6.0.2",
-    "@jupyterlab/terminal": "3.0.3",
-    "@microsoft/applicationinsights-web": "2.6.1",
-    "@nteract/commutable": "7.4.2",
+    "@azure/identity": "1.1.0",
+    "@jupyterlab/services": "6.0.0-rc.2",
+    "@jupyterlab/terminal": "3.0.0-rc.2",
+    "@microsoft/applicationinsights-web": "2.5.9",
+    "@nteract/commutable": "7.3.2",
     "@nteract/connected-components": "6.8.2",
     "@nteract/core": "15.1.0",
     "@nteract/data-explorer": "8.0.3",
     "@nteract/directory-listing": "2.0.6",
     "@nteract/dropdown-menu": "1.0.1",
-    "@nteract/editor": "10.1.12",
+    "@nteract/editor": "10.1.2",
     "@nteract/fixtures": "2.3.0",
     "@nteract/iron-icons": "1.0.0",
     "@nteract/jupyter-widgets": "2.0.0",
     "@nteract/logos": "1.0.0",
-    "@nteract/markdown": "4.6.0",
+    "@nteract/markdown": "4.4.0",
     "@nteract/monaco-editor": "3.2.2",
     "@nteract/octicons": "2.0.0",
     "@nteract/outputs": "3.0.9",
@@ -41,15 +36,16 @@
     "@nteract/transform-vega": "7.0.6",
     "@octokit/rest": "17.9.2",
     "@phosphor/widgets": "1.9.3",
-    "@testing-library/jest-dom": "5.11.9",
-    "@types/lodash": "4.14.171",
     "@types/mkdirp": "1.0.1",
     "@types/node-fetch": "2.5.7",
+    "@uifabric/react-cards": "0.109.110",
+    "@uifabric/styling": "7.13.7",
+    "abort-controller": "3.0.0",
     "applicationinsights": "1.8.0",
+    "babel-polyfill": "6.26.0",
     "bootstrap": "3.4.1",
-    "canvas": "file:./canvas",
+    "canvas": "2.6.1",
     "clean-webpack-plugin": "0.1.19",
-    "clipboard-copy": "4.0.1",
     "copy-webpack-plugin": "6.0.2",
     "crossroads": "0.12.2",
     "css-element-queries": "1.1.1",
@@ -58,16 +54,13 @@
     "datatables.net-dt": "1.10.19",
     "date-fns": "1.29.0",
     "dayjs": "1.8.19",
-    "dom-to-image": "2.6.0",
     "dotenv": "8.2.0",
+    "es6-object-assign": "1.1.0",
+    "es6-symbol": "3.1.3",
     "eslint-plugin-jest": "23.13.2",
     "eslint-plugin-react": "7.20.0",
     "hasher": "1.2.0",
     "html2canvas": "1.0.0-rc.5",
-    "i18next": "19.8.4",
-    "i18next-browser-languagedetector": "6.0.1",
-    "i18next-http-backend": "1.0.23",
-    "iframe-resizer-react": "1.1.0",
     "immutable": "4.0.0-rc.12",
     "is-ci": "2.0.0",
     "jquery": "3.5.1",
@@ -76,62 +69,67 @@
     "knockout": "3.5.1",
     "mkdirp": "1.0.4",
     "monaco-editor": "0.18.1",
-    "ms": "2.1.3",
+    "object.entries": "1.1.0",
+    "office-ui-fabric-react": "7.134.1",
     "p-retry": "4.2.0",
     "plotly.js-cartesian-dist-min": "1.52.3",
-    "post-robot": "10.0.42",
+    "promise-polyfill": "8.1.0",
+    "promise.prototype.finally": "3.1.0",
     "q": "1.5.1",
     "react": "16.13.1",
     "react-animate-height": "2.0.8",
     "react-dnd": "9.4.0",
     "react-dnd-html5-backend": "9.4.0",
-    "react-dom": "16.13.1",
+    "react-dom": "16.9.0",
     "react-hotkeys": "2.0.0",
-    "react-i18next": "11.8.5",
     "react-notification-system": "0.2.17",
     "react-redux": "7.1.3",
-    "react-splitter-layout": "4.0.0",
     "redux": "4.0.4",
-    "reflect-metadata": "0.1.13",
     "rx-jupyter": "5.5.12",
     "rxjs": "6.6.3",
-    "sanitize-html": "2.3.3",
     "styled-components": "4.3.2",
-    "swr": "0.4.0",
-    "terser-webpack-plugin": "3.1.0",
+    "text-encoding": "0.7.0",
     "underscore": "1.9.1",
+    "url-polyfill": "1.1.7",
     "utility-types": "3.10.0",
-    "zustand": "3.5.0"
+    "webcrypto-liner": "1.1.4",
+    "webfontloader": "1.6.28",
+    "whatwg-fetch": "3.0.0"
   },
   "devDependencies": {
     "@babel/core": "7.9.0",
     "@babel/preset-env": "7.9.0",
     "@babel/preset-react": "7.9.4",
     "@babel/preset-typescript": "7.9.0",
-    "@testing-library/react": "11.2.3",
     "@types/applicationinsights-js": "1.0.7",
     "@types/codemirror": "0.0.56",
     "@types/crossroads": "0.0.30",
     "@types/d3": "5.9.2",
-    "@types/dom-to-image": "2.6.2",
     "@types/enzyme": "3.10.7",
     "@types/enzyme-adapter-react-16": "1.0.6",
+    "@types/expect-puppeteer": "4.4.3",
     "@types/hasher": "0.0.31",
-    "@types/jest": "26.0.20",
+    "@types/jest": "23.3.10",
+    "@types/jest-environment-puppeteer": "4.3.2",
+    "@types/memoize-one": "4.1.1",
     "@types/node": "12.11.1",
-    "@types/post-robot": "10.0.1",
+    "@types/promise.prototype.finally": "2.0.3",
+    "@types/prop-types": "15.5.8",
+    "@types/puppeteer": "3.0.1",
     "@types/q": "1.5.1",
-    "@types/react": "17.0.3",
-    "@types/react-dom": "17.0.3",
+    "@types/react": "16.9.56",
+    "@types/react-dom": "16.0.7",
     "@types/react-notification-system": "0.2.39",
     "@types/react-redux": "7.1.7",
-    "@types/react-splitter-layout": "3.0.1",
-    "@types/sanitize-html": "1.27.2",
     "@types/sinon": "2.3.3",
     "@types/styled-components": "5.1.1",
+    "@types/text-encoding": "0.0.33",
     "@types/underscore": "1.7.36",
-    "@typescript-eslint/eslint-plugin": "4.22.0",
-    "@typescript-eslint/parser": "4.22.0",
+    "@types/webfontloader": "1.6.29",
+    "@typescript-eslint/eslint-plugin": "4.0.1",
+    "@typescript-eslint/parser": "4.0.1",
+    "adal-angular": "1.0.15",
+    "axe-puppeteer": "1.1.0",
     "babel-jest": "24.9.0",
     "babel-loader": "8.1.0",
     "buffer": "5.1.0",
@@ -141,22 +139,21 @@
     "enzyme": "3.11.0",
     "enzyme-adapter-react-16": "1.15.5",
     "enzyme-to-json": "3.6.1",
+    "esbuild-loader": "2.7.0",
     "eslint": "7.8.1",
     "eslint-cli": "1.1.1",
     "eslint-plugin-no-null": "1.0.2",
     "eslint-plugin-prefer-arrow": "1.2.2",
-    "eslint-plugin-react-hooks": "4.2.0",
-    "expect-playwright": "0.3.3",
-    "fast-glob": "3.2.5",
+    "expose-loader": "0.7.5",
     "file-loader": "2.0.0",
     "fs-extra": "7.0.0",
-    "html-inline-css-webpack-plugin": "1.11.0",
     "html-loader": "0.5.5",
     "html-loader-jest": "0.2.1",
-    "html-webpack-plugin": "4.5.2",
+    "html-webpack-plugin": "3.2.0",
+    "inline-css": "2.2.5",
     "jest": "25.5.4",
     "jest-canvas-mock": "2.1.0",
-    "jest-playwright-preset": "1.5.1",
+    "jest-puppeteer": "4.4.0",
     "jest-trx-results-processor": "0.0.7",
     "less": "3.8.1",
     "less-loader": "4.1.0",
@@ -164,24 +161,24 @@
     "mini-css-extract-plugin": "0.4.3",
     "monaco-editor-webpack-plugin": "1.7.0",
     "node-fetch": "2.6.1",
-    "playwright": "1.13.0",
-    "prettier": "2.2.1",
+    "prettier": "1.19.1",
+    "puppeteer": "4.0.0",
     "raw-loader": "0.5.1",
-    "react-dev-utils": "11.0.4",
     "rimraf": "3.0.0",
     "sinon": "3.2.1",
     "style-loader": "0.23.0",
+    "terser-webpack-plugin": "3.0.5",
     "ts-loader": "6.2.2",
     "tslint": "5.11.0",
     "tslint-microsoft-contrib": "6.0.0",
-    "typedoc": "0.20.36",
-    "typescript": "4.3.4",
+    "typescript": "4.0.2",
     "url-loader": "1.1.1",
     "wait-on": "4.0.2",
-    "webpack": "4.46.0",
+    "webpack": "4.43.0",
     "webpack-bundle-analyzer": "3.6.1",
     "webpack-cli": "3.3.10",
-    "webpack-dev-server": "3.11.0"
+    "webpack-dev-server": "3.11.0",
+    "worker-loader": "2.0.0"
   },
   "scripts": {
     "start": "node --max-old-space-size=10196 node_modules/webpack-dev-server/bin/webpack-dev-server.js",
@@ -193,11 +190,10 @@
     "pack:fast": "node --max_old_space_size=10196 ./node_modules/webpack/bin/webpack.js  --mode development --progress",
     "copyToConsumers": "node copyToConsumers",
     "test": "rimraf coverage && jest",
-    "test:e2e": "jest -c ./jest.config.playwright.js --detectOpenHandles",
+    "test:e2e": "jest -c ./jest.config.e2e.js --detectOpenHandles",
     "watch": "npm run start",
     "wait-for-server": "wait-on -t 240000 -i 5000 -v https-get://0.0.0.0:1234/",
     "build:ase": "gulp build:ase",
-    "selfServeDocs": "typedoc",
     "compile": "tsc",
     "compile:contracts": "tsc -p ./tsconfig.contracts.json",
     "compile:strict": "tsc -p ./tsconfig.strict.json",
@@ -205,10 +201,10 @@
     "format:check": "prettier --check \"{src,test}/**/*.{ts,tsx,html}\" \"*.{js,html}\"",
     "lint": "tslint --project tsconfig.json && eslint \"**/*.{ts,tsx}\"",
     "build:contracts": "npm run compile:contracts",
-    "strict:find": "node ./strict-null-checks/find.js",
-    "strict:add": "node ./strict-null-checks/auto-add.js",
+    "strictEligibleFiles": "node ./strict-migration-tools/index.js",
+    "autoAddStrictEligibleFiles": "node ./strict-migration-tools/autoAdd.js",
     "compile:fullStrict": "tsc -p ./tsconfig.json --strictNullChecks",
-    "generateARMClients": "npx ts-node --compiler-options '{\"module\":\"commonjs\"}' utils/armClientGenerator/generator.ts"
+    "generateARMClients": "ts-node --compiler-options '{\"module\":\"commonjs\"}' utils/armClientGenerator/generator.ts"
   },
   "repository": {
     "type": "git",

preview/.azure/config

@@ -1,7 +0,0 @@
-[defaults]
-group = stfaul
-sku = P1v2
-appserviceplan = stfaul_asp_Linux_centralus_0
-location = centralus
-web = cosmos-explorer-preview
-

preview/README.md

@@ -1,20 +0,0 @@
-# Cosmos Explorer Preview
-
-Cosmos Explorer Preview makes it possible to try a working version of any commit on master or in a PR. No need to run the app locally or deploy to staging.
-
-Initial support is for Hosted (Connection string only) or the Azure Portal. Examples:
-
-Connection string URLs: https://cosmos-explorer-preview.azurewebsites.net/commit/COMMIT_SHA/hostedExplorer.html
-Portal URLs: https://ms.portal.azure.com/?dataExplorerSource=https://cosmos-explorer-preview.azurewebsites.net/commit/COMMIT_SHA/explorer.html#home
-
-In both cases replace `COMMIT_SHA` with the commit you want to view. It must have already completed its build on GitHub Actions.
-
-### Architechture
-
-- This folder contains a NodeJS app deployed to Azure App Service that powers preview URLs:
-  - Paths starting with `/commit/` are proxied to an Azure Storage account containing build artifacts
-  - Paths starting with `/proxy/` are proxied dynamically to Cosmos account endpoints. Required otherwise CORS would need to be configured for every account accessed.
-  - Paths starting with `/api/` are proxied to Portal APIs that do not support CORS.
-- On GitHub Actions build completion:
-  - All files in dist are uploaded to an Azure Storage account namespaced by the SHA of the commit
-  - `/preview/config.json` is uploaded to the same folder with preview specific configuration

preview/config.json

@@ -1,4 +0,0 @@
-{
-  "PROXY_PATH": "/proxy",
-  "msalRedirectURI": "https://cosmos-explorer-preview.azurewebsites.net/"
-}

preview/index.js

@@ -1,79 +0,0 @@
-const express = require("express");
-const { createProxyMiddleware } = require("http-proxy-middleware");
-const port = process.env.PORT || 3000;
-const fetch = require("node-fetch");
-
-const api = createProxyMiddleware("/api", {
-  target: "https://main.documentdb.ext.azure.com",
-  changeOrigin: true,
-  logLevel: "debug",
-  bypass: (req, res) => {
-    if (req.method === "OPTIONS") {
-      res.statusCode = 200;
-      res.send();
-    }
-  },
-});
-
-const proxy = createProxyMiddleware("/proxy", {
-  target: "https://main.documentdb.ext.azure.com",
-  changeOrigin: true,
-  secure: false,
-  logLevel: "debug",
-  pathRewrite: { "^/proxy": "" },
-  router: (req) => {
-    let newTarget = req.headers["x-ms-proxy-target"];
-    return newTarget;
-  },
-});
-
-const commit = createProxyMiddleware("/commit", {
-  target: "https://cosmosexplorerpreview.blob.core.windows.net",
-  changeOrigin: true,
-  secure: false,
-  logLevel: "debug",
-  pathRewrite: { "^/commit": "$web/" },
-});
-
-const app = express();
-
-app.use(api);
-app.use(proxy);
-app.use(commit);
-app.get("/pull/:pr(\\d+)", (req, res) => {
-  const pr = req.params.pr;
-  const [, query] = req.originalUrl.split("?");
-  const search = new URLSearchParams(query);
-
-  fetch("https://api.github.com/repos/Azure/cosmos-explorer/pulls/" + pr)
-    .then((response) => response.json())
-    .then(({ head: { ref, sha } }) => {
-      const prUrl = new URL("https://github.com/Azure/cosmos-explorer/pull/" + pr);
-      prUrl.hash = ref;
-      search.set("feature.pr", prUrl.href);
-
-      const explorer = new URL("https://cosmos-explorer-preview.azurewebsites.net/commit/" + sha + "/explorer.html");
-      explorer.search = search.toString();
-
-      const portal = new URL("https://ms.portal.azure.com/");
-      portal.searchParams.set("dataExplorerSource", explorer.href);
-
-      return res.redirect(portal.href);
-    })
-    .catch(() => res.sendStatus(500));
-});
-app.get("/", (req, res) => {
-  fetch("https://api.github.com/repos/Azure/cosmos-explorer/branches/master")
-    .then((response) => response.json())
-    .then(({ commit: { sha } }) => {
-      const explorer = new URL(
-        "https://cosmos-explorer-preview.azurewebsites.net/commit/" + sha + "/hostedExplorer.html"
-      );
-      return res.redirect(explorer.href);
-    })
-    .catch(() => res.sendStatus(500));
-});
-
-app.listen(port, () => {
-  console.log(`Example app listening on port: ${port}`);
-});

preview/package.json

@@ -1,18 +0,0 @@
-{
-  "name": "cosmos-explorer-preview",
-  "version": "1.0.0",
-  "description": "",
-  "main": "index.js",
-  "scripts": {
-    "deploy": "az webapp up -n cosmos-explorer-preview --subscription cosmosdb-portalteam-generaldemo -g stfaul",
-    "start": "node index.js",
-    "test": "echo \"Error: no test specified\" && exit 1"
-  },
-  "keywords": [],
-  "author": "Microsoft Corporation",
-  "dependencies": {
-    "express": "^4.17.1",
-    "http-proxy-middleware": "^1.1.0",
-    "node-fetch": "^2.6.1"
-  }
-}

sampleData/gremlinSampleData.json

@@ -3,7 +3,6 @@
   "offerThroughput": 400,
   "databaseLevelThroughput": false,
   "collectionId": "Persons",
-  "createNewDatabase": true,
   "partitionKey": { "kind": "Hash", "paths": ["/name"] },
   "data": [
     "g.addV('person').property(id, '1').property('name', 'Eva').property('age', 44)",

src/AuthType.ts

@@ -1,7 +1,6 @@
-export enum AuthType {
-  AAD = "aad",
-  EncryptedToken = "encryptedtoken",
-  MasterKey = "masterkey",
-  ResourceToken = "resourcetoken",
-  ConnectionString = "connectionstring",
-}
+export enum AuthType {
+  AAD = "aad",
+  EncryptedToken = "encryptedtoken",
+  MasterKey = "masterkey",
+  ResourceToken = "resourcetoken"
+}

src/Bindings/BindingHandlersRegisterer.ts

@@ -1,22 +1,21 @@
-import * as ko from "knockout";
-import * as ReactBindingHandler from "./ReactBindingHandler";
-import "../Explorer/Tables/DataTable/DataTableBindingManager";
-
-export class BindingHandlersRegisterer {
-  public static registerBindingHandlers() {
-    ko.bindingHandlers.setTemplateReady = {
-      init(
-        element: any,
-        wrappedValueAccessor: () => any,
-        allBindings?: ko.AllBindings,
-        viewModel?: any,
-        bindingContext?: ko.BindingContext
-      ) {
-        const value = ko.unwrap(wrappedValueAccessor());
-        bindingContext?.$data.isTemplateReady(value);
-      },
-    } as ko.BindingHandler;
-
-    ReactBindingHandler.Registerer.register();
-  }
-}
+import * as ko from "knockout";
+import * as ReactBindingHandler from "./ReactBindingHandler";
+
+export class BindingHandlersRegisterer {
+  public static registerBindingHandlers() {
+    ko.bindingHandlers.setTemplateReady = {
+      init(
+        element: any,
+        wrappedValueAccessor: () => any,
+        allBindings?: ko.AllBindings,
+        viewModel?: any,
+        bindingContext?: ko.BindingContext
+      ) {
+        const value = ko.unwrap(wrappedValueAccessor());
+        bindingContext?.$data.isTemplateReady(value);
+      }
+    } as ko.BindingHandler;
+
+    ReactBindingHandler.Registerer.register();
+  }
+}

src/Bindings/ReactBindingHandler.ts

@@ -22,7 +22,13 @@ export interface ReactAdapter {
 export class Registerer {
   public static register(): void {
     ko.bindingHandlers.react = {
-      init: (element: any, wrappedValueAccessor: () => any) => {
+      init: (
+        element: any,
+        wrappedValueAccessor: () => any,
+        allBindings?: ko.AllBindings,
+        viewModel?: any,
+        bindingContext?: ko.BindingContext
+      ) => {
         const adapter: ReactAdapter = wrappedValueAccessor();
 
         if (adapter.setElement) {
@@ -36,7 +42,7 @@ export class Registerer {
 
         // Initial rendering at mount point
         ReactDOM.render(adapter.renderComponent(), element);
-      },
+      }
     } as ko.BindingHandler;
   }
 }

src/CellOutputViewer/CellOutputViewer.less

@@ -1,15 +0,0 @@
-.schema-analyzer-cell-outputs {
-  padding: 10px 2px;
-}
-
-// Mimic FluentUI8's DocumentCard style
-.schema-analyzer-cell-output {
-  margin-bottom: 20px;
-  padding: 14px 20px;
-  border: 1px solid rgb(237, 235, 233);
-}
-
-.schema-analyzer-cell-output:hover {
-  border-color: rgb(200, 198, 196);
-  box-shadow: inset 0 0 0 1px rgb(200, 198, 196)
-}

src/CellOutputViewer/CellOutputViewer.tsx

@@ -1,104 +0,0 @@
-import { createImmutableOutput, JSONObject, OnDiskOutput } from "@nteract/commutable";
-// import outputs individually to avoid increasing the bundle size
-import { KernelOutputError } from "@nteract/outputs/lib/components/kernel-output-error";
-import { Output } from "@nteract/outputs/lib/components/output";
-import { StreamText } from "@nteract/outputs/lib/components/stream-text";
-import { ContentRef } from "@nteract/types";
-import "bootstrap/dist/css/bootstrap.css";
-import postRobot from "post-robot";
-import * as React from "react";
-import * as ReactDOM from "react-dom";
-import "../../externals/iframeResizer.contentWindow.min.js"; // Required for iFrameResizer to work
-import { SnapshotRequest } from "../Explorer/Notebook/NotebookComponent/types";
-import "../Explorer/Notebook/NotebookRenderer/base.css";
-import "../Explorer/Notebook/NotebookRenderer/default.css";
-import { NotebookUtil } from "../Explorer/Notebook/NotebookUtil";
-import "./CellOutputViewer.less";
-import { TransformMedia } from "./TransformMedia";
-
-export interface SnapshotResponse {
-  imageSrc: string;
-  requestId: string;
-}
-export interface CellOutputViewerProps {
-  id: string;
-  contentRef: ContentRef;
-  outputsContainerClassName: string;
-  outputClassName: string;
-  outputs: OnDiskOutput[];
-  onMetadataChange: (metadata: JSONObject, mediaType: string, index?: number) => void;
-}
-
-const onInit = async () => {
-  postRobot.on(
-    "props",
-    {
-      window: window.parent,
-      domain: window.location.origin,
-    },
-    (event) => {
-      // Typescript definition for event is wrong. So read props by casting to <any>
-      // eslint-disable-next-line @typescript-eslint/no-explicit-any
-      const props = (event as any).data as CellOutputViewerProps;
-      const outputs = (
-        <div data-iframe-height className={props.outputsContainerClassName}>
-          {props.outputs?.map((output, index) => (
-            <div className={props.outputClassName} key={index}>
-              <Output output={createImmutableOutput(output)} key={index}>
-                <TransformMedia
-                  output_type={"display_data"}
-                  id={props.id}
-                  contentRef={props.contentRef}
-                  onMetadataChange={(metadata, mediaType) => props.onMetadataChange(metadata, mediaType, index)}
-                />
-                <TransformMedia
-                  output_type={"execute_result"}
-                  id={props.id}
-                  contentRef={props.contentRef}
-                  onMetadataChange={(metadata, mediaType) => props.onMetadataChange(metadata, mediaType, index)}
-                />
-                <KernelOutputError />
-                <StreamText />
-              </Output>
-            </div>
-          ))}
-        </div>
-      );
-
-      ReactDOM.render(outputs, document.getElementById("cellOutput"));
-    }
-  );
-
-  postRobot.on(
-    "snapshotRequest",
-    {
-      window: window.parent,
-      domain: window.location.origin,
-    },
-    async (event): Promise<SnapshotResponse> => {
-      const topNode = document.getElementById("cellOutput");
-      if (!topNode) {
-        const errorMsg = "No top node to snapshot";
-        return Promise.reject(new Error(errorMsg));
-      }
-
-      // Typescript definition for event is wrong. So read props by casting to <any>
-      // eslint-disable-next-line @typescript-eslint/no-explicit-any
-      const snapshotRequest = (event as any).data as SnapshotRequest;
-      const result = await NotebookUtil.takeScreenshotDomToImage(
-        topNode,
-        snapshotRequest.aspectRatio,
-        undefined,
-        snapshotRequest.downloadFilename
-      );
-
-      return {
-        imageSrc: result.imageSrc,
-        requestId: snapshotRequest.requestId,
-      };
-    }
-  );
-};
-
-// Entry point
-window.addEventListener("load", onInit);

src/CellOutputViewer/TransformMedia.tsx

@@ -1,138 +0,0 @@
-import { ImmutableDisplayData, ImmutableExecuteResult, JSONObject } from "@nteract/commutable";
-// import outputs individually to avoid increasing the bundle size
-import { HTML } from "@nteract/outputs/lib/components/media/html";
-import { Image } from "@nteract/outputs/lib/components/media/image";
-import { JavaScript } from "@nteract/outputs/lib/components/media/javascript";
-import { Json } from "@nteract/outputs/lib/components/media/json";
-import { LaTeX } from "@nteract/outputs/lib/components/media/latex";
-import { Plain } from "@nteract/outputs/lib/components/media/plain";
-import { SVG } from "@nteract/outputs/lib/components/media/svg";
-import { ContentRef } from "@nteract/types";
-import React, { Suspense } from "react";
-
-const EmptyTransform = (): JSX.Element => <></>;
-
-const displayOrder = [
-  "application/vnd.jupyter.widget-view+json",
-  "application/vnd.vega.v5+json",
-  "application/vnd.vega.v4+json",
-  "application/vnd.vega.v3+json",
-  "application/vnd.vega.v2+json",
-  "application/vnd.vegalite.v4+json",
-  "application/vnd.vegalite.v3+json",
-  "application/vnd.vegalite.v2+json",
-  "application/vnd.vegalite.v1+json",
-  "application/geo+json",
-  "application/vnd.plotly.v1+json",
-  "text/vnd.plotly.v1+html",
-  "application/x-nteract-model-debug+json",
-  "application/vnd.dataresource+json",
-  "application/vdom.v1+json",
-  "application/json",
-  "application/javascript",
-  "text/html",
-  "text/markdown",
-  "text/latex",
-  "image/svg+xml",
-  "image/gif",
-  "image/png",
-  "image/jpeg",
-  "text/plain",
-];
-
-// eslint-disable-next-line @typescript-eslint/no-explicit-any
-const transformsById = new Map<string, React.ComponentType<any>>([
-  ["text/vnd.plotly.v1+html", React.lazy(() => import("@nteract/transform-plotly"))],
-  ["application/vnd.plotly.v1+json", React.lazy(() => import("@nteract/transform-plotly"))],
-  ["application/geo+json", EmptyTransform], // TODO: The geojson transform will likely need some work because of the basemap URL(s)
-  ["application/x-nteract-model-debug+json", React.lazy(() => import("@nteract/transform-model-debug"))],
-  ["application/vnd.dataresource+json", React.lazy(() => import("@nteract/data-explorer"))],
-  ["application/vnd.jupyter.widget-view+json", React.lazy(() => import("./transforms/WidgetDisplay"))],
-  ["application/vnd.vegalite.v1+json", React.lazy(() => import("./transforms/VegaLite1"))],
-  ["application/vnd.vegalite.v2+json", React.lazy(() => import("./transforms/VegaLite2"))],
-  ["application/vnd.vegalite.v3+json", React.lazy(() => import("./transforms/VegaLite3"))],
-  ["application/vnd.vegalite.v4+json", React.lazy(() => import("./transforms/VegaLite4"))],
-  ["application/vnd.vega.v2+json", React.lazy(() => import("./transforms/Vega2"))],
-  ["application/vnd.vega.v3+json", React.lazy(() => import("./transforms/Vega3"))],
-  ["application/vnd.vega.v4+json", React.lazy(() => import("./transforms/Vega4"))],
-  ["application/vnd.vega.v5+json", React.lazy(() => import("./transforms/Vega5"))],
-  ["application/vdom.v1+json", React.lazy(() => import("@nteract/transform-vdom"))],
-  ["application/json", Json],
-  ["application/javascript", JavaScript],
-  ["text/html", HTML],
-  ["text/markdown", React.lazy(() => import("@nteract/outputs/lib/components/media/markdown"))], // Markdown increases the bundle size so lazy load it
-  ["text/latex", LaTeX],
-  ["image/svg+xml", SVG],
-  ["image/gif", Image],
-  ["image/png", Image],
-  ["image/jpeg", Image],
-  ["text/plain", Plain],
-]);
-
-interface TransformMediaProps {
-  output_type: string;
-  id: string;
-  contentRef: ContentRef;
-  output?: ImmutableDisplayData | ImmutableExecuteResult;
-  onMetadataChange: (metadata: JSONObject, mediaType: string) => void;
-}
-
-export const TransformMedia = (props: TransformMediaProps): JSX.Element => {
-  const { Media, mediaType, data, metadata } = getMediaInfo(props);
-
-  // If we had no valid result, return an empty output
-  if (!mediaType || !data) {
-    return <></>;
-  }
-
-  return (
-    <Suspense fallback={<div>Loading...</div>}>
-      <Media
-        onMetadataChange={props.onMetadataChange}
-        data={data}
-        metadata={metadata}
-        contentRef={props.contentRef}
-        id={props.id}
-      />
-    </Suspense>
-  );
-};
-
-const getMediaInfo = (props: TransformMediaProps) => {
-  const { output, output_type } = props;
-  // This component should only be used with display data and execute result
-  if (!output || !(output_type === "display_data" || output_type === "execute_result")) {
-    console.warn("connected transform media managed to get a non media bundle output");
-    return {
-      Media: EmptyTransform,
-    };
-  }
-
-  // Find the first mediaType in the output data that we support with a handler
-  const mediaType = displayOrder.find(
-    (key) =>
-      Object.prototype.hasOwnProperty.call(output.data, key) &&
-      (Object.prototype.hasOwnProperty.call(transformsById, key) || transformsById.get(key))
-  );
-
-  if (mediaType) {
-    const metadata = output.metadata.get(mediaType);
-    const data = output.data[mediaType];
-
-    const Media = transformsById.get(mediaType);
-    return {
-      Media,
-      mediaType,
-      data,
-      metadata,
-    };
-  }
-
-  return {
-    Media: EmptyTransform,
-    mediaType,
-    output,
-  };
-};
-
-export default TransformMedia;

src/CellOutputViewer/cellOutputViewer.html

@@ -1,12 +0,0 @@
-<!DOCTYPE html>
-<html lang="en">
-  <head>
-    <meta charset="UTF-8" />
-    <meta name="viewport" content="height=device-height, width=device-width, initial-scale=1.0" />
-    <title>Cell Output Viewer</title>
-  </head>
-
-  <body>
-    <div class="cellOutput" id="cellOutput"></div>
-  </body>
-</html>

src/CellOutputViewer/transforms/Vega2.ts

@@ -1 +0,0 @@
-export { Vega2 as default } from "@nteract/transform-vega";

src/CellOutputViewer/transforms/Vega3.ts

@@ -1 +0,0 @@
-export { Vega3 as default } from "@nteract/transform-vega";

src/CellOutputViewer/transforms/Vega4.ts

@@ -1 +0,0 @@
-export { Vega4 as default } from "@nteract/transform-vega";

src/CellOutputViewer/transforms/Vega5.ts

@@ -1 +0,0 @@
-export { Vega5 as default } from "@nteract/transform-vega";

src/CellOutputViewer/transforms/VegaLite1.ts

@@ -1 +0,0 @@
-export { VegaLite1 as default } from "@nteract/transform-vega";

src/CellOutputViewer/transforms/VegaLite2.ts

@@ -1 +0,0 @@
-export { VegaLite2 as default } from "@nteract/transform-vega";

src/CellOutputViewer/transforms/VegaLite3.ts

@@ -1 +0,0 @@
-export { VegaLite3 as default } from "@nteract/transform-vega";

src/CellOutputViewer/transforms/VegaLite4.ts

@@ -1 +0,0 @@
-export { VegaLite4 as default } from "@nteract/transform-vega";

src/CellOutputViewer/transforms/WidgetDisplay.ts

@@ -1 +0,0 @@
-export { WidgetDisplay as default } from "@nteract/jupyter-widgets";

src/Common/ArrayHashMap.ts

@@ -1,9 +1,49 @@
+import { HashMap } from "./HashMap";
+
 /**
  * Hash map of arrays which allows to:
  * - push an item by key: add to array and create array if needed
  * - remove item by key: remove from array and delete array if needed
  */
-export class ArrayHashMap<T> extends Map<string, T[]> {
+
+export class ArrayHashMap<T> {
+  private store: HashMap<T[]>;
+
+  constructor() {
+    this.store = new HashMap();
+  }
+
+  public has(key: string): boolean {
+    return this.store.has(key);
+  }
+
+  public get(key: string): T[] {
+    return this.store.get(key);
+  }
+
+  public size(): number {
+    return this.store.size();
+  }
+
+  public clear(): void {
+    this.store.clear();
+  }
+
+  public keys(): string[] {
+    return this.store.keys();
+  }
+
+  public delete(key: string): boolean {
+    return this.store.delete(key);
+  }
+
+  public forEach(key: string, iteratorFct: (value: T) => void) {
+    const values = this.store.get(key);
+    if (values) {
+      values.forEach(value => iteratorFct(value));
+    }
+  }
+
   /**
    * Insert item into array.
    * If no array, create one.
@@ -12,8 +52,16 @@ export class ArrayHashMap<T> extends Map<string, T[]> {
    * @param item
    */
   public push(key: string, item: T): void {
-    const array = this.get(key);
-    array ? array.includes(item) || array.push(item) : this.set(key, [item]);
+    let itemsArray: T[] = this.store.get(key);
+    if (!itemsArray) {
+      itemsArray = [item];
+      this.store.set(key, itemsArray);
+      return;
+    }
+
+    if (itemsArray.indexOf(item) === -1) {
+      itemsArray.push(item);
+    }
   }
 
   /**
@@ -22,11 +70,18 @@ export class ArrayHashMap<T> extends Map<string, T[]> {
    * @param key
    * @param itemToRemove
    */
-  public remove(key: string, itemToRemove: T): void {
-    const array = this.get(key);
-    if (array) {
-      const remaining = array.filter((item) => item !== itemToRemove);
-      remaining.length ? this.set(key, remaining) : this.delete(key);
+  public remove(key: string, itemToRemove: T) {
+    if (!this.store.has(key)) {
+      return;
+    }
+
+    const itemsArray = this.store.get(key);
+    const index = itemsArray.indexOf(itemToRemove);
+    if (index >= 0) {
+      itemsArray.splice(index, 1);
+      if (itemsArray.length === 0) {
+        this.store.delete(key);
+      }
     }
   }
 }

src/Common/CollapsedResourceTree.tsx

@@ -1,36 +0,0 @@
-import React, { FunctionComponent } from "react";
-import arrowLeftImg from "../../images/imgarrowlefticon.svg";
-import { userContext } from "../UserContext";
-
-export interface CollapsedResourceTreeProps {
-  toggleLeftPaneExpanded: () => void;
-  isLeftPaneExpanded: boolean;
-}
-
-export const CollapsedResourceTree: FunctionComponent<CollapsedResourceTreeProps> = ({
-  toggleLeftPaneExpanded,
-  isLeftPaneExpanded,
-}: CollapsedResourceTreeProps): JSX.Element => {
-  return (
-    <div id="mini" className={!isLeftPaneExpanded ? "mini toggle-mini" : "hiddenMain"}>
-      <div className="main-nav nav">
-        <ul className="nav">
-          <li
-            className="resourceTreeCollapse"
-            id="collapseToggleLeftPaneButton"
-            role="button"
-            tabIndex={0}
-            aria-label="Expand Tree"
-          >
-            <span className="leftarrowCollapsed" onClick={toggleLeftPaneExpanded}>
-              <img className="arrowCollapsed" src={arrowLeftImg} alt="Expand" />
-            </span>
-            <span className="collectionCollapsed" onClick={toggleLeftPaneExpanded}>
-              <span>{userContext.apiType} API</span>
-            </span>
-          </li>
-        </ul>
-      </div>
-    </div>
-  );
-};

src/Common/Constants.ts

@@ -1,371 +1,434 @@
-export class CodeOfConductEndpoints {
-  public static privacyStatement: string = "https://aka.ms/ms-privacy-policy";
-  public static codeOfConduct: string = "https://aka.ms/cosmos-code-of-conduct";
-  public static termsOfUse: string = "https://aka.ms/ms-terms-of-use";
-}
-
-export class EndpointsRegex {
-  public static readonly cassandra = [
-    "AccountEndpoint=(.*).cassandra.cosmosdb.azure.com",
-    "HostName=(.*).cassandra.cosmos.azure.com",
-  ];
-  public static readonly mongo = "mongodb://.*:(.*)@(.*).documents.azure.com";
-  public static readonly mongoCompute = "mongodb://.*:(.*)@(.*).mongo.cosmos.azure.com";
-  public static readonly sql = "AccountEndpoint=https://(.*).documents.azure.com";
-  public static readonly table = "TableEndpoint=https://(.*).table.cosmosdb.azure.com";
-}
-
-export class ApiEndpoints {
-  public static runtimeProxy: string = "/api/RuntimeProxy";
-  public static guestRuntimeProxy: string = "/api/guest/RuntimeProxy";
-}
-
-export class ServerIds {
-  public static localhost: string = "localhost";
-  public static blackforest: string = "blackforest";
-  public static fairfax: string = "fairfax";
-  public static mooncake: string = "mooncake";
-  public static productionPortal: string = "prod";
-  public static dev: string = "dev";
-}
-
-export class ArmApiVersions {
-  public static readonly documentDB: string = "2015-11-06";
-  public static readonly arcadia: string = "2019-06-01-preview";
-  public static readonly arcadiaLivy: string = "2019-11-01-preview";
-  public static readonly arm: string = "2015-11-01";
-  public static readonly armFeatures: string = "2014-08-01-preview";
-  public static readonly publicVersion = "2020-04-01";
-}
-
-export class ArmResourceTypes {
-  public static readonly notebookWorkspaces = "Microsoft.DocumentDB/databaseAccounts/notebookWorkspaces";
-  public static readonly synapseWorkspaces = "Microsoft.Synapse/workspaces";
-}
-
-export class BackendDefaults {
-  public static partitionKeyKind = "Hash";
-  public static singlePartitionStorageInGb: string = "10";
-  public static multiPartitionStorageInGb: string = "100";
-  public static maxChangeFeedRetentionDuration: number = 10;
-  public static partitionKeyVersion = 2;
-}
-
-export class ClientDefaults {
-  public static requestTimeoutMs: number = 60000;
-  public static portalCacheTimeoutMs: number = 10000;
-  public static errorNotificationTimeoutMs: number = 5000;
-  public static copyHelperTimeoutMs: number = 2000;
-  public static waitForDOMElementMs: number = 500;
-  public static cacheBustingTimeoutMs: number =
-    10 /** minutes **/ * 60 /** to seconds **/ * 1000 /** to milliseconds **/;
-  public static databaseThroughputIncreaseFactor: number = 100;
-  public static readonly arcadiaTokenRefreshInterval: number =
-    20 /** minutes **/ * 60 /** to seconds **/ * 1000 /** to milliseconds **/;
-  public static readonly arcadiaTokenRefreshIntervalPaddingMs: number = 2000;
-}
-
-export enum AccountKind {
-  DocumentDB = "DocumentDB",
-  MongoDB = "MongoDB",
-  Parse = "Parse",
-  GlobalDocumentDB = "GlobalDocumentDB",
-  Default = "DocumentDB",
-}
-
-export class CorrelationBackend {
-  public static Url: string = "https://aka.ms/cosmosdbanalytics";
-}
-
-export class CapabilityNames {
-  public static EnableTable: string = "EnableTable";
-  public static EnableGremlin: string = "EnableGremlin";
-  public static EnableCassandra: string = "EnableCassandra";
-  public static EnableAutoScale: string = "EnableAutoScale";
-  public static readonly EnableNotebooks: string = "EnableNotebooks";
-  public static readonly EnableStorageAnalytics: string = "EnableStorageAnalytics";
-  public static readonly EnableMongo: string = "EnableMongo";
-  public static readonly EnableServerless: string = "EnableServerless";
-}
-
-// flight names returned from the portal are always lowercase
-export class Flights {
-  public static readonly SettingsV2 = "settingsv2";
-  public static readonly MongoIndexEditor = "mongoindexeditor";
-  public static readonly MongoIndexing = "mongoindexing";
-  public static readonly AutoscaleTest = "autoscaletest";
-  public static readonly PartitionKeyTest = "partitionkeytest";
-}
-
-export class AfecFeatures {
-  public static readonly Spark = "spark-public-preview";
-  public static readonly Notebooks = "sparknotebooks-public-preview";
-  public static readonly StorageAnalytics = "storageanalytics-public-preview";
-}
-
-export class TagNames {
-  public static defaultExperience: string = "defaultExperience";
-}
-
-export class MongoDBAccounts {
-  public static protocol: string = "https";
-  public static defaultPort: string = "10255";
-}
-
-export enum MongoBackendEndpointType {
-  local,
-  remote,
-}
-
-// TODO: 435619 Add default endpoints per cloud and use regional only when available
-export class CassandraBackend {
-  public static readonly createOrDeleteApi: string = "api/cassandra/createordelete";
-  public static readonly guestCreateOrDeleteApi: string = "api/guest/cassandra/createordelete";
-  public static readonly queryApi: string = "api/cassandra";
-  public static readonly guestQueryApi: string = "api/guest/cassandra";
-  public static readonly keysApi: string = "api/cassandra/keys";
-  public static readonly guestKeysApi: string = "api/guest/cassandra/keys";
-  public static readonly schemaApi: string = "api/cassandra/schema";
-  public static readonly guestSchemaApi: string = "api/guest/cassandra/schema";
-}
-
-export class Queries {
-  public static CustomPageOption: string = "custom";
-  public static UnlimitedPageOption: string = "unlimited";
-  public static itemsPerPage: number = 100;
-  public static unlimitedItemsPerPage: number = 100; // TODO: Figure out appropriate value so it works for accounts with a large number of partitions
-
-  public static QueryEditorMinHeightRatio: number = 0.1;
-  public static QueryEditorMaxHeightRatio: number = 0.4;
-  public static readonly DefaultMaxDegreeOfParallelism = 6;
-}
-
-export class SavedQueries {
-  public static readonly CollectionName: string = "___Query";
-  public static readonly DatabaseName: string = "___Cosmos";
-  public static readonly OfferThroughput: number = 400;
-  public static readonly PartitionKeyProperty: string = "id";
-}
-
-export class DocumentsGridMetrics {
-  public static DocumentsPerPage: number = 100;
-  public static IndividualRowHeight: number = 34;
-  public static BufferHeight: number = 28;
-  public static SplitterMinWidth: number = 200;
-  public static SplitterMaxWidth: number = 360;
-
-  public static DocumentEditorMinWidthRatio: number = 0.2;
-  public static DocumentEditorMaxWidthRatio: number = 0.4;
-}
-
-export class Areas {
-  public static ResourceTree: string = "Resource Tree";
-  public static ContextualPane: string = "Contextual Pane";
-  public static Tab: string = "Tab";
-  public static ShareDialog: string = "Share Access Dialog";
-  public static Notebook: string = "Notebook";
-}
-
-export class HttpHeaders {
-  public static activityId: string = "x-ms-activity-id";
-  public static apiType: string = "x-ms-cosmos-apitype";
-  public static authorization: string = "authorization";
-  public static collectionIndexTransformationProgress: string =
-    "x-ms-documentdb-collection-index-transformation-progress";
-  public static continuation: string = "x-ms-continuation";
-  public static correlationRequestId: string = "x-ms-correlation-request-id";
-  public static enableScriptLogging: string = "x-ms-documentdb-script-enable-logging";
-  public static guestAccessToken: string = "x-ms-encrypted-auth-token";
-  public static getReadOnlyKey: string = "x-ms-get-read-only-key";
-  public static connectionString: string = "x-ms-connection-string";
-  public static msDate: string = "x-ms-date";
-  public static location: string = "Location";
-  public static contentType: string = "Content-Type";
-  public static offerReplacePending: string = "x-ms-offer-replace-pending";
-  public static user: string = "x-ms-user";
-  public static populatePartitionStatistics: string = "x-ms-documentdb-populatepartitionstatistics";
-  public static queryMetrics: string = "x-ms-documentdb-query-metrics";
-  public static requestCharge: string = "x-ms-request-charge";
-  public static resourceQuota: string = "x-ms-resource-quota";
-  public static resourceUsage: string = "x-ms-resource-usage";
-  public static retryAfterMs: string = "x-ms-retry-after-ms";
-  public static scriptLogResults: string = "x-ms-documentdb-script-log-results";
-  public static populateCollectionThroughputInfo = "x-ms-documentdb-populatecollectionthroughputinfo";
-  public static supportSpatialLegacyCoordinates = "x-ms-documentdb-supportspatiallegacycoordinates";
-  public static usePolygonsSmallerThanAHemisphere = "x-ms-documentdb-usepolygonssmallerthanahemisphere";
-  public static autoPilotThroughput = "autoscaleSettings";
-  public static autoPilotThroughputSDK = "x-ms-cosmos-offer-autopilot-settings";
-  public static partitionKey: string = "x-ms-documentdb-partitionkey";
-  public static migrateOfferToManualThroughput: string = "x-ms-cosmos-migrate-offer-to-manual-throughput";
-  public static migrateOfferToAutopilot: string = "x-ms-cosmos-migrate-offer-to-autopilot";
-}
-
-export class ApiType {
-  // Mapped to hexadecimal values in the backend
-  public static readonly MongoDB: number = 1;
-  public static readonly Gremlin: number = 2;
-  public static readonly Cassandra: number = 4;
-  public static readonly Table: number = 8;
-  public static readonly SQL: number = 16;
-}
-
-export class HttpStatusCodes {
-  public static readonly OK: number = 200;
-  public static readonly Created: number = 201;
-  public static readonly Accepted: number = 202;
-  public static readonly NoContent: number = 204;
-  public static readonly NotModified: number = 304;
-  public static readonly Unauthorized: number = 401;
-  public static readonly Forbidden: number = 403;
-  public static readonly NotFound: number = 404;
-  public static readonly TooManyRequests: number = 429;
-  public static readonly Conflict: number = 409;
-
-  public static readonly InternalServerError: number = 500;
-  public static readonly BadGateway: number = 502;
-  public static readonly ServiceUnavailable: number = 503;
-  public static readonly GatewayTimeout: number = 504;
-
-  public static readonly RetryableStatusCodes: number[] = [
-    HttpStatusCodes.TooManyRequests,
-    HttpStatusCodes.InternalServerError, // TODO: Handle all 500s on Portal backend and remove from retries list
-    HttpStatusCodes.BadGateway,
-    HttpStatusCodes.ServiceUnavailable,
-    HttpStatusCodes.GatewayTimeout,
-  ];
-}
-
-export class Urls {
-  public static feedbackEmail = "https://aka.ms/cosmosdbfeedback?subject=Cosmos%20DB%20Data%20Explorer%20Feedback";
-  public static autoscaleMigration = "https://aka.ms/cosmos-autoscale-migration";
-  public static freeTierInformation = "https://aka.ms/cosmos-free-tier";
-  public static cosmosPricing = "https://aka.ms/azure-cosmos-db-pricing";
-}
-
-export class HashRoutePrefixes {
-  public static databases: string = "/dbs/{db_id}";
-  public static collections: string = "/dbs/{db_id}/colls/{coll_id}";
-  public static sprocHash: string = "/sprocs/";
-  public static sprocs: string = HashRoutePrefixes.collections + HashRoutePrefixes.sprocHash + "{sproc_id}";
-  public static docs: string = HashRoutePrefixes.collections + "/docs/{doc_id}/";
-  public static conflicts: string = HashRoutePrefixes.collections + "/conflicts";
-
-  public static databasesWithId(databaseId: string): string {
-    return this.databases.replace("{db_id}", databaseId).replace("/", ""); // strip the first slash since hasher adds it
-  }
-
-  public static collectionsWithIds(databaseId: string, collectionId: string): string {
-    const transformedDatabasePrefix: string = this.collections.replace("{db_id}", databaseId);
-
-    return transformedDatabasePrefix.replace("{coll_id}", collectionId).replace("/", ""); // strip the first slash since hasher adds it
-  }
-
-  public static sprocWithIds(
-    databaseId: string,
-    collectionId: string,
-    sprocId: string,
-    stripFirstSlash: boolean = true
-  ): string {
-    const transformedDatabasePrefix: string = this.sprocs.replace("{db_id}", databaseId);
-
-    const transformedSprocRoute: string = transformedDatabasePrefix
-      .replace("{coll_id}", collectionId)
-      .replace("{sproc_id}", sprocId);
-    if (!!stripFirstSlash) {
-      return transformedSprocRoute.replace("/", ""); // strip the first slash since hasher adds it
-    }
-
-    return transformedSprocRoute;
-  }
-
-  public static conflictsWithIds(databaseId: string, collectionId: string) {
-    const transformedDatabasePrefix: string = this.conflicts.replace("{db_id}", databaseId);
-
-    return transformedDatabasePrefix.replace("{coll_id}", collectionId).replace("/", ""); // strip the first slash since hasher adds it;
-  }
-
-  public static docsWithIds(databaseId: string, collectionId: string, docId: string) {
-    const transformedDatabasePrefix: string = this.docs.replace("{db_id}", databaseId);
-
-    return transformedDatabasePrefix.replace("{coll_id}", collectionId).replace("{doc_id}", docId).replace("/", ""); // strip the first slash since hasher adds it
-  }
-}
-
-export class ConfigurationOverridesValues {
-  public static IsBsonSchemaV2: string = "true";
-}
-
-export class KeyCodes {
-  public static Space: number = 32;
-  public static Enter: number = 13;
-  public static Escape: number = 27;
-  public static UpArrow: number = 38;
-  public static DownArrow: number = 40;
-  public static LeftArrow: number = 37;
-  public static RightArrow: number = 39;
-  public static Tab: number = 9;
-}
-
-// Normalized per: https://www.w3.org/TR/uievents-key/#named-key-attribute-values
-export class NormalizedEventKey {
-  public static readonly Space = " ";
-  public static readonly Enter = "Enter";
-  public static readonly Escape = "Escape";
-  public static readonly UpArrow = "ArrowUp";
-  public static readonly DownArrow = "ArrowDown";
-  public static readonly LeftArrow = "ArrowLeft";
-  public static readonly RightArrow = "ArrowRight";
-}
-
-export class TryCosmosExperience {
-  public static extendUrl: string = "https://trycosmosdb.azure.com/api/resource/extendportal?userId={0}";
-  public static deleteUrl: string = "https://trycosmosdb.azure.com/api/resource/deleteportal?userId={0}";
-  public static collectionsPerAccount: number = 3;
-  public static maxRU: number = 5000;
-  public static defaultRU: number = 3000;
-}
-
-export class OfferVersions {
-  public static V1: string = "V1";
-  public static V2: string = "V2";
-}
-
-export enum ConflictOperationType {
-  Replace = "replace",
-  Create = "create",
-  Delete = "delete",
-}
-
-export const EmulatorMasterKey =
-  //[SuppressMessage("Microsoft.Security", "CS002:SecretInNextLine", Justification="Well known public masterKey for emulator")]
-  "C2y6yDjf5/R+ob0N8A7Cgv30VRDJIWEHLM+4QDU5DE2nQ9nDuVTqobD4b8mGGyPMbIZnqyMsEcaGQy67XIw/Jw==";
-
-// A variable @MyVariable defined in Constants.less is accessible as StyleConstants.MyVariable
-export const StyleConstants = require("less-vars-loader!../../less/Common/Constants.less");
-
-export class Notebook {
-  public static readonly defaultBasePath = "./notebooks";
-  public static readonly heartbeatDelayMs = 5000;
-  public static readonly kernelRestartInitialDelayMs = 1000;
-  public static readonly kernelRestartMaxDelayMs = 20000;
-  public static readonly autoSaveIntervalMs = 120000;
-}
-
-export class SparkLibrary {
-  public static readonly nameMinLength = 3;
-  public static readonly nameMaxLength = 63;
-}
-
-export class AnalyticalStorageTtl {
-  public static readonly Days90: number = 7776000;
-  public static readonly Infinite: number = -1;
-  public static readonly Disabled: number = 0;
-}
-
-export class TerminalQueryParams {
-  public static readonly Terminal = "terminal";
-  public static readonly Server = "server";
-  public static readonly Token = "token";
-  public static readonly SubscriptionId = "subscriptionId";
-  public static readonly TerminalEndpoint = "terminalEndpoint";
-}
+import { HashMap } from "./HashMap";
+
+export class AuthorizationEndpoints {
+  public static arm: string = "https://management.core.windows.net/";
+  public static common: string = "https://login.windows.net/";
+}
+
+export class CodeOfConductEndpoints {
+  public static privacyStatement: string = "https://aka.ms/ms-privacy-policy";
+  public static codeOfConduct: string = "https://aka.ms/cosmos-code-of-conduct";
+  public static termsOfUse: string = "https://aka.ms/ms-terms-of-use";
+}
+
+export class EndpointsRegex {
+  public static readonly cassandra = [
+    "AccountEndpoint=(.*).cassandra.cosmosdb.azure.com",
+    "HostName=(.*).cassandra.cosmos.azure.com"
+  ];
+  public static readonly mongo = "mongodb://.*:(.*)@(.*).documents.azure.com";
+  public static readonly mongoCompute = "mongodb://.*:(.*)@(.*).mongo.cosmos.azure.com";
+  public static readonly sql = "AccountEndpoint=https://(.*).documents.azure.com";
+  public static readonly table = "TableEndpoint=https://(.*).table.cosmosdb.azure.com";
+}
+
+export class ApiEndpoints {
+  public static runtimeProxy: string = "/api/RuntimeProxy";
+  public static guestRuntimeProxy: string = "/api/guest/RuntimeProxy";
+}
+
+export class ServerIds {
+  public static localhost: string = "localhost";
+  public static blackforest: string = "blackforest";
+  public static fairfax: string = "fairfax";
+  public static mooncake: string = "mooncake";
+  public static productionPortal: string = "prod";
+  public static dev: string = "dev";
+}
+
+export class ArmApiVersions {
+  public static readonly documentDB: string = "2015-11-06";
+  public static readonly arcadia: string = "2019-06-01-preview";
+  public static readonly arcadiaLivy: string = "2019-11-01-preview";
+  public static readonly arm: string = "2015-11-01";
+  public static readonly armFeatures: string = "2014-08-01-preview";
+  public static readonly publicVersion = "2020-04-01";
+}
+
+export class ArmResourceTypes {
+  public static readonly notebookWorkspaces = "Microsoft.DocumentDB/databaseAccounts/notebookWorkspaces";
+  public static readonly synapseWorkspaces = "Microsoft.Synapse/workspaces";
+}
+
+export class BackendDefaults {
+  public static partitionKeyKind: string = "Hash";
+  public static singlePartitionStorageInGb: string = "10";
+  public static multiPartitionStorageInGb: string = "100";
+  public static maxChangeFeedRetentionDuration: number = 10;
+  public static partitionKeyVersion = 2;
+}
+
+export class ClientDefaults {
+  public static requestTimeoutMs: number = 60000;
+  public static portalCacheTimeoutMs: number = 10000;
+  public static errorNotificationTimeoutMs: number = 5000;
+  public static copyHelperTimeoutMs: number = 2000;
+  public static waitForDOMElementMs: number = 500;
+  public static cacheBustingTimeoutMs: number =
+    10 /** minutes **/ * 60 /** to seconds **/ * 1000 /** to milliseconds **/;
+  public static databaseThroughputIncreaseFactor: number = 100;
+  public static readonly arcadiaTokenRefreshInterval: number =
+    20 /** minutes **/ * 60 /** to seconds **/ * 1000 /** to milliseconds **/;
+  public static readonly arcadiaTokenRefreshIntervalPaddingMs: number = 2000;
+}
+
+export class AccountKind {
+  public static DocumentDB: string = "DocumentDB";
+  public static MongoDB: string = "MongoDB";
+  public static Parse: string = "Parse";
+  public static GlobalDocumentDB: string = "GlobalDocumentDB";
+  public static Default: string = AccountKind.DocumentDB;
+}
+
+export class CorrelationBackend {
+  public static Url: string = "https://aka.ms/cosmosdbanalytics";
+}
+
+export class DefaultAccountExperience {
+  public static DocumentDB: string = "DocumentDB";
+  public static Graph: string = "Graph";
+  public static MongoDB: string = "MongoDB";
+  public static ApiForMongoDB: string = "Azure Cosmos DB for MongoDB API";
+  public static Table: string = "Table";
+  public static Cassandra: string = "Cassandra";
+  public static Default: string = DefaultAccountExperience.DocumentDB;
+}
+
+export class CapabilityNames {
+  public static EnableTable: string = "EnableTable";
+  public static EnableGremlin: string = "EnableGremlin";
+  public static EnableCassandra: string = "EnableCassandra";
+  public static EnableAutoScale: string = "EnableAutoScale";
+  public static readonly EnableNotebooks: string = "EnableNotebooks";
+  public static readonly EnableStorageAnalytics: string = "EnableStorageAnalytics";
+  public static readonly EnableMongo: string = "EnableMongo";
+  public static readonly EnableServerless: string = "EnableServerless";
+}
+
+export class Features {
+  public static readonly cosmosdb = "cosmosdb";
+  public static readonly enableChangeFeedPolicy = "enablechangefeedpolicy";
+  public static readonly executeSproc = "dataexplorerexecutesproc";
+  public static readonly hostedDataExplorer = "hosteddataexplorerenabled";
+  public static readonly enableTtl = "enablettl";
+  public static readonly enableNotebooks = "enablenotebooks";
+  public static readonly enableGalleryPublish = "enablegallerypublish";
+  public static readonly enableLinkInjection = "enablelinkinjection";
+  public static readonly enableSpark = "enablespark";
+  public static readonly livyEndpoint = "livyendpoint";
+  public static readonly notebookServerUrl = "notebookserverurl";
+  public static readonly notebookServerToken = "notebookservertoken";
+  public static readonly notebookBasePath = "notebookbasepath";
+  public static readonly canExceedMaximumValue = "canexceedmaximumvalue";
+  public static readonly enableFixedCollectionWithSharedThroughput = "enablefixedcollectionwithsharedthroughput";
+  public static readonly ttl90Days = "ttl90days";
+  public static readonly enableRightPanelV2 = "enablerightpanelv2";
+  public static readonly enableSchema = "enableschema";
+  public static readonly enableSDKoperations = "enablesdkoperations";
+  public static readonly showMinRUSurvey = "showminrusurvey";
+}
+
+// flight names returned from the portal are always lowercase
+export class Flights {
+  public static readonly SettingsV2 = "settingsv2";
+  public static readonly MongoIndexEditor = "mongoindexeditor";
+}
+
+export class AfecFeatures {
+  public static readonly Spark = "spark-public-preview";
+  public static readonly Notebooks = "sparknotebooks-public-preview";
+  public static readonly StorageAnalytics = "storageanalytics-public-preview";
+}
+
+export class Spark {
+  public static readonly MaxWorkerCount = 10;
+  public static readonly SKUs: HashMap<string> = new HashMap({
+    "Cosmos.Spark.D1s": "D1s / 1 core / 4GB RAM",
+    "Cosmos.Spark.D2s": "D2s / 2 cores / 8GB RAM",
+    "Cosmos.Spark.D4s": "D4s / 4 cores / 16GB RAM",
+    "Cosmos.Spark.D8s": "D8s / 8 cores / 32GB RAM",
+    "Cosmos.Spark.D16s": "D16s / 16 cores / 64GB RAM",
+    "Cosmos.Spark.D32s": "D32s / 32 cores / 128GB RAM",
+    "Cosmos.Spark.D64s": "D64s / 64 cores / 256GB RAM"
+  });
+}
+
+export class TagNames {
+  public static defaultExperience: string = "defaultExperience";
+}
+
+export class MongoDBAccounts {
+  public static protocol: string = "https";
+  public static defaultPort: string = "10255";
+}
+
+export enum MongoBackendEndpointType {
+  local,
+  remote
+}
+
+// TODO: 435619 Add default endpoints per cloud and use regional only when available
+export class CassandraBackend {
+  public static readonly createOrDeleteApi: string = "api/cassandra/createordelete";
+  public static readonly guestCreateOrDeleteApi: string = "api/guest/cassandra/createordelete";
+  public static readonly queryApi: string = "api/cassandra";
+  public static readonly guestQueryApi: string = "api/guest/cassandra";
+  public static readonly keysApi: string = "api/cassandra/keys";
+  public static readonly guestKeysApi: string = "api/guest/cassandra/keys";
+  public static readonly schemaApi: string = "api/cassandra/schema";
+  public static readonly guestSchemaApi: string = "api/guest/cassandra/schema";
+}
+
+export class Queries {
+  public static CustomPageOption: string = "custom";
+  public static UnlimitedPageOption: string = "unlimited";
+  public static itemsPerPage: number = 100;
+  public static unlimitedItemsPerPage: number = 100; // TODO: Figure out appropriate value so it works for accounts with a large number of partitions
+
+  public static QueryEditorMinHeightRatio: number = 0.1;
+  public static QueryEditorMaxHeightRatio: number = 0.4;
+  public static readonly DefaultMaxDegreeOfParallelism = 6;
+}
+
+export class SavedQueries {
+  public static readonly CollectionName: string = "___Query";
+  public static readonly DatabaseName: string = "___Cosmos";
+  public static readonly OfferThroughput: number = 400;
+  public static readonly PartitionKeyProperty: string = "id";
+}
+
+export class DocumentsGridMetrics {
+  public static DocumentsPerPage: number = 100;
+  public static IndividualRowHeight: number = 34;
+  public static BufferHeight: number = 28;
+  public static SplitterMinWidth: number = 200;
+  public static SplitterMaxWidth: number = 360;
+
+  public static DocumentEditorMinWidthRatio: number = 0.2;
+  public static DocumentEditorMaxWidthRatio: number = 0.4;
+}
+
+export class ExplorerMetrics {
+  public static SplitterMinWidth: number = 240;
+  public static SplitterMaxWidth: number = 400;
+  public static CollapsedResourceTreeWidth: number = 36;
+}
+
+export class SplitterMetrics {
+  public static CollapsedPositionLeft: number = ExplorerMetrics.CollapsedResourceTreeWidth;
+}
+
+export class Areas {
+  public static ResourceTree: string = "Resource Tree";
+  public static ContextualPane: string = "Contextual Pane";
+  public static Tab: string = "Tab";
+  public static ShareDialog: string = "Share Access Dialog";
+  public static Notebook: string = "Notebook";
+}
+
+export class HttpHeaders {
+  public static activityId: string = "x-ms-activity-id";
+  public static apiType: string = "x-ms-cosmos-apitype";
+  public static authorization: string = "authorization";
+  public static collectionIndexTransformationProgress: string =
+    "x-ms-documentdb-collection-index-transformation-progress";
+  public static continuation: string = "x-ms-continuation";
+  public static correlationRequestId: string = "x-ms-correlation-request-id";
+  public static enableScriptLogging: string = "x-ms-documentdb-script-enable-logging";
+  public static guestAccessToken: string = "x-ms-encrypted-auth-token";
+  public static getReadOnlyKey: string = "x-ms-get-read-only-key";
+  public static connectionString: string = "x-ms-connection-string";
+  public static msDate: string = "x-ms-date";
+  public static location: string = "Location";
+  public static contentType: string = "Content-Type";
+  public static offerReplacePending: string = "x-ms-offer-replace-pending";
+  public static user: string = "x-ms-user";
+  public static populatePartitionStatistics: string = "x-ms-documentdb-populatepartitionstatistics";
+  public static queryMetrics: string = "x-ms-documentdb-query-metrics";
+  public static requestCharge: string = "x-ms-request-charge";
+  public static resourceQuota: string = "x-ms-resource-quota";
+  public static resourceUsage: string = "x-ms-resource-usage";
+  public static retryAfterMs: string = "x-ms-retry-after-ms";
+  public static scriptLogResults: string = "x-ms-documentdb-script-log-results";
+  public static populateCollectionThroughputInfo = "x-ms-documentdb-populatecollectionthroughputinfo";
+  public static supportSpatialLegacyCoordinates = "x-ms-documentdb-supportspatiallegacycoordinates";
+  public static usePolygonsSmallerThanAHemisphere = "x-ms-documentdb-usepolygonssmallerthanahemisphere";
+  public static autoPilotThroughput = "autoscaleSettings";
+  public static autoPilotThroughputSDK = "x-ms-cosmos-offer-autopilot-settings";
+  public static partitionKey: string = "x-ms-documentdb-partitionkey";
+  public static migrateOfferToManualThroughput: string = "x-ms-cosmos-migrate-offer-to-manual-throughput";
+  public static migrateOfferToAutopilot: string = "x-ms-cosmos-migrate-offer-to-autopilot";
+}
+
+export class ApiType {
+  // Mapped to hexadecimal values in the backend
+  public static readonly MongoDB: number = 1;
+  public static readonly Gremlin: number = 2;
+  public static readonly Cassandra: number = 4;
+  public static readonly Table: number = 8;
+  public static readonly SQL: number = 16;
+}
+
+export class HttpStatusCodes {
+  public static readonly OK: number = 200;
+  public static readonly Created: number = 201;
+  public static readonly Accepted: number = 202;
+  public static readonly NoContent: number = 204;
+  public static readonly NotModified: number = 304;
+  public static readonly Unauthorized: number = 401;
+  public static readonly Forbidden: number = 403;
+  public static readonly NotFound: number = 404;
+  public static readonly TooManyRequests: number = 429;
+  public static readonly Conflict: number = 409;
+
+  public static readonly InternalServerError: number = 500;
+  public static readonly BadGateway: number = 502;
+  public static readonly ServiceUnavailable: number = 503;
+  public static readonly GatewayTimeout: number = 504;
+
+  public static readonly RetryableStatusCodes: number[] = [
+    HttpStatusCodes.TooManyRequests,
+    HttpStatusCodes.InternalServerError, // TODO: Handle all 500s on Portal backend and remove from retries list
+    HttpStatusCodes.BadGateway,
+    HttpStatusCodes.ServiceUnavailable,
+    HttpStatusCodes.GatewayTimeout
+  ];
+}
+
+export class Urls {
+  public static feedbackEmail = "https://aka.ms/cosmosdbfeedback?subject=Cosmos%20DB%20Data%20Explorer%20Feedback";
+  public static autoscaleMigration = "https://aka.ms/cosmos-autoscale-migration";
+  public static freeTierInformation = "https://aka.ms/cosmos-free-tier";
+  public static cosmosPricing = "https://aka.ms/azure-cosmos-db-pricing";
+}
+
+export class HashRoutePrefixes {
+  public static databases: string = "/dbs/{db_id}";
+  public static collections: string = "/dbs/{db_id}/colls/{coll_id}";
+  public static sprocHash: string = "/sprocs/";
+  public static sprocs: string = HashRoutePrefixes.collections + HashRoutePrefixes.sprocHash + "{sproc_id}";
+  public static docs: string = HashRoutePrefixes.collections + "/docs/{doc_id}/";
+  public static conflicts: string = HashRoutePrefixes.collections + "/conflicts";
+
+  public static databasesWithId(databaseId: string): string {
+    return this.databases.replace("{db_id}", databaseId).replace("/", ""); // strip the first slash since hasher adds it
+  }
+
+  public static collectionsWithIds(databaseId: string, collectionId: string): string {
+    const transformedDatabasePrefix: string = this.collections.replace("{db_id}", databaseId);
+
+    return transformedDatabasePrefix.replace("{coll_id}", collectionId).replace("/", ""); // strip the first slash since hasher adds it
+  }
+
+  public static sprocWithIds(
+    databaseId: string,
+    collectionId: string,
+    sprocId: string,
+    stripFirstSlash: boolean = true
+  ): string {
+    const transformedDatabasePrefix: string = this.sprocs.replace("{db_id}", databaseId);
+
+    const transformedSprocRoute: string = transformedDatabasePrefix
+      .replace("{coll_id}", collectionId)
+      .replace("{sproc_id}", sprocId);
+    if (!!stripFirstSlash) {
+      return transformedSprocRoute.replace("/", ""); // strip the first slash since hasher adds it
+    }
+
+    return transformedSprocRoute;
+  }
+
+  public static conflictsWithIds(databaseId: string, collectionId: string) {
+    const transformedDatabasePrefix: string = this.conflicts.replace("{db_id}", databaseId);
+
+    return transformedDatabasePrefix.replace("{coll_id}", collectionId).replace("/", ""); // strip the first slash since hasher adds it;
+  }
+
+  public static docsWithIds(databaseId: string, collectionId: string, docId: string) {
+    const transformedDatabasePrefix: string = this.docs.replace("{db_id}", databaseId);
+
+    return transformedDatabasePrefix
+      .replace("{coll_id}", collectionId)
+      .replace("{doc_id}", docId)
+      .replace("/", ""); // strip the first slash since hasher adds it
+  }
+}
+
+export class ConfigurationOverridesValues {
+  public static IsBsonSchemaV2: string = "true";
+}
+
+export class KeyCodes {
+  public static Space: number = 32;
+  public static Enter: number = 13;
+  public static Escape: number = 27;
+  public static UpArrow: number = 38;
+  public static DownArrow: number = 40;
+  public static LeftArrow: number = 37;
+  public static RightArrow: number = 39;
+  public static Tab: number = 9;
+}
+
+// Normalized per: https://www.w3.org/TR/uievents-key/#named-key-attribute-values
+export class NormalizedEventKey {
+  public static readonly Space = " ";
+  public static readonly Enter = "Enter";
+  public static readonly Escape = "Escape";
+  public static readonly UpArrow = "ArrowUp";
+  public static readonly DownArrow = "ArrowDown";
+  public static readonly LeftArrow = "ArrowLeft";
+  public static readonly RightArrow = "ArrowRight";
+}
+
+export class TryCosmosExperience {
+  public static extendUrl: string = "https://trycosmosdb.azure.com/api/resource/extendportal?userId={0}";
+  public static deleteUrl: string = "https://trycosmosdb.azure.com/api/resource/deleteportal?userId={0}";
+  public static collectionsPerAccount: number = 3;
+  public static maxRU: number = 5000;
+  public static defaultRU: number = 3000;
+}
+
+export class OfferVersions {
+  public static V1: string = "V1";
+  public static V2: string = "V2";
+}
+
+export enum ConflictOperationType {
+  Replace = "replace",
+  Create = "create",
+  Delete = "delete"
+}
+
+export const EmulatorMasterKey =
+  //[SuppressMessage("Microsoft.Security", "CS002:SecretInNextLine", Justification="Well known public masterKey for emulator")]
+  "C2y6yDjf5/R+ob0N8A7Cgv30VRDJIWEHLM+4QDU5DE2nQ9nDuVTqobD4b8mGGyPMbIZnqyMsEcaGQy67XIw/Jw==";
+
+// A variable @MyVariable defined in Constants.less is accessible as StyleConstants.MyVariable
+export const StyleConstants = require("less-vars-loader!../../less/Common/Constants.less");
+
+export class Notebook {
+  public static readonly defaultBasePath = "./notebooks";
+  public static readonly heartbeatDelayMs = 5000;
+  public static readonly kernelRestartInitialDelayMs = 1000;
+  public static readonly kernelRestartMaxDelayMs = 20000;
+  public static readonly autoSaveIntervalMs = 120000;
+}
+
+export class SparkLibrary {
+  public static readonly nameMinLength = 3;
+  public static readonly nameMaxLength = 63;
+}
+
+export class AnalyticalStorageTtl {
+  public static readonly Days90: number = 7776000;
+  public static readonly Infinite: number = -1;
+  public static readonly Disabled: number = 0;
+}
+
+export class TerminalQueryParams {
+  public static readonly Terminal = "terminal";
+  public static readonly Server = "server";
+  public static readonly Token = "token";
+  public static readonly SubscriptionId = "subscriptionId";
+  public static readonly TerminalEndpoint = "terminalEndpoint";
+}

src/Common/CosmosClient.test.ts

@@ -1,5 +1,5 @@
 import { ResourceType } from "@azure/cosmos/dist-esm/common/constants";
-import { Platform, resetConfigContext, updateConfigContext } from "../ConfigContext";
+import { configContext, Platform, updateConfigContext, resetConfigContext } from "../ConfigContext";
 import { updateUserContext } from "../UserContext";
 import { endpoint, getTokenFromAuthService, requestPlugin, tokenProvider } from "./CosmosClient";
 
@@ -10,17 +10,17 @@ describe("tokenProvider", () => {
     resourceId: "",
     resourceType: "dbs" as ResourceType,
     headers: {},
-    getAuthorizationTokenUsingMasterKey: () => "",
+    getAuthorizationTokenUsingMasterKey: () => ""
   };
 
   beforeEach(() => {
     updateConfigContext({
-      BACKEND_ENDPOINT: "https://main.documentdb.ext.azure.com",
+      BACKEND_ENDPOINT: "https://main.documentdb.ext.azure.com"
     });
     window.fetch = jest.fn().mockImplementation(() => {
       return {
         json: () => "{}",
-        headers: new Map(),
+        headers: new Map()
       };
     });
   });
@@ -36,7 +36,7 @@ describe("tokenProvider", () => {
 
   it("does not call the auth service if a master key is set", async () => {
     updateUserContext({
-      masterKey: "foo",
+      masterKey: "foo"
     });
     await tokenProvider(options);
     expect((window.fetch as any).mock.calls.length).toBe(0);
@@ -50,7 +50,7 @@ describe("getTokenFromAuthService", () => {
     window.fetch = jest.fn().mockImplementation(() => {
       return {
         json: () => "{}",
-        headers: new Map(),
+        headers: new Map()
       };
     });
   });
@@ -61,7 +61,7 @@ describe("getTokenFromAuthService", () => {
 
   it("builds the correct URL in production", () => {
     updateConfigContext({
-      BACKEND_ENDPOINT: "https://main.documentdb.ext.azure.com",
+      BACKEND_ENDPOINT: "https://main.documentdb.ext.azure.com"
     });
     getTokenFromAuthService("GET", "dbs", "foo");
     expect(window.fetch).toHaveBeenCalledWith(
@@ -72,7 +72,7 @@ describe("getTokenFromAuthService", () => {
 
   it("builds the correct URL in dev", () => {
     updateConfigContext({
-      BACKEND_ENDPOINT: "https://localhost:1234",
+      BACKEND_ENDPOINT: "https://localhost:1234"
     });
     getTokenFromAuthService("GET", "dbs", "foo");
     expect(window.fetch).toHaveBeenCalledWith(
@@ -91,19 +91,20 @@ describe("endpoint", () => {
         location: "foo",
         type: "foo",
         kind: "foo",
+        tags: [],
         properties: {
           documentEndpoint: "bar",
           gremlinEndpoint: "foo",
           tableEndpoint: "foo",
-          cassandraEndpoint: "foo",
-        },
-      },
+          cassandraEndpoint: "foo"
+        }
+      }
     });
     expect(endpoint()).toEqual("bar");
   });
   it("uses _endpoint if set", () => {
     updateUserContext({
-      endpoint: "baz",
+      endpoint: "baz"
     });
     expect(endpoint()).toEqual("baz");
   });
@@ -120,7 +121,7 @@ describe("requestPlugin", () => {
       updateConfigContext({
         platform: Platform.Hosted,
         BACKEND_ENDPOINT: "https://localhost:1234",
-        PROXY_PATH: "/proxy",
+        PROXY_PATH: "/proxy"
       });
       const headers = {};
       const endpoint = "https://docs.azure.com";

src/Common/CosmosClient.ts

@@ -1,22 +1,15 @@
 import * as Cosmos from "@azure/cosmos";
 import { RequestInfo, setAuthorizationTokenHeaderUsingMasterKey } from "@azure/cosmos";
 import { configContext, Platform } from "../ConfigContext";
-import { userContext } from "../UserContext";
+import { getErrorMessage } from "./ErrorHandlingUtils";
 import { logConsoleError } from "../Utils/NotificationConsoleUtils";
 import { EmulatorMasterKey, HttpHeaders } from "./Constants";
-import { getErrorMessage } from "./ErrorHandlingUtils";
+import { userContext } from "../UserContext";
 
 const _global = typeof self === "undefined" ? window : self;
 
 export const tokenProvider = async (requestInfo: RequestInfo) => {
   const { verb, resourceId, resourceType, headers } = requestInfo;
-
-  if (userContext.features.enableAadDataPlane && userContext.aadToken) {
-    const AUTH_PREFIX = `type=aad&ver=1.0&sig=`;
-    const authorizationToken = `${AUTH_PREFIX}${userContext.aadToken}`;
-    return authorizationToken;
-  }
-
   if (configContext.platform === Platform.Emulator) {
     // TODO This SDK method mutates the headers object. Find a better one or fix the SDK.
     await setAuthorizationTokenHeaderUsingMasterKey(verb, resourceId, resourceType, headers, EmulatorMasterKey);
@@ -39,7 +32,7 @@ export const tokenProvider = async (requestInfo: RequestInfo) => {
 };
 
 export const requestPlugin: Cosmos.Plugin<any> = async (requestContext, next) => {
-  requestContext.endpoint = new URL(configContext.PROXY_PATH, window.location.href).href;
+  requestContext.endpoint = configContext.PROXY_PATH;
   requestContext.headers["x-ms-proxy-target"] = endpoint();
   return next(requestContext);
 };
@@ -50,7 +43,12 @@ export const endpoint = () => {
     const location = _global.parent ? _global.parent.location : _global.location;
     return configContext.EMULATOR_ENDPOINT || location.origin;
   }
-  return userContext.endpoint || userContext?.databaseAccount?.properties?.documentEndpoint;
+  return (
+    userContext.endpoint ||
+    (userContext.databaseAccount &&
+      userContext.databaseAccount.properties &&
+      userContext.databaseAccount.properties.documentEndpoint)
+  );
 };
 
 export async function getTokenFromAuthService(verb: string, resourceType: string, resourceId?: string): Promise<any> {
@@ -60,13 +58,13 @@ export async function getTokenFromAuthService(verb: string, resourceType: string
       method: "POST",
       headers: {
         "content-type": "application/json",
-        "x-ms-encrypted-auth-token": userContext.accessToken,
+        "x-ms-encrypted-auth-token": userContext.accessToken
       },
       body: JSON.stringify({
         verb,
         resourceType,
-        resourceId,
-      }),
+        resourceId
+      })
     });
     //TODO I am not sure why we have to parse the JSON again here. fetch should do it for us when we call .json()
     const result = JSON.parse(await response.json());
@@ -77,23 +75,19 @@ export async function getTokenFromAuthService(verb: string, resourceType: string
   }
 }
 
-let _client: Cosmos.CosmosClient;
-
 export function client(): Cosmos.CosmosClient {
-  if (_client) return _client;
   const options: Cosmos.CosmosClientOptions = {
-    endpoint: endpoint() || "https://cosmos.azure.com", // CosmosClient gets upset if we pass a bad URL. This should never actually get called
+    endpoint: endpoint() || " ", // CosmosClient gets upset if we pass a falsy value here
     key: userContext.masterKey,
     tokenProvider,
     connectionPolicy: {
-      enableEndpointDiscovery: false,
+      enableEndpointDiscovery: false
     },
-    userAgentSuffix: "Azure Portal",
+    userAgentSuffix: "Azure Portal"
   };
 
   if (configContext.PROXY_PATH !== undefined) {
     (options as any).plugins = [{ on: "request", plugin: requestPlugin }];
   }
-  _client = new Cosmos.CosmosClient(options);
-  return _client;
+  return new Cosmos.CosmosClient(options);
 }

src/Common/DatabaseAccountUtility.ts

@@ -1,17 +0,0 @@
-import { userContext } from "../UserContext";
-
-function isVirtualNetworkFilterEnabled() {
-  return userContext.databaseAccount?.properties?.isVirtualNetworkFilterEnabled;
-}
-
-function isIpRulesEnabled() {
-  return userContext.databaseAccount?.properties?.ipRules?.length > 0;
-}
-
-function isPrivateEndpointConnectionsEnabled() {
-  return userContext.databaseAccount?.properties?.privateEndpointConnections?.length > 0;
-}
-
-export function isPublicInternetAccessAllowed(): boolean {
-  return !isVirtualNetworkFilterEnabled() && !isIpRulesEnabled() && !isPrivateEndpointConnectionsEnabled();
-}

src/Common/DocumentUtility.ts

@@ -1,7 +1,8 @@
+import { DefaultAccountExperienceType } from "../DefaultAccountExperienceType";
 import { userContext } from "../UserContext";
 
 export const getEntityName = (): string => {
-  if (userContext.apiType === "Mongo") {
+  if (userContext.defaultExperience === DefaultAccountExperienceType.MongoDB) {
     return "document";
   }
 

src/Common/EditableUtility.ts

@@ -1,94 +1,94 @@
-import * as ko from "knockout";
-import * as ViewModels from "../Contracts/ViewModels";
-
-export default class EditableUtility {
-  public static observable<T>(initialValue?: T): ViewModels.Editable<T> {
-    var observable: ViewModels.Editable<T> = <ViewModels.Editable<T>>ko.observable<T>(initialValue);
-
-    observable.edits = ko.observableArray<T>([initialValue]);
-    observable.validations = ko.observableArray<(value: T) => boolean>([]);
-
-    observable.setBaseline = (baseline: T) => {
-      observable(baseline);
-      observable.edits([baseline]);
-    };
-
-    observable.getEditableCurrentValue = ko.computed<T>(() => {
-      const edits = (observable.edits && observable.edits()) || [];
-      if (edits.length === 0) {
-        return undefined;
-      }
-
-      return edits[edits.length - 1];
-    });
-
-    observable.getEditableOriginalValue = ko.computed<T>(() => {
-      const edits = (observable.edits && observable.edits()) || [];
-      if (edits.length === 0) {
-        return undefined;
-      }
-
-      return edits[0];
-    });
-
-    observable.editableIsDirty = ko.computed<boolean>(() => {
-      const edits = (observable.edits && observable.edits()) || [];
-      if (edits.length <= 1) {
-        return false;
-      }
-
-      let current: any = observable.getEditableCurrentValue();
-      let original: any = observable.getEditableOriginalValue();
-
-      switch (typeof current) {
-        case "string":
-        case "undefined":
-        case "number":
-        case "boolean":
-          current = current && current.toString();
-          break;
-
-        default:
-          current = JSON.stringify(current);
-          break;
-      }
-
-      switch (typeof original) {
-        case "string":
-        case "undefined":
-        case "number":
-        case "boolean":
-          original = original && original.toString();
-          break;
-
-        default:
-          original = JSON.stringify(original);
-          break;
-      }
-
-      if (current !== original) {
-        return true;
-      }
-
-      return false;
-    });
-
-    observable.subscribe((edit) => {
-      var edits = observable.edits && observable.edits();
-      if (!edits) {
-        return;
-      }
-      edits.push(edit);
-      observable.edits(edits);
-    });
-
-    observable.editableIsValid = ko.observable<boolean>(true);
-    observable.subscribe((value) => {
-      const validations: ((value: T) => boolean)[] = (observable.validations && observable.validations()) || [];
-      const isValid = validations.every((validate) => validate(value));
-      observable.editableIsValid(isValid);
-    });
-
-    return observable;
-  }
-}
+import * as ko from "knockout";
+import * as ViewModels from "../Contracts/ViewModels";
+
+export default class EditableUtility {
+  public static observable<T>(initialValue?: T): ViewModels.Editable<T> {
+    var observable: ViewModels.Editable<T> = <ViewModels.Editable<T>>ko.observable<T>(initialValue);
+
+    observable.edits = ko.observableArray<T>([initialValue]);
+    observable.validations = ko.observableArray<(value: T) => boolean>([]);
+
+    observable.setBaseline = (baseline: T) => {
+      observable(baseline);
+      observable.edits([baseline]);
+    };
+
+    observable.getEditableCurrentValue = ko.computed<T>(() => {
+      const edits = (observable.edits && observable.edits()) || [];
+      if (edits.length === 0) {
+        return undefined;
+      }
+
+      return edits[edits.length - 1];
+    });
+
+    observable.getEditableOriginalValue = ko.computed<T>(() => {
+      const edits = (observable.edits && observable.edits()) || [];
+      if (edits.length === 0) {
+        return undefined;
+      }
+
+      return edits[0];
+    });
+
+    observable.editableIsDirty = ko.computed<boolean>(() => {
+      const edits = (observable.edits && observable.edits()) || [];
+      if (edits.length <= 1) {
+        return false;
+      }
+
+      let current: any = observable.getEditableCurrentValue();
+      let original: any = observable.getEditableOriginalValue();
+
+      switch (typeof current) {
+        case "string":
+        case "undefined":
+        case "number":
+        case "boolean":
+          current = current && current.toString();
+          break;
+
+        default:
+          current = JSON.stringify(current);
+          break;
+      }
+
+      switch (typeof original) {
+        case "string":
+        case "undefined":
+        case "number":
+        case "boolean":
+          original = original && original.toString();
+          break;
+
+        default:
+          original = JSON.stringify(original);
+          break;
+      }
+
+      if (current !== original) {
+        return true;
+      }
+
+      return false;
+    });
+
+    observable.subscribe(edit => {
+      var edits = observable.edits && observable.edits();
+      if (!edits) {
+        return;
+      }
+      edits.push(edit);
+      observable.edits(edits);
+    });
+
+    observable.editableIsValid = ko.observable<boolean>(true);
+    observable.subscribe(value => {
+      const validations: ((value: T) => boolean)[] = (observable.validations && observable.validations()) || [];
+      const isValid = validations.every(validate => validate(value));
+      observable.editableIsValid(isValid);
+    });
+
+    return observable;
+  }
+}

src/Common/EntityValue.tsx

@@ -1,66 +0,0 @@
-import { DatePicker, TextField } from "@fluentui/react";
-import React, { FunctionComponent } from "react";
-
-export interface TableEntityProps {
-  entityValueLabel?: string;
-  entityValuePlaceholder: string;
-  entityValue: string | Date;
-  isEntityTypeDate: boolean;
-  isEntityValueDisable?: boolean;
-  entityTimeValue: string;
-  entityValueType: string;
-  onEntityValueChange: (event: React.FormEvent<HTMLElement>, newInput?: string) => void;
-  onSelectDate: (date: Date | null | undefined) => void;
-  onEntityTimeValueChange: (event: React.FormEvent<HTMLElement>, newInput?: string) => void;
-}
-
-export const EntityValue: FunctionComponent<TableEntityProps> = ({
-  entityValueLabel,
-  entityValuePlaceholder,
-  entityValue,
-  isEntityTypeDate,
-  entityTimeValue,
-  entityValueType,
-  onEntityValueChange,
-  onSelectDate,
-  isEntityValueDisable,
-  onEntityTimeValueChange,
-}: TableEntityProps): JSX.Element => {
-  if (isEntityTypeDate) {
-    return (
-      <>
-        <DatePicker
-          className="addEntityDatePicker"
-          placeholder={entityValuePlaceholder}
-          value={entityValue ? new Date(entityValue) : new Date()}
-          ariaLabel={entityValuePlaceholder}
-          onSelectDate={onSelectDate}
-          disabled={isEntityValueDisable}
-        />
-        <TextField
-          label={entityValueLabel && entityValueLabel}
-          id="entityTimeId"
-          autoFocus
-          type="time"
-          value={entityTimeValue}
-          onChange={onEntityTimeValueChange}
-          disabled={isEntityValueDisable}
-        />
-      </>
-    );
-  }
-
-  return (
-    <TextField
-      label={entityValueLabel && entityValueLabel}
-      className="addEntityTextField"
-      id="entityValueId"
-      autoFocus
-      disabled={isEntityValueDisable}
-      type={entityValueType}
-      placeholder={entityValuePlaceholder}
-      value={typeof entityValue === "string" ? entityValue : ""}
-      onChange={onEntityValueChange}
-    />
-  );
-};

src/Common/EnvironmentUtility.ts

@@ -1,6 +1,6 @@
-export function normalizeArmEndpoint(uri: string): string {
-  if (uri && uri.slice(-1) !== "/") {
-    return `${uri}/`;
-  }
-  return uri;
-}
+export function normalizeArmEndpoint(uri: string): string {
+  if (uri && uri.slice(-1) !== "/") {
+    return `${uri}/`;
+  }
+  return uri;
+}

src/Common/ErrorHandlingUtils.ts

@@ -1,9 +1,8 @@
+import { ARMError } from "../Utils/arm/request";
+import { HttpStatusCodes } from "./Constants";
 import { MessageTypes } from "../Contracts/ExplorerContracts";
 import { SubscriptionType } from "../Contracts/SubscriptionType";
-import { userContext } from "../UserContext";
-import { ARMError } from "../Utils/arm/request";
 import { logConsoleError } from "../Utils/NotificationConsoleUtils";
-import { HttpStatusCodes } from "./Constants";
 import { logError } from "./Logger";
 import { sendMessage } from "./MessageHandler";
 
@@ -22,7 +21,7 @@ export const handleError = (error: string | ARMError | Error, area: string, cons
   sendNotificationForError(errorMessage, errorCode);
 };
 
-export const getErrorMessage = (error: string | Error = ""): string => {
+export const getErrorMessage = (error: string | Error): string => {
   const errorMessage = typeof error === "string" ? error : error.message;
   return replaceKnownError(errorMessage);
 };
@@ -38,18 +37,18 @@ const sendNotificationForError = (errorMessage: string, errorCode: number | stri
     }
     sendMessage({
       type: MessageTypes.ForbiddenError,
-      reason: errorMessage,
+      reason: errorMessage
     });
   }
 };
 
 const replaceKnownError = (errorMessage: string): string => {
   if (
-    userContext.subscriptionType === SubscriptionType.Internal &&
-    errorMessage?.indexOf("SharedOffer is Disabled for your account") >= 0
+    window.dataExplorer?.subscriptionType() === SubscriptionType.Internal &&
+    errorMessage.indexOf("SharedOffer is Disabled for your account") >= 0
   ) {
     return "Database throughput is not supported for internal subscriptions.";
-  } else if (errorMessage?.indexOf("Partition key paths must contain only valid") >= 0) {
+  } else if (errorMessage.indexOf("Partition key paths must contain only valid") >= 0) {
     return "Partition key paths must contain only valid characters and not contain a trailing slash or wildcard character.";
   }
 

src/Common/HashMap.test.ts

@@ -0,0 +1,70 @@
+import { HashMap } from "./HashMap";
+
+describe("HashMap", () => {
+  it("should test if key/val exists", () => {
+    const map = new HashMap<number>();
+    map.set("a", 123);
+
+    expect(map.has("a")).toBe(true);
+    expect(map.has("b")).toBe(false);
+  });
+
+  it("should get object back", () => {
+    const map = new HashMap<string>();
+    map.set("a", "123");
+    map.set("a", "456");
+
+    expect(map.get("a")).toBe("456");
+    expect(map.get("a")).not.toBe("123");
+  });
+
+  it("should return the right size", () => {
+    const map = new HashMap<string>();
+    map.set("a", "123");
+    map.set("b", "456");
+
+    expect(map.size()).toBe(2);
+  });
+
+  it("should be iterable", () => {
+    const map = new HashMap<number>();
+    map.set("a", 1);
+    map.set("b", 10);
+    map.set("c", 100);
+    map.set("d", 1000);
+
+    let i = 0;
+    map.forEach((key: string, value: number) => {
+      i += value;
+    });
+    expect(i).toBe(1111);
+  });
+
+  it("should be deleted", () => {
+    const map = new HashMap<number>();
+    map.set("a", 1);
+    map.set("b", 10);
+
+    expect(map.delete("a")).toBe(true);
+    expect(map.delete("c")).toBe(false);
+    expect(map.has("a")).toBe(false);
+    expect(map.has("b")).toBe(true);
+  });
+
+  it("should clear", () => {
+    const map = new HashMap<number>();
+    map.set("a", 1);
+    map.clear();
+    expect(map.size()).toBe(0);
+    expect(map.has("a")).toBe(false);
+  });
+
+  it("should return all keys", () => {
+    const map = new HashMap<number>();
+    map.set("a", 1);
+    map.set("b", 1);
+    expect(map.keys()).toEqual(["a", "b"]);
+    map.clear();
+    expect(map.keys().length).toBe(0);
+  });
+});