Compare commits

..

1196 Commits

Author SHA1 Message Date
nishthaAhujaa
919a344d1e fixed through setTimeout 2025-05-07 17:15:24 +05:30
Laurent Nguyen
2fa95a281e Disable "Learn more" link for now in Fabric Home (#2129) 2025-05-07 11:52:41 +02:00
Sourabh Jain
ea6f3d1579 Cloudshell: Few Enhancement (#2128)
* few enhancement

* fix time
2025-05-05 21:17:36 +05:30
Dmitry Shilov
f9b0abdd14 fix: Add overflow property and set minimum heights for flex and sidebar containers (#2124)
* fix: Add overflow property and set minimum heights for flex and sidebar containers

* fix: Update overflow and minimum height properties for tab panes and containers
2025-05-05 15:50:43 +02:00
asier-isayas
10cda21401 Add Vector Index Shard Key option on container creation (#2097)
* Add vector index shard key

* npm run format

* rename shard key to vector index shard key

* add tooltip for quantization byte size

* change text for GSI and container in VectorEmbedding Policy

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2025-05-02 11:05:40 -04:00
Sourabh Jain
205355bf55 Shell: Integrate Cloudshell to existing shells (#2098)
* first draft

* refactored code

* ux fix

* add custom header support and fix ui

* minor changes

* hide last command also

* remove logger

* bug fixes

* updated loick file

* fix tests

* moved files

* update readme

* documentation update

* fix compilationerror

* undefined check handle

* format fix

* format fix

* fix lints

* format fix

* fix unrelatred test

* code refator

* fix format

* ut fix

* cgmanifest

* Revert "cgmanifest"

This reverts commit 2e76a6926ee0d3d4e0510f2e04e03446c2ca8c47.

* fix snap

* test fix

* formatting code

* updated xterm

* include username in command

* cloudshell add exit

* fix test

* format fix

* tets fix

* fix multiple open cloudshell calls

* socket time out after 20 min

* remove unused code

* 120 min

* Addressed comments
2025-04-30 13:19:01 -07:00
sunghyunkang1111
bb66deb3a4 Added more test cases and fix system partition key load issue (#2126)
* Added more test cases and fix system partition key load issue

* Fix unit tests and fix ci

* Updated test snapsho
2025-04-30 15:18:11 -05:00
Laurent Nguyen
fe73d0a1c6 Fix Fabric Native ReadOnly mode (#2123)
* Add FabricNativeReadOnly mode

* Hide Settings for Fabric native readonly

* Fix strict compil
2025-04-30 17:37:54 +02:00
sakshigupta12feb
e90e1fc581 Updated the Migrate data link (#2122)
* updated the Migrate data link

* updated the Migrate data link (removed en-us)

---------

Co-authored-by: Sakshi Gupta <sakshig+microsoft@microsoft.com>
2025-04-30 17:48:15 +05:30
Nishtha Ahuja
8bcad6e0e0 Emulator Quickstart Tutorials (#2121)
* updated all outdated sample apps
Co-authored-by: nishthaAhujaa <nishtha17354@iiittd.ac.in>
2025-04-30 13:32:53 +05:30
SATYA SB
9f3236c29c [accessibility-3560183]:[Screen reader - Cosmos DB Query Copilot - Query Faster with Copilot>Enable Query Advisor]: Screen reader does not announce the dialog information on invoking 'Clear editor' button. (#2068)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2025-04-30 11:35:58 +05:30
Laurent Nguyen
2f858ecf9b Fabric native improvements: Settings pane, Partition Key settings tab, sample data and message contract (#2119)
* Hide entire Accordion of options in Settings Pane

* In PartitionKeyComponent hide "Change partition key" label when read-only.

* Create sample data container with correct pkey

* Add unit tests to PartitionKeyComponent

* Fix format

* fix unit test snapshot

* Add Fabric message to open Settings to given tab id

* Improve syntax on message contract

* Remove "(preview)" in partition key tab title in Settings Tab
2025-04-29 17:50:20 +02:00
sunghyunkang1111
274c85d2de Added document test skips (#2120) 2025-04-28 13:42:18 -05:00
asier-isayas
d9436be61b Remove references to old Portal Backend (#2109)
* remove old portal backend endpoints

* format

* fix tests

* remove Materialized Views from createResourceTokenTreeNodes

* add portal FE back to defaultAllowedBackendEndpoints

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2025-04-28 13:29:27 -04:00
Nishtha Ahuja
6db2536a61 fixed quickstart tab in emulator (#2115)
Co-authored-by: nishthaAhujaa <nishtha17354@iiittd.ac.in>
2025-04-28 21:11:27 +05:30
Sourabh Jain
714f38a1be Mongo RU Schema Analyzer Deprecation (#2117)
* remove menu item

* remove unused import
2025-04-27 20:43:24 -05:00
asier-isayas
af4e1d10b4 GSI: Remove Unique Key Policy and Manual Throughput (#2114)
* Remove Unique Key Policy and Manual Throughput

* fix tests

* remove manual throughput option from scale & settings

* fix test

* cleanup

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2025-04-18 14:39:31 -04:00
Laurent Nguyen
6dbc412fa6 Implement Sample data import for Fabric Home (#2101)
* Implement dialog to import sample data

* Fix format

* Cosmetic fixes

* fix: update help link to point to the new documentation URL

---------

Co-authored-by: Sevo Kukol <sevoku@microsoft.com>
2025-04-16 14:27:22 -07:00
sunghyunkang1111
3470f56535 Pk missing fix (#2107)
* fix partition key missing not being able to load the document

* Implement E2E tests for documents with different partitionkeys

* Implement E2E tests for documents with different partitionkeys

* Implement E2E tests for documents with different partitionkeys

* Updated snapshot

* Updated tests for MongoRU and add create/delete tests

* Fixing system partition key showing up in Data Explorer
2025-04-16 13:12:53 -05:00
Vsevolod Kukol
00ec678569 fix: handle optional activeTab in tab activation logic (#2106) 2025-04-16 10:34:15 -07:00
Laurent Nguyen
27c9ea7ab6 Add tracing events for tracking query execution and upload documents (#2100)
* Add tracing for Execute (submit) query and Upload documents

* Trace query closer to iterator operation

* Add warnings to values used in Fabric

* Fix format

* Don't trace execute queries for filtering calls

* Remove tracing call for documents tab filtering

* Fix failing unit test.

---------

Co-authored-by: Jade Welton <jawelton@microsoft.com>
Co-authored-by: Sevo Kukol <sevoku@microsoft.com>
2025-04-16 10:31:43 -07:00
asier-isayas
d5fe2d9e9f Fix Unit and E2E tests (#2112)
* fix tests

* remove Materialized Views from createResourceTokenTreeNodes

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2025-04-16 10:05:36 -04:00
Laurent Nguyen
94b1e729d1 Enable original azure resource tree style for Fabric native and turn on Settings tab (#2103)
* Enable original azure resource tree for Fabric native and turn on Settings page

* Fix unit tests
2025-04-15 08:49:16 -07:00
Laurent Nguyen
afdbefe36c Implement refreshResourceTree message and hide refresh button above resource tree for Fabric native (#2102) 2025-04-15 08:48:44 -07:00
asier-isayas
2cff0fc3ff Global Secondary Index (#2071)
* add Materialized Views feature flag

* fetch MV properties from RP API and capture them in our data models

* AddMaterializedViewPanel

* undefined check

* subpartition keys

* Partition Key, Throughput, Unique Keys

* All views associated with a container (#2063) and Materialized View Target Container (#2065)

Identified Source container and Target container
Created tabs in Scale and Settings respectively
Changed the Icon of target container

* Add MV Panel

* format

* format

* styling

* add tests

* tests

* test files (#2074)

Co-authored-by: nishthaAhujaa

* fix type error

* fix tests

* merge conflict

* Panel Integration (#2075)

* integrated panel

* edited header text

---------

Co-authored-by: nishthaAhujaa <nishtha17354@iiittd.ac.in>
Co-authored-by: Asier Isayas <aisayas@microsoft.com>

* updated tests (#2077)

Co-authored-by: nishthaAhujaa

* fix tests

* update treeNodeUtil test snap

* update settings component test snap

* fixed source container in global "New Materialized View"

* source container check (#2079)

Co-authored-by: nishthaAhujaa

* renamed Materialized Views to Global Secondary Index

* more renaming

* fix import

* fix typo

* disable materialized views for Fabric

* updated input validation

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
Co-authored-by: Nishtha Ahuja <45535788+nishthaAhujaa@users.noreply.github.com>
Co-authored-by: nishthaAhujaa <nishtha17354@iiittd.ac.in>
2025-04-11 10:39:32 -04:00
sunghyunkang1111
a3bfc89318 Revert "Pk missing fix (#2094)" (#2099)
This reverts commit af0a890516.
2025-04-09 13:04:44 -05:00
Ajay Parulekar
0666e11d89 Renaming Materialized views builder blade text to Global secondary indexes for NoSql API (#1991)
* GSI changes

* GSI changes

* GSI changes

* updating GlobalSecondaryIndexesBuilder.json

* Changes

* Update cost text keys based on user context API type

* Refactor Materialized Views Builder code for improved readability and consistency in API type checks

* Update links in Materialized Views Builder for consistency and accuracy

* Update Global Secondary Indexes links and descriptions for clarity and accuracy based on API type

* Update portal notification message keys based on user context API type for Materialized Views Builder

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Fix capitalization and wording inconsistencies in Materialized Views Builder localization strings

* Fix capitalization and wording inconsistencies in localization strings for Materialized Views Builder

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

* Update src/Localization/en/MaterializedViewsBuilder.json

Co-authored-by: Justine Cocchi <justine@cocchi.org>

---------

Co-authored-by: Justine Cocchi <justine@cocchi.org>
2025-04-09 13:32:35 -04:00
bogercraig
9bb1d0bace Manual Region Selection (#2037)
* Add standin region selection to settings menu.

* Retrieve read and write regions from user context and populate dropdown menu.  Update local storage value.
Need to now connect with updating read region of primary cosmos client.

* Change to only selecting region for cosmos client.  Not setting up separate read and write clients.

* Add read and write endpoint logging to cosmos client.

* Pass changing endpoint from settings menu to client.  Encountered token issues using new endpoint in client.

* Rough implementation of region selection of endpoint for cosmos client.  Still need to:
1 - Use separate context var to track selected region.  Directly updating database account context throws off token generation by acquireMSALTokenForAccount
2 - Remove href overrides in acquireMSALTokenForAccount.

* Update region selection to include global endpoint and generate a unique list of read and write endpoints.
Need to continue with clearing out selected endpoint when global is selected again.
Write operations stall when read region is selected even though 403 returned when region rejects operation.
Need to limit feature availablility to nosql, table, gremlin (maybe).

* Update cosmos client to fix bug.
Clients continuously generate after changing RBAC setting.

* Swapping back to default endpoint value.

* Rebase on client refresh bug fix.

* Enable region selection for NoSql, Table, Gremlin

* Add logic to reset regional endpoint when global is selected.

* Fix state changing when selecting region or resetting to global.

* Rough implementation of configuring regional endpoint when DE is loaded in portal or hosted with AAD/Entra auth.

* Ininitial attempt at adding error handling, but still having issues with errors caught at proxy plugin.

* Added rough error handling in local requestPlugin used in local environments.  Passes new error to calling code.
Might need to add specific error handling for request plugin to the handleError class.

* Change how request plugin returns error so existing error handling utility can process and present error.

* Only enable region selection for nosql accounts.

* Limit region selection to portal and hosted AAD auth.  SQL accounts only.  Could possibly enable on table and gremlin later.

* Update error handling to account for generic error code.

* Refactor error code extraction.

* Update test snapshots and remove unneeded logging.

* Change error handling to use only the message rather than casting to any.

* Clean up debug logging in cosmos client.

* Remove unused storage keys.

* Use endpoint instead of region name to track selected region.  Prevents having to do endpoint lookups.

* Add initial button state update depending on region selection.
Need to update with the API and react to user context changes.

* Disable CRUD buttons when read region selected.

* Default to write enabled in react.

* Disable query saving when read region is selected.

* Patch clientWidth error on conflicts tab.

* Resolve merge conflicts from rebase.

* Make sure proxy endpoints return in all cases.

* Remove excess client logging and match main for ConflictsTab.

* Cleaning up logging and fixing endpoint discovery bug.

* Fix formatting.

* Reformatting if statements with preferred formatting.

* Migrate region selection to local persistence.  Fixes account swapping bug.
TODO: Inspect better way to reset interface elements when deleteAllStates is called.  Need to react to regional endpoint being reset.

* Relocate resetting interface context to helper function.

* Remove legacy state storage for regional endpoint selection.

* Laurent suggestion updates.
2025-04-07 09:29:11 -07:00
sunghyunkang1111
af0a890516 Pk missing fix (#2094)
* fix partition key missing not being able to load the document

* Implement E2E tests for documents with different partitionkeys

* Implement E2E tests for documents with different partitionkeys

* Implement E2E tests for documents with different partitionkeys

* Updated snapshot
2025-04-07 10:45:29 -05:00
bogercraig
e3c3a8b1b7 Hide Keys and Connection Strings in Connect Tab (#2095)
* Hide connection strings and keys by default.  Move URI above pivot since common across tabs.  Matches frontend.  Need to add scrolling of keys when window is small.  Possibly reduce URI width.

* Add vertical scrolling when window size reduces.

* Adding missing semicolon at end of connection strings.
2025-04-03 17:19:28 -07:00
sunghyunkang1111
0f6c979268 Update cleanupDBs.js (#2093) 2025-04-03 11:10:40 -05:00
asier-isayas
32576f50d3 Self Serve text render fix (#2088)
* debug

* added comment

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2025-03-27 14:17:06 -04:00
sunghyunkang1111
10f5a5fbfe Revert "fix partition key missing not being able to load the document (#2085)" (#2090)
This reverts commit 257256f915.
2025-03-27 12:47:14 -05:00
JustinKol
8eb53674dc Add refresh button to Mongo DB RU and adjust ellipsis so refresh button on single column container doesn't hide it (#2089)
* Moved ellipsis to the left for single column containers

* Added refresh to MongoDB RU

* prettier run
2025-03-27 13:44:22 -04:00
sunghyunkang1111
257256f915 fix partition key missing not being able to load the document (#2085) 2025-03-26 11:26:47 -05:00
jawelton74
41f5401016 Fix input validation patterns for resource ids (#2086)
* Fix input element pattern matching and add validation reporting for
cases where the element is not within a form element.

* Update test snapshots.

* Remove old code and fix trigger error message.

* Move id validation to a util class.

* Add unit tests, fix standalone function, rename constants.
2025-03-26 07:10:47 -07:00
Laurent Nguyen
a4c9a47d4e Add comments for expired token used in test (#2084) 2025-03-26 09:00:55 +01:00
JustinKol
c43132d5c0 Adding container item refresh button back to upper right corner of page (#2083)
* Moved button to upper right

* Reverted background color

* Updated test snapshot

* Added hidding refresh button on overflow

* Ran prettier and updated snapshot
2025-03-25 08:16:39 -04:00
tarazou9
6ce81099ef Handle catalog empty (#2082)
Handle UI errors caused by Catalog API calls returning no offering id.
2025-03-21 16:15:48 -04:00
Nishtha Ahuja
777e411f4f edited screenshot for vcore quickstart shell (#2080)
Co-authored-by: nishthaAhujaa <nishtha17354@iiittd.ac.in>
2025-03-20 21:55:03 +05:30
Laurent Nguyen
63d4b4f4ef fix tab wrapping with a lil' css tweak (#2013) (#2076)
Co-authored-by: Ashley Stanton-Nurse <ashleyst@microsoft.com>
2025-03-17 11:51:59 +01:00
asier-isayas
eaf9a14e7d Cancel Phoenix container allocation on ctrl+c & ctrl+z (#2055)
* Cancel Phoenix container allocation on ctrl+c

* revert package-lock

* fix build issues

* add ctrl+z

* Close terminal when Ctrl key is pressed

* format

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2025-03-13 14:56:11 -04:00
SATYA SB
4b65760a1d [accessibility-3554312-3560235]:[Screen reader - Cosmos DB Query Copilot - Query Faster with Copilot>Enable Query Advisor]: Screen reader does not announce the associated text information when focus lands on the 'Like/Dislike' button. (#2067)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2025-03-11 12:31:51 +05:30
SATYA SB
ced2725476 Enhance accessibility and focus styles for Notification Console component (#2066)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2025-03-11 12:28:44 +05:30
asier-isayas
b5d7423849 Set default RU throughput for Production workload accounts to be 10k (#2070)
* assign default throughput based on workload type

* combined common logic

* fix unit tests

* add tests

* update tests

* npm run format

* Set default RU throughput for Production workload accounts to be 10k

* remove unused method

* refactor

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2025-03-10 11:35:17 -04:00
Laurent Nguyen
1529303107 Fabric native: use SDK not ARM for update offers/collections. Enable Delete Container context menu item in resource tree (#2069)
* For all control plane operations, do not use ARM for Fabric. Enable "delete container" for fabric native.

* Fix unit test

* Fix tre note tests with proper fabric config. Add new fabric non-readonly test.
2025-03-07 07:10:45 +01:00
Laurent Nguyen
083bccfda9 Prepare for Fabric native (#2050)
* Implement fabric native path

* Fix default values to work with current fabric clients

* Fix Fabric native mode

* Fix unit test

* export Fabric context

* Dynamically close Home tab for Mirrored databases in Fabric rather than conditional init (which doesn't work for Native)

* For Fabric native, don't show "Delete Database" in context menu and reading databases should return the database from the context.

* Update to V3 messaging

* For data plane operations, skip ARM for Fabric native. Refine the tests for fabric to make the distinction between mirrored key, mirrored AAD and native. Fix FabricUtil to strict compile.

* Add support for refreshing access tokens

* Buf fix: don't wait for refresh is async

* Fix format

* Fix strict compile issue

---------

Co-authored-by: Laurent Nguyen <languye@microsoft.com>
2025-03-06 07:30:13 +01:00
SATYA SB
14c9874e5e [accessibility-3560325]:[Programmatic access - Cosmos DB Query Copilot - Query Faster with Copilot>Enable Query Advisor]: Element's role present under 'Sample Query1' tab does not support its ARIA attributes. (#2059)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2025-02-25 13:35:59 +05:30
jawelton74
a04eaff6be Add Tables to missing api type checks for dataplane RBAC. (#2060)
* Add Tables to missing api type checks for dataplane RBAC.

* Comment out test that is broken due to invalid hook call error.
2025-02-20 08:15:53 -08:00
jawelton74
51a412e2c0 Change value of the example SelfServeType enum to match name of (#2062)
localization file.
2025-02-20 07:06:25 -08:00
SATYA SB
3fcbdf6152 [accessibility-3739790-3739677]:[Forms and Validation - Azure Cosmos DB- Data Explorer - New Vertex]: Visual Label is not defined for Key, Value and Type input fields under 'New Vertex' pane. (#2040)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2025-02-19 11:26:15 +05:30
SATYA SB
8da078579e [accessibility-3739618]:[Screen Reader - Azure Cosmos DB- Data Explorer - Graphs]: Screen Reader announces both expanded and collapsed information simultaneously for expand/collapse button in bottom notification region under 'Data Explorer' pane. (#2048)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2025-02-19 11:25:44 +05:30
vchske
4ac41031e6 Fixing SelfServeType enum to work in MPAC (#2057) 2025-02-18 09:59:51 -08:00
jawelton74
d7923db108 Add Tables as an API type that supports dataplane RBAC. (#2056) 2025-02-18 09:29:53 -08:00
SATYA SB
0170c9e1cc [accessibility-3739182]:[Visual Requirement - Azure Cosmos DB - Add Row]: Ensures the contrast between foreground and background colors meets WCAG 2 AA minimum contrast ratio thresholds. (#2054)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2025-02-14 11:53:01 +05:30
bogercraig
2730da7ab6 Backend Migration - Remove Use of Legacy Backend from DE (#2043)
* Default to new backend endpoint if the endpoint in current context does not match existing set in constants.

* Remove some env references.

* Added comments with reasoning for selecting new backend by default.

* Update comment.

* Remove all references to useNewPortalBackendEndpoint now that old backend is disabled in all environments.

* Resolve lint issues.

* Removed references to old backend from Cassandra and Mongo Apis

* fix unit tests

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2025-02-12 18:12:59 -08:00
sunghyunkang1111
de2449ee25 Adding throughput bucket settings in Data Explorer (#2044)
* Added throughput bucketing

* fix bugs

* enable/disable per autoscale selection

* Added logic

* change query bucket to group

* Updated to a tab

* Fixed unit tests

* Edit package-lock

* Compile build fix

* fix unit tests

* moving the throughput bucket flag to the client generation level
2025-02-12 13:10:07 -06:00
sunghyunkang1111
99378582ce Remove blocking await on sample database (#2047)
* Remove blocking await on sample database

* Remove compress flag to reduce bundle size

* Fix typo in webpack config comment date
2025-02-12 13:09:52 -06:00
SATYA SB
bd592d07af [accessibility-1217621]: Keyboard focus gets lost on the page which opens after activating "Data Explorer" menu item present under 'Overview' page. (#1927)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2025-02-12 11:31:30 +05:30
asier-isayas
644f5941ec Set default throughput based on account's workload type (#2021)
* assign default throughput based on workload type

* combined common logic

* fix unit tests

* add tests

* update tests

* npm run format

* Update ci.yml

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2025-02-11 17:47:55 -05:00
jawelton74
9fb006a996 Restore DisplayNPSSurvey message type enum which was removed in a prior (#2046)
change.
2025-02-11 06:58:44 -08:00
jawelton74
c2b98c3e23 Modify E2E cleanup script to use @azure/identity for AZ credentials. (#2051) 2025-02-10 08:48:26 -08:00
Nishtha Ahuja
76d49d86d4 Added emulator checks in settings pane fields (#2041)
* added emulator checks

* created macro

* conditions as const

---------

Co-authored-by: Nishtha Ahuja <nishthaahuja@microsoft.com>
2025-02-10 11:52:56 +05:30
Laurent Nguyen
7893b89bf7 Do not open first container if a tab is already open (#2045)
Co-authored-by: Laurent Nguyen <languye@microsoft.com>
2025-02-06 21:58:38 +01:00
JustinKol
5945e3cb6b Removed NPS Survey from DE since it has been moved to the Overview Blade (#2027)
* Removed NPS Survey from DE since it has been moved to the Overview Blade

* Added ExplorerBindings back

* Moved applyExplorerBindings back to original place
2025-02-05 13:30:03 -05:00
Laurent Nguyen
213d1c68fe Remove feature switch on restore tabs (#2039) 2025-02-03 17:59:00 +01:00
Nishtha Ahuja
c26f9a1ebb disabled change buttom for emulator (#2017)
Co-authored-by: Nishtha Ahuja <nishthaahuja@microsoft.com>
2025-02-03 12:39:01 +05:30
SATYA SB
bd7cd7ae8f [accessibility-3556793]: [Screen Reader- Azure Cosmos DB- Data Explorer]: The Learn more links are not descriptive present under the settings. (#2035)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2025-01-31 10:58:44 +05:30
SATYA SB
6504358580 [Programmatic Access - Azure Cosmos DB- Data Explorer]: Keyboard focus indicator is not visible on controls inside the settings. (#2016)
* [accessibility-3556824] : [Programmatic Access - Azure Cosmos DB- Data Explorer]: Keyboard focus indicator is not visible on controls inside the settings.

* Snapshots updated.

---------

Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2025-01-31 10:53:18 +05:30
SATYA SB
ce88659fca [Keyboard Navigation - Cosmos DB Query Copilot - Query Faster with Copilot>Enable Query Advisor]: Keyboard focus order is not logical after selecting the 'Copy code' button. (#2010)
* [accessibility-3560073]: [Keyboard Navigation - Cosmos DB Query Copilot - Query Faster with Copilot>Enable Query Advisor]: Keyboard focus order is not logical after selecting the 'Copy code' button.

* [Keyboard Navigation - Cosmos DB Query Copilot - Query Faster with Copilot>Enable Query Advisor]: Keyboard focus order is not logical after selecting the 'Copy code' button.

---------

Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2025-01-31 10:48:34 +05:30
SATYA SB
642c708e9c [accessibility-3556756]: [Programmatic Access- Azure Cosmos DB- Data explorer]: Ensures <img> elements have alternate text or a role of none or presentation. (#2007)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2025-01-31 10:45:49 +05:30
SATYA SB
4156009d09 [Screen reader - Cosmos DB Query Copilot - Query Faster with Copilot>Enable Query Advisor]: Screen reader does not announce status information which appears on invoking the 'Send' button. (#2002)
* [accessibility-3549715]: [Screen reader - Cosmos DB Query Copilot - Query Faster with Copilot>Enable Query Advisor]: Screen reader does not announce status information which appears on invoking the 'Send' button.

* [accessibility-3549715]:[Screen reader - Cosmos DB Query Copilot - Query Faster with Copilot>Enable Query Advisor]: Screen reader does not announce status information which appears on invoking the 'Send' button.

---------

Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2025-01-31 10:44:32 +05:30
SATYA SB
5c6abbd635 [accessibility-3556595]: [Programmatic Access- Azure Cosmos DB- Data Explorer]: Ensures role attribute has an appropriate value for the element. (#2001)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2025-01-31 10:37:11 +05:30
jawelton74
881726e9af New preview site (#2036)
* Changes to DE preview site to support managed identity. Changes to
infrastructure to use new preview site.

* Fix formatting.

* Potential fix for code scanning alert no. 56: Server-side request forgery

Co-authored-by: Copilot Autofix powered by AI <62310815+github-advanced-security[bot]@users.noreply.github.com>

* Use different secrets for subscription/tenant/client id's.

* Revert new id names.

* Update Az CLI config.

* Update to Node 18 and update security vulnerable dependencies.

---------

Co-authored-by: Copilot Autofix powered by AI <62310815+github-advanced-security[bot]@users.noreply.github.com>
2025-01-30 16:14:03 -08:00
jawelton74
7015590d1a Remove hard coded client and subscription Ids from webpack config. (#2033) 2025-01-24 07:23:33 -08:00
jawelton74
1d952a4ea2 Remove throughput survey text and link from Throughput tab. (#2031) 2025-01-21 10:53:47 -08:00
jawelton74
2a81551a60 Use unique names in upload artifacts tasks (#2030)
* Specify actual package names in upload artifacts task.

* Revert path change, use unique names for upload task.

* Fix the right properties.

* Revert condition change
2025-01-21 07:07:53 -08:00
jawelton74
eceee36913 Use azure identity package for e2e test credentials (#2032)
* Update identity package, remove ms-rest-nodeauth package.

* Test changes to use identity package.
2025-01-21 07:07:18 -08:00
jawelton74
96faf92c12 Use dotnet CLI for nuget operations in CI pipeline (#2026)
* Start of moving nuget actions to use dotnet.

* Comment out env section

* Set auth token.

* Disable globalization support.

* Comment out dotnet setup.

* Copy proj file with build.

* PLace Content item under ItemGroup.

* Update project with Sdk and No Build args.

* Remove no-build from cmd line.

* Set TargetFramework version.

* Fix TargetFramework value.

* Add nuget push command.

* Fix test version string

* Add nuget add source step.

* Fix add source args.

* Enable cleartext password, remove source after completion.

* Use wildcard for nupkg path. Add debug.

* Remove debug.

* Fix nupkg path

* Fix API key argument

* Re-enable MPAC nuget. Tidy up ci.yml.

* Fix formatting of webpack config.

* Remove Globalization flag.

* Revert test changes.
2025-01-15 11:37:30 -08:00
jawelton74
2fdb3df4ae Update to Nuget setup action v2. (#2024) 2025-01-10 17:32:12 -08:00
bogercraig
7c9802c07d Settings Menu Client Refresh Bug Fix, Limit Client Options in APIs (#2023)
* Reset hasDataPlaneRbacSettingChanged back to false after cosmos client is refreshed with new settings.
Dispose of old client before new one is created.

* Update client refresh variable after settings change.

* Only refresh client when related settings are changed.

* Update comparisons in settings menu.

* Remove unnecessary comments.

* Update refresh variable naming.

* Attempting to sync package.json and package-lock.json in CI.

* Remove npm install from CI after successful CI run.

* Only show retry settings with those APIs using the cosmos client -> NoSQL, Table, Gremlin
2025-01-10 12:42:03 -08:00
jawelton74
e5609bd91e Update Playwright to latest and rename MongoProxy development endpoint constant (#2022)
* Rename MongoProxy development endpoint constant to be consistent with other
endpoints.

* Update Playwright version to latest release due to test setup break.
2025-01-08 07:56:04 -08:00
jawelton74
4b75e86b74 Remove Network Warning banner from Data Explorer. (#2019) 2024-12-12 15:44:28 -08:00
SATYA SB
abf061089d [accessibility-3102896]: [Keyboard Navigation - Azure CosmosDB - Data Explorer]: "Learn more" link is not accessible using keyboard present inside the tooltip of "Analytical store’. (#1989)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2024-12-10 10:14:19 +05:30
Laurent Nguyen
ec25586a6e Close all tabs and always load first container when initializing Fabric (#2014)
Co-authored-by: Laurent Nguyen <languye@microsoft.com>
2024-12-06 17:14:37 +01:00
tarazou9
c15d1432b2 Fix the filter for getting offering id (#2015)
Fix offering id filter
2024-12-05 13:04:46 -05:00
Laurent Nguyen
73d2686025 Restore open collection tabs: Query, Documents, Settings (#2004)
* Persist query multiple query texts

* Save multiple query tab histories

* Save and restore states for QueryTab and DocumentsTab for SQL and Mongo

* Enable Collection Scale/Settings restore

* Persist documents tab current filter

* Fix DocumentsTab conflict resolve mistake

* Remove unused variable

* Fix e2e test

* Fix e2e localStorage reference

* Try clearing local storage via playwright page

* Clear local storage after opening page

* Move restore flag behind feature flag. Whitelist restorable tabs in for Fabric. Restore e2e tests.

* Fix typo

* Fix: avoid setting undefined for preferredSize for the <Allotment.Pane>

* Add comments

* Move restore tabs after knockout configure step from Explorer constructor (which could be called multiple times)
2024-11-28 11:18:55 +01:00
vchske
80b926214b Vector Embedding and Full Text Search (#2009)
* Replaced monaco editor on Container Vector Policy tab with controls same as on create container ux

* Adds vector embedding policy to container management. Adds FullTextSearch to both add container and container management.

* Fixing unit tests and formatting issues

* More fixes

* Updating full text controls based on feedback

* Minor updates

* Editing test to fix compile issue

* Minor fix

* Adding paths for jest to ignore transform due to recent changes in upstream dependencies

* Adding mock to temporarily get unit tests to pass

* Hiding FTS feature behind the new EnableNoSQLFullTextSearch capability
2024-11-18 12:49:27 -08:00
Laurent Nguyen
070b7a4ca7 Remove unnecessary padding for Fabric (#2005)
Co-authored-by: Laurent Nguyen <languye@microsoft.com>
2024-11-13 09:52:51 +01:00
jawelton74
d61ff5dcb5 Update upload/download-artifact actions to v4 due to v3 deprecation. (#2006) 2024-11-11 11:17:48 -08:00
Laurent Nguyen
d42eebaa5a Improve DocumentsTab filter input (#1998)
* Rework Input and dropdown in DocumentsTab

* Improve input: implement Escape and add clear button

* Undo body :focus outline, since fluent UI has a nicer focus style

* Close dropdown if last element is tabbed

* Fix unit tests

* Fix theme and remove autocomplete

* Load theme inside rendering function to fix using correct colors

* Remove commented code

* Add aria-label to clear filter button

* Fix format

* Fix keyboard navigation with tab and arrow up/down. Clear button becomes down button.

---------

Co-authored-by: Laurent Nguyen <languye@microsoft.com>
2024-11-01 16:59:26 +01:00
Ashley Stanton-Nurse
056be2a74d add more edge cases to Query Error parser (#2003) 2024-10-30 08:43:18 -07:00
jawelton74
b93c90e7d1 Update query advisor privacy statement and link (#2000)
* Update query advisor privacy details.

* Update test snapshot.
2024-10-29 10:56:04 -07:00
Laurent Nguyen
82de81f2b6 Fix row selection issue in DocumentsTab when sorting rows (#1997)
* Fix bug clicking on item highlights wrong row. Remove unused prop.

* Fix clicking on table row on sorted rows and multi-select using ctrl

* Update test snaphosts

* Remove unnecessary setTimeout
2024-10-25 12:08:55 +02:00
Ashley Stanton-Nurse
236f075cf6 fix layout issues in fabric (#1996) 2024-10-24 09:59:03 -07:00
bogercraig
d478af3869 Correct spelling of CreateDocumen to CreateDocuments (#1995) 2024-10-22 14:23:07 -07:00
Laurent Nguyen
93c1fdc238 Revert "Persist and restore query text, tab position and splitter direction in QueryTabComponent (#1993)" (#1994)
This reverts commit d562fc0f40.
2024-10-22 19:03:10 +02:00
Laurent Nguyen
d562fc0f40 Persist and restore query text, tab position and splitter direction in QueryTabComponent (#1993)
* Save query text, tab splitter direction and position in QueryTabComponent

* Fix unit tests
2024-10-22 14:31:09 +02:00
bogercraig
808faa9fa5 CP and MP API Overrides from Config.json (#1992)
* Force useMongoProxyEndpoint to always return true if valid endpoint provided.  Enables new Mongo proxy in all environments.

* Checking MP endpoint in config context.

* Enabling cassandra proxy in all environments.  Requires later cleanup.

* Simplifying and removing endpoint validation since run when config context is generated.

* Enabling one MP API at a time globally.

* Revent to existing CP selection logic.

* Creating list of globally enable CP apis.

* Add list of mongo and cassandra APIs to config and only enable if environment outside existing list of environments.

* Remove environment checks.  If API globally enabled, return true.

* Adding config initialization for mongo unit tests.

* Default to empty enable list to minimize possible impact.  Config.json overrides can be used for testing.
2024-10-17 13:41:22 -07:00
Vsevolod Kukol
c1bc11d27d Support multi-tenant switching for Data Plane RBAC (#1988)
* Fix API endpoint for CassandraProxy query API

* activate Mongo Proxy and Cassandra Proxy in Prod

* Add CP Prod endpoint

* Run npm format and tests

* Revert code

* fix bug that blocked local mongo proxy and cassandra proxy development

* Add prod endpoint

* fix pr check tests

* Remove prod

* Remove prod endpoint

* Remove dev endpoint

* Support data plane RBAC

* Support data plane RBAC

* Add additional changes for Portal RBAC functionality

* Remove unnecessary code

* Remove unnecessary code

* Add code to fix VCoreMongo/PG bug

* Address feedback

* Add more logs for RBAC feature

* Add more logs for RBAC features

* Add AAD endpoints for all environments

* Add AAD endpoints

* Run npm format

* Support multi-tenant switching for Data Plane RBAC

* Remove tenantID duplicates

---------

Co-authored-by: Senthamil Sindhu <sindhuba@microsoft.com>
Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-10-10 07:36:19 -07:00
sindhuba
ac2e2a6f8e Add tenantId info in Data Explorer while opening from Portal (#1987)
* Fix API endpoint for CassandraProxy query API

* activate Mongo Proxy and Cassandra Proxy in Prod

* Add CP Prod endpoint

* Run npm format and tests

* Revert code

* fix bug that blocked local mongo proxy and cassandra proxy development

* Add prod endpoint

* fix pr check tests

* Remove prod

* Remove prod endpoint

* Remove dev endpoint

* Support data plane RBAC

* Support data plane RBAC

* Add additional changes for Portal RBAC functionality

* Remove unnecessary code

* Remove unnecessary code

* Add code to fix VCoreMongo/PG bug

* Address feedback

* Add more logs for RBAC feature

* Add more logs for RBAC features

* Add AAD endpoints for all environments

* Add AAD endpoints

* Run npm format

* Support multi-tenant switching for Data plane RBAC

* Run npm format

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-10-09 15:41:58 -07:00
Laurent Nguyen
3138580eae Move column selection out of mpac (#1980) 2024-10-09 14:23:31 +02:00
SATYA SB
aa88815c6e [Keyboard Navigation - Azure Cosmos DB - Data Explorer]: Keyboard focus is not retaining back to 'more' button after closing 'Delete container' dialog. (#1978)
* [accessibility-2262594]: [Keyboard Navigation - Azure Cosmos DB - Data Explorer]: Keyboard focus is not retaining back to 'more' button after closing 'Delete container' dialog.

* Optimize closeSidePanel: add timeout cleanup to prevent memory leaks and ensure proper focus behavior

---------

Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2024-10-07 09:09:23 +05:30
Vsevolod Kukol
5a2f78b51e Improve Entra ID token acquisition logic (#1940)
* Add a silent parameter to acquireTokenWithMsal

If true, the function won't retry to sign in using a Popup if silent token acquisition fails.

* Improve Login for Entra ID RBAC button logic

Try to reuse an existing signed-in MSAL account to get the AAD token
and fall back to full sign-in otherwise.

Also move the logic to AuthorizationUtils

* Try to acquire an Entra ID token silently on startup.

When running in Portal MSAL should be able to reuse the
MSAL account from Portal and allow us to silently get
the RBAC token. If it fails we'll show the Login for Entry ID RBAC
button as usual.

* Small code improvements

* Remove the RBAC notice from settings pane
and try to acquire RBAC token silently after enabling RBAC.

* Use msal.ssoSilent with an optional login hint
to avoid more sign-in popups.
msal.loginPopup will be used as a backup option if ssoSilent fails.
Ideally the parent environment (Portal/Fabric) should send
a loginHint with the username of the currently signed in user that
can be passed to the token acquisition flow.

* Improve RBAC error wording, clarifying where to find the Login button.
2024-10-04 08:45:29 +02:00
bogercraig
fbc2e1335b Pull Additional Allowed Cassandra and Mongo Proxy Endpoints from Deployed Config (#1984)
* Updating to take default cassandra proxy endpoints from external config.json.

* Updating allow list for mongo proxy endpoints.
2024-10-02 14:05:21 -07:00
SATYA SB
eb0d7b71b3 [accessibility-3100029]:[Screen Reader - Azure Cosmos DB - Add Table Row]: Descriptive Label is not provided for 'Value' edit fields under 'Add Table Row' pane. (#1970)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2024-10-01 09:15:25 +05:30
Asier Isayas
261289b031 Remove legacy backend references in tests and local dev (#1983)
* remove legacy backend references in tests and local dev

* fix unit tests

* fixed bulk delete

* fix tests

* fix cosmosclient

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-09-30 14:34:37 -04:00
Asier Isayas
fae4589427 Bulk Delete API fix (#1977)
* Bulk Delete API fix

* Bulk Delete API fix

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-09-30 11:40:48 -04:00
jawelton74
cbcb7e6240 Switch E2E tests to use new accounts. (#1982) 2024-09-30 07:29:24 -07:00
jawelton74
e0b773d920 Set shared throughput default to false for New Databases (#1981)
* Introduce common function for shared throughput default and set to
false.

* Add new file.

* Adjust E2E tests to not set throughput for database create.
2024-09-27 09:59:41 -07:00
Ashley Stanton-Nurse
9ec2cea95c Ensure the "Ctrl+Alt+["/"Ctrl+Alt+]" shortcuts don't get triggered on "AltGr+8"/"AltGr+9" (#1979)
* Remove the "Ctrl+Alt+[" and "Ctrl+Alt+]" shortcuts, as they conflict on non-US keyboard layouts

* Use "BracketLeft" and "BracketRight" to re-enable shortcut for US keyboards
2024-09-25 09:15:54 -07:00
Ashley Stanton-Nurse
1a4f713a79 Clarifying copy-edit to delete database panel (#1974)
* change 'Database id' to 'Database name' in Delete Database confirm prompt

* put 'name' in a parenthetical instead of replacing 'id'

* update test snapshots
2024-09-23 11:34:49 -07:00
Laurent Nguyen
7128133874 Only show throttling warning when throttling happened. (#1976) 2024-09-23 17:30:42 +02:00
Ashley Stanton-Nurse
053dc9d76b Add config files for Codespaces (#1975) 2024-09-20 08:28:03 -07:00
Laurent Nguyen
23b2e59560 Migrate Most Recent activity local storage to App State persistence (#1967)
* Rewrite MostRecentActivity to leverage AppStatePersistenceUtility.

* Fix format. Update type enum.

* Migrate Item enum to string enum

* Fix unit tests

* Fix build issue
2024-09-20 08:26:58 +02:00
sunghyunkang1111
869d81dfbc fix partitionkey value fetching (#1972)
* fix partitionkey value fetching

* fix partitionkey value fetching

* added unit test

* Added some unit tests

* move the constant
2024-09-19 13:09:09 -05:00
Laurent Nguyen
42a1c6c319 Move table column selection out of feature flag to MPAC. (#1973) 2024-09-19 07:18:03 +02:00
Asier Isayas
9f1cc4cd5c Force Mongo and Proxy users to switch to Mongo and Cassandra Proxy (#1971)
* Force Mongo and Cassandra users to the new Proxies

* npm run format

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-09-18 13:49:09 -04:00
Asier Isayas
78154bd976 Disable Bulk Delete API (#1968)
* disable bulk delete

* disable bulk delete

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-09-13 08:36:53 -04:00
Laurent Nguyen
91649d2f52 Migrate Copilot local persistence (toggle and prompt history) to new local storage infrastructure (#1948)
* Migrate copilot persistence to AppState

* Migrate persistence of toggle and history to new infra

* Save toggle value as boolean

* Fix compile bug

* Fix unit tests
2024-09-13 12:01:14 +02:00
vchske
d7647b2ecf Fixed issue with Tables API when selecting a row with the same row key in different partition keys (#1969) 2024-09-12 16:36:22 -07:00
Ashley Stanton-Nurse
2c7e788358 Replace RU limit banner by clarifying the error when RU limit is exceeded (#1966)
* allow DE to provide clearer error messages for certain conditions

* allow rendeering a "help" link for an error

* use TableCellLayout where possible

* remove RU Threshold banner, now that we have a clearer error

* refmt

* fix QueryError test

* change "RU Threshold" to "RU Limit"
2024-09-12 11:45:10 -07:00
Laurent Nguyen
fdbbbd7378 Better handling throttling error in bulk delete (#1954)
* Implement retry on throttling for nosql

* Clean up code

* Produce specific error for throttling error in mongoProxy bulk delete. Clean up code.

* Fix throttling doc url

* Fix mongo error wording

* Fix unit test

* Unit test cleanup

* Fix format

* Fix unit tests

* Fix format

* Fix unit test

* Fix format

* Improve comments

* Improve error message wording. Fix URL and add specific URL for Mongo and NoSql.

* Fix error messages. Add console errors.

* Clean up selection of various delete fct

* Fix error display
2024-09-11 17:11:41 +02:00
Asier Isayas
82bdeff158 Add new Portal Backend Sample Data API and remove Notifications API references (#1965)
* Fixed Sample Data logic and remove notifications references

* fixed undefined

* fixed unit tests

* fixed format test

* cleanup

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-09-11 08:07:50 -04:00
Laurent Nguyen
825a5d5257 Enable column selection and sorting in DocumentsTab (with persistence) with improvements (#1963)
* Reapply "Enable column selection and sorting in DocumentsTab (with persistence) (#1881)" (#1960)

This reverts commit fe9730206e.

* Fix logic bug: always include defaultQueryFields in query.

* Show resize column option outside of feature flag

* Improve prevention of no selected columns

* Add more unit tests

* Fix styling on table

* Update test snapshots

* Remove "sortable" property on table which makes the header cell focusable (user sorts by selecting menu item, not by clicking on cell)
2024-09-11 13:26:49 +02:00
vchske
d75553a94d Removing trailing ; from resource token which is incompatible with v2 tokens (#1962)
* Removing trailing ; from resource token which is incompatible with v2 tokens

* Adding check in case resourceToken is undefined

* Fixing unit tests
2024-09-09 12:04:16 -07:00
Laurent Nguyen
50c47a82d6 Allow slashes in persistence keys (#1961)
* Allow slashes in persistence keys

* Add unit tests
2024-09-09 19:12:55 +02:00
Laurent Nguyen
2c2f0c8d7b Disable bulkdelete for users point to old mongo proxy (#1964)
* Disable bulk delete if old mongo proxy

* Bug fix

* Fix unit tests

* Fix formatting
2024-09-09 11:13:52 -04:00
SATYA SB
cfc8196c4b [accessibility-3100032]:[Programmatic Access - Azure Cosmos DB - Data Explorer]: Close button does not have discernible text under 'Data Explorer' pane. (#1949) 2024-09-06 11:56:05 +05:30
Asier Isayas
87024f4bf4 use old backend for Mongo and Cassandra accounts depending on their IP addresses (#1959)
Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-09-05 16:25:53 -04:00
Laurent Nguyen
fe9730206e Revert "Enable column selection and sorting in DocumentsTab (with persistence) (#1881)" (#1960)
This reverts commit 7e95f5d8c8.
2024-09-05 21:44:33 +02:00
Laurent Nguyen
7e95f5d8c8 Enable column selection and sorting in DocumentsTab (with persistence) (#1881)
* Initial implementation of saving split value to local storage

* Make table columns generic (no more id and partition keys)

* Save column width

* Add column selection from right-click

* Implement new menu for column selection with search.

* Switch icons and search compare with lowercase.

* Search uses string includes instead of startsWith

* Only allow data fields that can be rendered (string and numbers) in column selection

* Accumulate properties rather than replace for column definitions

* Do not allow deselecting all columns

* Move table values under its own property

* Update choices of column when creating new or updating document

* Rework column selection UI

* Fix table size issue with some heuristics

* Fix heuristic for size update

* Don't allow unselecting last column

* Implement column sorting

* Fix format

* Fix format, update snapshots

* Add reset button to column selection and fix naming of openUploadItemsPanePane()

* Fix unit tests

* Fix unit test

* Persist column selection

* Persist column sorting

* Save columns definition (schema) along with selected columns.

* Merge branch 'master' into users/languy/save-documentstab-prefs

* Revert "Merge branch 'master' into users/languy/save-documentstab-prefs"

This reverts commit e5a82fd356.

* Disable column selection for Mongo. Remove extra refresh button

* Update test snapshots

* Remove unused function

* Fix table width

* Add background color to "..." button for column selection

* Label to indicate which field is a partition key in Column Selection Pane

* Update unit test snapshot

* Move column selection and sorting behind feature flag enableDocumentsTableColumnSelection

* Cleanup checkbox styles
2024-09-05 17:43:40 +02:00
Ashley Stanton-Nurse
1be221e106 fix rendering of global commands menu (#1953)
* fix rendering of global commands menu

* refmt
2024-09-05 08:33:39 -07:00
Asier Isayas
8e7a3db67e Point DE to new Mongo and Cassandra Proxies only and activate Cassandra Proxy in FF/MC (#1958)
Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-09-05 10:57:55 -04:00
Laurent Nguyen
07c0ead523 Improve SettingsPane (#1945)
* Use accordion in settingsPane

* Fix format

* Fix format for retry interval

* Fix unit tests

* Cosmetic changes

* Move info tips into accordion section

* Update snapshot
2024-09-05 11:51:32 +02:00
Laurent Nguyen
4296b5ae02 Add more default filters (#1955) 2024-09-05 07:16:48 +02:00
Ashley Stanton-Nurse
e8a5658799 Reduce extra spacing in the new tree and items tab (#1951)
* reduce layout row size and default font size

* icons for the tree

* refmt and update snapshots

* remove commented out code
2024-09-04 13:07:27 -07:00
vchske
b4973e8367 Fixing regex on allowedParentFrameOrigins to address XSS (#1956) 2024-09-04 11:35:32 -07:00
Asier Isayas
4b207f3fa6 Show portal networking banner for new backend (#1952)
* show portal networking banner for new backend

* fixed valid endpoints

* format

* fixed tests

* Fixed tests

* fix tests

* fixed tests

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-08-29 18:42:13 -04:00
sindhuba
c5b7f599b3 Add AAD Endpoints for Data Explorer in Portal (#1943)
* Fix API endpoint for CassandraProxy query API

* activate Mongo Proxy and Cassandra Proxy in Prod

* Add CP Prod endpoint

* Run npm format and tests

* Revert code

* fix bug that blocked local mongo proxy and cassandra proxy development

* Add prod endpoint

* fix pr check tests

* Remove prod

* Remove prod endpoint

* Remove dev endpoint

* Support data plane RBAC

* Support data plane RBAC

* Add additional changes for Portal RBAC functionality

* Remove unnecessary code

* Remove unnecessary code

* Add code to fix VCoreMongo/PG bug

* Address feedback

* Add more logs for RBAC feature

* Add more logs for RBAC features

* Add AAD endpoints for all environments

* Add AAD endpoints

* Run npm format

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-08-28 09:11:21 -07:00
Asier Isayas
6aeac542b1 Runtime Proxy API (#1950)
Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-08-28 09:04:49 -04:00
Ashley Stanton-Nurse
0d22d4ab4d change default splitter orientation when the setting has not been set (#1946) 2024-08-27 14:20:34 -07:00
vchske
0658448b54 Reinstating partition key fix with added check for nested partitions (#1947)
* Reinstating empty hiearchical partition key value fix

* Added use case for nested partitions

* Fix lint issue
2024-08-26 10:00:33 -07:00
Laurent Nguyen
833d677d20 Change persistence format for column width (#1944) 2024-08-22 17:00:49 +02:00
Laurent Nguyen
038142c180 Save and restore DocumentsTab state to local storage (#1919)
* Infrastructure to save app state

* Save filters

* Replace read/save methods with more generic ones

* Make datalist for filter unique per database/container combination

* Disable saving middle split position for now

* Fix unit tests

* Turn off confusing auto-complete from input box

* Disable tabStateData for now

* Save and restore split position

* Fix replace autocomplete="off" by removing id on Input tag

* Properly set allotment width

* Fix saved percentage

* Save splitter per collection

* Add error handling and telemetry

* Fix compiling issue

* Add ability to delete filter history. Bug fix when hitting Enter on filter input box.

* Replace delete filter modal with dropdown menu

* Add code to remove oldest record if max limit is reached in app state persistence

* Only save new splitter position on drag end (not onchange)

* Add unit tests

* Add Clear all in settings. Update snapshots

* Fix format

* Remove filter delete and keep filter history to a max. Reword clear button and message in settings pane.

* Fix setting button label

* Update test snapshots

* Reword Clear history button text

* Update unit test snapshot

* Enable Settings pane for Fabric, but turn off Rbac dial for Fabric.

* Change union type to enum

* Update src/Shared/AppStatePersistenceUtility.ts

Assert that path does not include slash char.

Co-authored-by: Ashley Stanton-Nurse <ashleyst@microsoft.com>

* Update src/Shared/AppStatePersistenceUtility.ts

Assert that path does not contain slash.

Co-authored-by: Ashley Stanton-Nurse <ashleyst@microsoft.com>

* Fix format

---------

Co-authored-by: Ashley Stanton-Nurse <ashleyst@microsoft.com>
2024-08-22 07:37:15 +02:00
Ashley Stanton-Nurse
94d3fcb30f disable query error tests due to backend issue (#1942) 2024-08-21 11:30:43 -07:00
Ashley Stanton-Nurse
d3722f2c99 Improve sidebar UI layout when narrow (#1938)
* improve how the sidebar reacts to being a smol lil' guy

* fix snapshots

* shrink minimum sizes to allow small screens to work in some way
2024-08-21 09:55:57 -07:00
Laurent Nguyen
5a5e155205 Implement bulk delete documents for Mongo (#1859)
* Implement bulk delete documents for Mongo

* Fix unit test

* Adding bulkdelete to new mongo apis

* Fix error message

* Fix typo

* Improve error message wording

* Fix format

* Fix format

* Put back old delete for older container with system partition key
2024-08-21 16:59:52 +02:00
Laurent Nguyen
2226169a71 Remove database context menu if Fabric and readonly. (#1939)
Co-authored-by: Laurent Nguyen <languye@microsoft.com>
2024-08-20 16:54:58 +02:00
SATYA SB
6f35fb5526 [accessibility-2819223]:Bug 2819223: [Keyboard navigation - Cosmos DB Query Copilot - Copilot]: The suggestions of 'Copilot search' edit field are not accessible with keyboard. (#1893)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2024-08-19 10:34:49 +05:30
Ashley Stanton-Nurse
805a4ae168 Error rendering improvements (#1887) 2024-08-15 13:29:57 -07:00
Asier Isayas
cc89691da3 Activate Mongo Proxy in Prod (#1936)
* activate mongo proxy in mpac

* activate mongo proxy in mpac

* activate mongo proxy in prod

* fixed parition key unit test

* remove three part partition key value test

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-08-14 14:15:11 -04:00
sunghyunkang1111
24860a6842 revert extract partition key (#1935) 2024-08-14 02:54:20 -05:00
Asier Isayas
bf6b362610 Activate Mongo Proxy in MPAC (#1934)
* activate mongo proxy in mpac

* activate mongo proxy in mpac

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-08-13 16:34:34 -04:00
sunghyunkang1111
baca7922b4 move nps survey open dialog call to after explorer initialization (#1932) 2024-08-13 14:16:20 -05:00
Ashley Stanton-Nurse
b59ba20ed0 fix #1929 by using flex instead of grid to lay out the tabs view (#1930) 2024-08-13 11:19:24 -07:00
vchske
7f55de7aa2 Removing check for value when populating partition key values (#1928)
* Removing check for value when populating partition key values

* Removed invalid test case

* Added unit test for empty partition key value
2024-08-13 10:00:34 -07:00
SATYA SB
62c76cc264 [accessibility-2280341]:[Keyboard Navigation - Azure Cosmos DB - Graph]: Keyboard focus order is not logical after selecting any tab control. (#1854)
* [accessibility-2280341]:[Keyboard Navigation - Azure Cosmos DB - Graph]: Keyboard focus order is not logical after selecting any tab control.

* updated module structure.

---------

Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2024-08-12 11:06:35 +05:30
Ashley Stanton-Nurse
99d95a4cec swap splitter directions in query results view (#1896)
* swap splitter directions in query results view

* refmt *sigh*
2024-08-09 10:27:48 -07:00
SATYA SB
647cca09b3 [accessibility-2724013]: [Screen reader - Cosmos DB - Data Explorer -> Entities -> Add entity]: Screen reader announces incorrect role when focus lands on the "Edit" and "Delete" buttons. (#1923)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2024-08-09 21:02:10 +05:30
SATYA SB
2c5f4e9666 [accessibility-2950560}:[Programmatic Access-Try Cosmos DB-Welcome! What is Cosmos DB?]: 'Welcome! What is Cosmos DB?' is not defined programmatically as heading. (#1882)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2024-08-09 21:00:47 +05:30
Laurent Nguyen
58ae64193f Fix resource tree styling (#1926)
* Fix style for when no global command

* Fix style override expression

---------

Co-authored-by: Laurent Nguyen <languye@microsoft.com>
2024-08-09 17:00:09 +02:00
sindhuba
806a0657df Fix Login for Entra ID text (#1925)
* Fix API endpoint for CassandraProxy query API

* activate Mongo Proxy and Cassandra Proxy in Prod

* Add CP Prod endpoint

* Run npm format and tests

* Revert code

* fix bug that blocked local mongo proxy and cassandra proxy development

* Add prod endpoint

* fix pr check tests

* Remove prod

* Remove prod endpoint

* Remove dev endpoint

* Support data plane RBAC

* Support data plane RBAC

* Add additional changes for Portal RBAC functionality

* Remove unnecessary code

* Remove unnecessary code

* Add code to fix VCoreMongo/PG bug

* Address feedback

* Add more logs for RBAC feature

* Add more logs for RBAC features

* Fix login for Entra ID text

* Address comments

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-08-05 15:41:54 -07:00
Laurent Nguyen
bc479fb808 Add Word Wrap menu option to Editor React monaco context menu in Documents Tab (#1922)
* Remove "Go to Symbol..." menu option by default in monaco. Add option to toggle word wrap.

* Remove code that removes "Go to symbol" as it is not a public API

* Move WordWrap context menu item to its own section. Remove unnecessary parameters.

* Fix format
2024-08-02 17:53:00 +02:00
Ashley Stanton-Nurse
31773ee73b Redesign resource tree (#1865)
* start redesign work

* add left padding to all tree nodes

* fiddling with padding

* align tab bar line with first item in resource tree

* final touch ups

* fix a strange password manager autofill prompt

* add keyboard shortcuts

* revert testing change

* nudge messagebar to layout row height

* tidy up

* switch to Allotment to stop ResizeObserver issues with monaco

* refmt and fix lints

* fabric touch-ups

* update snapshots

* remove explicit react-icons dependency

* reinstall packages

* remove background from FluentProvider

* fix alignment of message bar

* undo temporary workaround

* restore refresh button

* fix e2e tests and reformat

* fix compiler error

* remove uiw/react-split

* uncomment selection change on expand
2024-08-01 10:02:36 -07:00
Asier Isayas
3d1f280378 Allow connection string users to add database to their Mongo serverless account (#1924)
* Allow connection string users to create databases mongo ser

* Allow connection string users to create databases for the mongo serverless accounts

* Allow connection string users to create databases for the mongo serverless accounts

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-08-01 12:29:55 -04:00
SATYA SB
2ef036ee94 [accessibility-3100032]:[Programmatic Access - Azure Cosmos DB - Data Explorer]: Close button does not have discernible text under 'Data Explorer' pane. (#1872)
* [accessibility-3100032]:[Programmatic Access - Azure Cosmos DB - Data Explorer]: Close button does not have discernible text under 'Data Explorer' pane.

* [accessibility-3100032]:[Programmatic Access - Azure Cosmos DB - Data Explorer]: Close button does not have discernible text under 'Data Explorer' pane.

---------

Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2024-07-31 20:42:19 +05:30
Laurent Nguyen
77c758714d Fix initial condition for shift/ctrl selection to work (#1908) 2024-07-31 16:52:23 +02:00
Laurent Nguyen
bcd8b7229f Upgrade typescript to 4.9.5 and jest to 29.7.0 (and related packages) (#1884)
* Upgrade typescript to 4.9.5

* Fix compile issue and put back files in tsconfig.strict.json

* Update test snapshots

* Fix jest tests by upgrading jest and other related packages.

* Attempt to fix playwright test

* Revert "Attempt to fix playwright test"

This reverts commit 8293f34c9c.

* 2nd attempt to fix example test

* fix waitFor in playwright

* Remove unused describe section

* Attempt to fix e2e test

* Revert "Attempt to fix e2e test"

This reverts commit 9745bcd2ef.

* Upgrade playwright to latest

* Revert "Upgrade playwright to latest"

This reverts commit e2ea1d0189.

* Error test on e2e

* Revert "Error test on e2e"

This reverts commit 124e3764f7.

* Try to select dropdown item by xpath selector

* Revert "Try to select dropdown item by xpath selector"

This reverts commit 8eb42a64e2.

* Attempt to wait until page is fully loaded

* Revert "Attempt to wait until page is fully loaded"

This reverts commit bb43fcea6e.

* Use playwright selectOption to select dropdown option

* Revert "Use playwright selectOption to select dropdown option"

This reverts commit daa8cd0930.

* Select dropdown option with playwright api instead of manual click

* c7ab4c7ecf7b05f32a85568bce1a667ad8c62703Revert "Select dropdown option with playwright api instead of manual click"

This reverts commit c7ab4c7ecf.

* Wait for 5s after dropdown click

* Revert "Wait for 5s after dropdown click"

This reverts commit 847e9ad33f.

* Try forcing click

* Revert "Try forcing click"

This reverts commit 29b9fa1bda.

* Force click on the dropdown and set viewport size bigger.

* Force click on the dropdown and set viewport size bigger.

* try force clicking option

* Skip container test on webkit

* Add branded browsers to e2e tests

---------

Co-authored-by: Ashley Stanton-Nurse <ashleyst@microsoft.com>
2024-07-30 15:41:41 -07:00
Nitesh Vijay
0a1d16de1b Fix vector search capability name (#1918) (#1921)
Co-authored-by: Nitesh Vijay <niteshvijay@microsoft.com>
2024-07-29 22:26:25 +05:30
Nitesh Vijay
1e6c40eabf Fix vector search capability name (#1918) 2024-07-23 07:33:24 +05:30
Nitesh Vijay
70d1dc6f74 Add vector search capability for emulator (#1917) 2024-07-20 00:02:42 +05:30
sindhuba
d07d2c7c0d Add readOnlyKeys call to support accounts with Reader role (#1916)
* Fix API endpoint for CassandraProxy query API

* activate Mongo Proxy and Cassandra Proxy in Prod

* Add CP Prod endpoint

* Run npm format and tests

* Revert code

* fix bug that blocked local mongo proxy and cassandra proxy development

* Add prod endpoint

* fix pr check tests

* Remove prod

* Remove prod endpoint

* Remove dev endpoint

* Support data plane RBAC

* Support data plane RBAC

* Add additional changes for Portal RBAC functionality

* Remove unnecessary code

* Remove unnecessary code

* Add code to fix VCoreMongo/PG bug

* Address feedback

* Add more logs for RBAC feature

* Add more logs for RBAC features

* Add readOnlyKeys call for accounts with Reader role

* Resolve conflicts

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-07-19 08:02:44 -07:00
Asier Isayas
7a1aa89cd1 Add Cassandra Shell tab (#1913)
Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-07-17 16:12:15 -04:00
sindhuba
e67c3f6774 Revert RBAC feature flag behavior (#1910)
* Fix API endpoint for CassandraProxy query API

* activate Mongo Proxy and Cassandra Proxy in Prod

* Add CP Prod endpoint

* Run npm format and tests

* Revert code

* fix bug that blocked local mongo proxy and cassandra proxy development

* Add prod endpoint

* fix pr check tests

* Remove prod

* Remove prod endpoint

* Remove dev endpoint

* Support data plane RBAC

* Support data plane RBAC

* Add additional changes for Portal RBAC functionality

* Remove unnecessary code

* Remove unnecessary code

* Add code to fix VCoreMongo/PG bug

* Address feedback

* Add more logs for RBAC feature

* Add more logs for RBAC features

* Revert enableAADDataPlane feature flag behavior

* Address feedback

* Address comment

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-07-17 10:12:36 -07:00
Laurent Nguyen
bd334a118a Prevent tabsManagerContainer width to grow beyond parent's width (#1911) 2024-07-17 17:30:12 +02:00
sindhuba
5871c1e2d0 Add more logs for RBAC (#1906)
* Fix API endpoint for CassandraProxy query API

* activate Mongo Proxy and Cassandra Proxy in Prod

* Add CP Prod endpoint

* Run npm format and tests

* Revert code

* fix bug that blocked local mongo proxy and cassandra proxy development

* Add prod endpoint

* fix pr check tests

* Remove prod

* Remove prod endpoint

* Remove dev endpoint

* Support data plane RBAC

* Support data plane RBAC

* Add additional changes for Portal RBAC functionality

* Remove unnecessary code

* Remove unnecessary code

* Add code to fix VCoreMongo/PG bug

* Address feedback

* Add more logs for RBAC feature

* Add more logs for RBAC features

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-07-10 10:16:05 -07:00
sindhuba
81dccbe5be Fix vCoreMongo/PostGres quickstart bug (#1903)
* Fix API endpoint for CassandraProxy query API

* activate Mongo Proxy and Cassandra Proxy in Prod

* Add CP Prod endpoint

* Run npm format and tests

* Revert code

* fix bug that blocked local mongo proxy and cassandra proxy development

* Add prod endpoint

* fix pr check tests

* Remove prod

* Remove prod endpoint

* Remove dev endpoint

* Support data plane RBAC

* Support data plane RBAC

* Add additional changes for Portal RBAC functionality

* Remove unnecessary code

* Remove unnecessary code

* Add code to fix VCoreMongo/PG bug

* Address feedback

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-07-09 10:58:13 -07:00
vchske
49c3d0f0cb Reorder Asier's commits in order to deploy CRI fixes (#1905)
* Set AllowPartialScopes flag to true (#1900)

* add partial scopes flag

* add partial scopes flag

* add partial scopes flag

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>

* Adding CRI fixes to pre RBAC commit (#1902)

Co-authored-by: Asier Isayas <aisayas@microsoft.com>

* Add Data Plane RBAC functionality (#1878)

* Fix API endpoint for CassandraProxy query API

* activate Mongo Proxy and Cassandra Proxy in Prod

* Add CP Prod endpoint

* Run npm format and tests

* Revert code

* fix bug that blocked local mongo proxy and cassandra proxy development

* Add prod endpoint

* fix pr check tests

* Remove prod

* Remove prod endpoint

* Remove dev endpoint

* Support data plane RBAC

* Support data plane RBAC

* Add additional changes for Portal RBAC functionality

* Address errors and checks

* Cleanup DP RBAC code

* Run format

* Fix unit tests

* Remove unnecessary code

* Run npm format

* Fix enableAadDataPlane feature flag behavior

* Fix  enable AAD dataplane feature flag behavior

* Address feedback comments

* Minor fix

* Add new fixes

* Fix Tables test

* Run npm format

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>

* Fix LMS regression when using old backend (#1890)

Co-authored-by: Asier Isayas <aisayas@microsoft.com>

* Address RBAC local storage default setting issue (#1892)

* Fix API endpoint for CassandraProxy query API

* activate Mongo Proxy and Cassandra Proxy in Prod

* Add CP Prod endpoint

* Run npm format and tests

* Revert code

* fix bug that blocked local mongo proxy and cassandra proxy development

* Add prod endpoint

* fix pr check tests

* Remove prod

* Remove prod endpoint

* Remove dev endpoint

* Support data plane RBAC

* Support data plane RBAC

* Add additional changes for Portal RBAC functionality

* Address errors and checks

* Cleanup DP RBAC code

* Run format

* Fix unit tests

* Remove unnecessary code

* Run npm format

* Fix enableAadDataPlane feature flag behavior

* Fix  enable AAD dataplane feature flag behavior

* Address feedback comments

* Minor fix

* Add new fixes

* Fix Tables test

* Run npm format

* Address Local storage default setting issue

* Run npm format

* Address lint error

* Run format

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>

* Fix bug in viewing tables account databases (#1899)

* Fix API endpoint for CassandraProxy query API

* activate Mongo Proxy and Cassandra Proxy in Prod

* Add CP Prod endpoint

* Run npm format and tests

* Revert code

* fix bug that blocked local mongo proxy and cassandra proxy development

* Add prod endpoint

* fix pr check tests

* Remove prod

* Remove prod endpoint

* Remove dev endpoint

* Support data plane RBAC

* Support data plane RBAC

* Add additional changes for Portal RBAC functionality

* Address errors and checks

* Cleanup DP RBAC code

* Run format

* Fix unit tests

* Remove unnecessary code

* Run npm format

* Fix enableAadDataPlane feature flag behavior

* Fix  enable AAD dataplane feature flag behavior

* Address feedback comments

* Minor fix

* Add new fixes

* Fix Tables test

* Run npm format

* Address Local storage default setting issue

* Run npm format

* Address lint error

* Run format

* Address bug in fetching data for Tables Account

* Add fetchAndUpdate Keys

* Add fix for MPAC Tables account issue

* Fix issue with Cosmos Client

* Run np format

* Address bugs

* Remove unused import

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>

---------

Co-authored-by: Asier Isayas <asier.isayas@gmail.com>
Co-authored-by: Asier Isayas <aisayas@microsoft.com>
Co-authored-by: sindhuba <122321535+sindhuba@users.noreply.github.com>
2024-07-09 12:27:57 -04:00
Asier Isayas
375bb5f567 Adding CRI fixes to pre RBAC commit (#1902)
Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-07-08 17:27:34 -04:00
Asier Isayas
e9f83a8efd Set AllowPartialScopes flag to true (#1900)
* add partial scopes flag

* add partial scopes flag

* add partial scopes flag

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-07-08 16:30:14 -04:00
sindhuba
093ddba2db Fix bug in viewing tables account databases (#1899)
* Fix API endpoint for CassandraProxy query API

* activate Mongo Proxy and Cassandra Proxy in Prod

* Add CP Prod endpoint

* Run npm format and tests

* Revert code

* fix bug that blocked local mongo proxy and cassandra proxy development

* Add prod endpoint

* fix pr check tests

* Remove prod

* Remove prod endpoint

* Remove dev endpoint

* Support data plane RBAC

* Support data plane RBAC

* Add additional changes for Portal RBAC functionality

* Address errors and checks

* Cleanup DP RBAC code

* Run format

* Fix unit tests

* Remove unnecessary code

* Run npm format

* Fix enableAadDataPlane feature flag behavior

* Fix  enable AAD dataplane feature flag behavior

* Address feedback comments

* Minor fix

* Add new fixes

* Fix Tables test

* Run npm format

* Address Local storage default setting issue

* Run npm format

* Address lint error

* Run format

* Address bug in fetching data for Tables Account

* Add fetchAndUpdate Keys

* Add fix for MPAC Tables account issue

* Fix issue with Cosmos Client

* Run np format

* Address bugs

* Remove unused import

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-07-08 08:48:22 -07:00
sindhuba
dfe79b20f5 Address RBAC local storage default setting issue (#1892)
* Fix API endpoint for CassandraProxy query API

* activate Mongo Proxy and Cassandra Proxy in Prod

* Add CP Prod endpoint

* Run npm format and tests

* Revert code

* fix bug that blocked local mongo proxy and cassandra proxy development

* Add prod endpoint

* fix pr check tests

* Remove prod

* Remove prod endpoint

* Remove dev endpoint

* Support data plane RBAC

* Support data plane RBAC

* Add additional changes for Portal RBAC functionality

* Address errors and checks

* Cleanup DP RBAC code

* Run format

* Fix unit tests

* Remove unnecessary code

* Run npm format

* Fix enableAadDataPlane feature flag behavior

* Fix  enable AAD dataplane feature flag behavior

* Address feedback comments

* Minor fix

* Add new fixes

* Fix Tables test

* Run npm format

* Address Local storage default setting issue

* Run npm format

* Address lint error

* Run format

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-07-01 16:58:05 -07:00
Asier Isayas
1021e9c969 Fix LMS regression when using old backend (#1890)
Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-07-01 12:40:07 -04:00
sindhuba
c30a9681fe Add Data Plane RBAC functionality (#1878)
* Fix API endpoint for CassandraProxy query API

* activate Mongo Proxy and Cassandra Proxy in Prod

* Add CP Prod endpoint

* Run npm format and tests

* Revert code

* fix bug that blocked local mongo proxy and cassandra proxy development

* Add prod endpoint

* fix pr check tests

* Remove prod

* Remove prod endpoint

* Remove dev endpoint

* Support data plane RBAC

* Support data plane RBAC

* Add additional changes for Portal RBAC functionality

* Address errors and checks

* Cleanup DP RBAC code

* Run format

* Fix unit tests

* Remove unnecessary code

* Run npm format

* Fix enableAadDataPlane feature flag behavior

* Fix  enable AAD dataplane feature flag behavior

* Address feedback comments

* Minor fix

* Add new fixes

* Fix Tables test

* Run npm format

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-07-01 09:33:07 -07:00
Asier Isayas
17754cba05 Revert to old Mongo Proxy (#1886)
* revert to old mongo proxy

* revert to old mongo proxy

* cleanup

* cleanup

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-06-27 11:40:05 -07:00
Asier Isayas
b07fa89a23 fix legacy mongo shell regression (#1883)
Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-06-26 14:33:57 -04:00
sunghyunkang1111
28db549fa1 pagination loading of subscription and databaseaccounts (#1877) 2024-06-21 14:28:00 -05:00
Laurent Nguyen
fe892dcc62 Temporarily disable bulk Delete for old non-partitioned NoSQL containers (#1880)
* Disable Delete button and document selection when partitionKey.systemKey = true for noSql.

* Update unit tests

* Always show delete button. Use single delete API for systemKey containers
2024-06-21 09:37:34 +02:00
Asier Isayas
380caba5f5 Cassandra: Delete a row for a table that has multiple partition keys (#1879)
* Delete a row with multiple parition keys

* clean up

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-06-20 12:55:14 -04:00
sunghyunkang1111
62ab0e3e60 Fix codeql issues (#1875) 2024-06-19 10:12:38 -05:00
SATYA SB
d199311633 Ensures ARIA attributes are allowed for an element's role. (#1846)
* [accessibility-3048277]:[Programmatic Access - Azure Cosmos DB - Data Explorer>New Container]: Ensures ARIA attributes are allowed for an element's role

* updated PartitionKeyPane

---------

Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2024-06-19 16:02:09 +05:30
sunghyunkang1111
bf225f91c4 Remove notification for sample collection loading (#1874) 2024-06-18 12:15:06 -05:00
jawelton74
4d0b1a6db8 Switch accountrestrictions call to use new backend in MPAC. (#1868) 2024-06-18 09:41:24 -07:00
SATYA SB
e66c8a1b5c [accessibility-1249101]:[Usable - Azure Cosmos DB - New Keyspace]: Link "capacity calculator" overlaps with the keyboard focus indicator boundary and not visible properly. (#1866)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2024-06-13 17:23:19 +05:30
SATYA SB
7e1a738f8e [accessibility-2819505]:[Programmatic access - Cosmos DB Query Copilot - Copilot]: "Read preview terms" link does not meet minimum contrast ratio 3:1 with the surrounding text. (#1858)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2024-06-13 17:21:49 +05:30
SATYA SB
dabb91e9e9 [accessibility-3101316]:[Programmatic Access - Azure Cosmos DB - Data Explorer]: 'Recents', 'Top 3 things you need to know' and 'Learning Resources' text appears as a heading but is not defined programmatically under 'Data Explorer' pane. (#1845)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2024-06-13 17:20:59 +05:30
sunghyunkang1111
7570d6b91d handle sampledb error handling to load the data explorer (#1870) 2024-06-12 20:46:22 -07:00
jawelton74
b8d6a0188a Add more details to the E2E Test README. Configure dev/test to use MPAC (#1869)
instances of the new backend services.
2024-06-12 12:32:48 -07:00
tarazou9
8c25742304 Update UPAPI for Dedicated Gateway in Self Serve Portal (#1825)
Update UPAPI for Dedicated Gateway in Self Serve Portal
2024-06-11 16:01:46 -04:00
Laurent Nguyen
1ba3a6c761 Tabs container now adapts its size with flex (#1867) 2024-06-11 17:17:45 +02:00
sunghyunkang1111
c680481fe0 Add form and validation for vector search (#1856)
* Add form and validation for vector search

* Add form and validation for vector search

* Add unit tests and merge forms
2024-06-10 13:37:51 -05:00
Laurent Nguyen
06d4829422 Fix click to show document issue. Table doesn't auto-select first document anymore. (#1864) 2024-06-07 16:28:08 +02:00
Ashley Stanton-Nurse
416743c548 stop tree nodes from expanding to full height, causing overlap (#1861) 2024-06-06 09:33:25 -07:00
Ashley Stanton-Nurse
b5d4509d49 fix a broken test snapshot (#1863) 2024-06-05 13:40:51 -07:00
Ashley Stanton-Nurse
417ef899f0 Update Playwright, improve E2E test reliability, add scripts to deploy test resources (#1857) 2024-06-05 12:46:32 -07:00
Ashley Stanton-Nurse
736731474f show an expand icon for nodes with non-null children arrray (#1862) 2024-06-05 12:27:29 -07:00
Ashley Stanton-Nurse
9b12775151 Allow query result view to be toggled from command bar (#1833)
* allow query result view to be toggled from command bar

also provides a default results view option that's stored in the
browser's local storage

* update SettingsPane test snapshot
2024-06-05 12:16:28 -07:00
Laurent Nguyen
7002da0b51 Implement ctrl-shift click to select multiple documents (#1851)
* Initial implementation of shift and ctrl click to select

* Implement shift-ctrl selection

* Fix snapshot, update selectionHelper comment

* Fix missing type

* Properly disable cursor selection

* Update snapshots

* Do not enable (multiselect) if readonly

* Consider meta key for mac and ctrl for everything else
2024-06-05 17:47:27 +02:00
SATYA SB
7c5fb1b697 [accessibility-3102730]:[Visual Requirement - Azure Cosmos DB - Data Explorer]: Luminosity ratio of 'Learn More' link with surrounding text is less than required 3:1 under 'Data Explorer' pane. (#1847) 2024-06-05 20:46:35 +05:30
SATYA SB
06e28ae3e7 [Visual Requirement - Azure Cosmos DB - Add Table]: Luminosity ratio of links with surrounding text is less than required 3:1 under 'Add Table' pane. (#1840) 2024-06-05 20:45:55 +05:30
SATYA SB
52c2cfe419 [Accessibility-3100036]: Close button is nested under 'Home' tab control under 'Data Explorer' pane. (#1818)
* [3100036]: [Programmatic Access - Azure Cosmos DB - Data Explorer]: Close button is nested under 'Home' tab control under 'Data Explorer' pane.

* Fabric-Less updated.

* Added specific width for contentWrapper.

* less update.

* Fixed out-scope space issue

---------

Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2024-06-05 20:42:48 +05:30
Laurent Nguyen
b76d83d8e1 Disable table selection for Fabric/read-only (#1855)
* Disable table selection for Fabric/read-only

* Update unit tests

* Fix format

---------

Co-authored-by: Laurent Nguyen <languye@microsoft.com>
2024-06-03 19:11:16 +02:00
Laurent Nguyen
495296602a Fix delete documents on mongo bug (#1852) 2024-06-03 15:23:09 +02:00
Asier Isayas
96ba0a9729 Reactivate Mongo Proxy (#1850)
* Reactivate Mongo Proxy

* Reactivate Mongo Proxy

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-05-31 13:31:24 -04:00
Laurent Nguyen
6276464e0d Fix refreshgrid behaving like load more (#1853) 2024-05-31 17:57:11 +02:00
Ashley Stanton-Nurse
98c5fe65e6 Use new Fluent-based Resource Tree for all environments (#1841)
Co-authored-by: Laurent Nguyen <laurent.nguyen@microsoft.com>
2024-05-29 09:56:27 -07:00
Laurent Nguyen
cebf044803 Fix typo (#1849) 2024-05-29 18:20:07 +02:00
Laurent Nguyen
f669a99228 Separate Fabric-specific message types (#1848)
* Update message de->fabric to v3

* Reinstate get authorization token path which doesn't get called every 5 minutes anymore

* Remove obsolete comment

* Add missing types

* Fix format

* Fix build issue

* Revert "Reinstate get authorization token path which doesn't get called every 5 minutes anymore"

This reverts commit a3f3511043.

* Keep 3 old fabric message types enums for compatibility with the portal

* Re-add warning comment about not changing existing message type enums

---------

Co-authored-by: Laurent Nguyen <languye@microsoft.com>
2024-05-29 16:03:51 +02:00
Laurent Nguyen
36736882ee Migrate DocumentsTab to React and add bulk delete and column resize (#1770)
* Document page now loads list of docs and displays selection

* DocumentsTabV2 now properly loads documents, show partition keys and display first doc with proper selection behavior. Move it to its own folder.

* Extract table in a separate component

* Resizable columns on the document table

* Fix selection behavior and some layout issue

* Adding table scrolling

* Fix NaN height issue

* Fix NaN height issue

* Fix column sizing + cell selection

* Improvement in width size. Add Load More

* Add react editor and pass column headers

* Dynamic columns for pk

* Fix initial columns size

* Add nav buttons

* Editing content updates buttons state

* Discard and save buttons working

* Fix save new document. Implement delete.

* Remove debug display

* Fix unexpand filter and reformat

* Fix compil issues

* Add refresh button

* Update column header placeholder style

* Implement delete multiple docs

* Fix multi delete

* Fix show/hide delete button

* Fix selection behavior

* Fix UX with buttons behavior and editor display

* Fix UX issue with not discarding edit changes

* Add some TODO's

* Remove debugging info and reformat

* Add mongo support

* Fix build issues

* Fix table header. Remove debug statement

* Restore broken nosql

* Fix mongo save new document/update document

* Fix bugs with clicking on newly created documents

* Fix comment

* Fix double fetch issue when clicking on an item

* Auto-select last document when saving new document

* Fix resourceTokenPartitionKey code

* Fix format

* Fix isQueryCopilotSampleContainer flag

* Fix unused code

* Call tab when updating error flag

* Destructure props to make useEffect dependencies work

* Fix loadStartKey

* minor update

* Fix format

* Add title to table

* Fix table coming off its container with unwanted horizontal scrollbar

* Increase table width. Fix eslint issue.

* Move refresh documents button from table back to DocumentsTabV2

* Fix load more text centering

* Don't show Load More if nothing to show

* Fix columns min width

* Add keyboard shortcuts

* Add keyboard handlers to load more and refresh button

* Add keyboard support to select table row

* Disable eslint issue from fluent library

* Connect cancel query button

* Add Fluent V9 theme for Fabric (#1821)

* Clean up dependencies and memoize internal functions and object. Move methods and object that don't depend on state outside of component.

* Fix filter disappearing when clicking Apply Filter

* Fix typo and format

* Implement bulk delete for nosql

* Replace filter ui components with fluent ui

* Remove jquery calls

* Migrate unit test to DocumentsTabV2

* Remove DocumentsTab and MongoDocumentsTab. Fix build issues.

* Properly handle activetab

* Remove comments and unused code

* Port keyboard shortcuts from commitId 1f4d0f2

* Port item editor shortcuts to improved Items tab branch (#1831)

* set filter focus on Ctrl+Shift+F

* implement filter enter/esc keybinds

* remove debugging

* Collapse filter when query is executed

* Fix monaco editor not happy when parent is null

* Fix how bulk delete operation gets called when no partition key

* Fix update id list after delete

* Fix deleteDocuments

* Fix build issue

* Fix bug in mongo delete

* Fix mongo delete flow

* Proper error handling in mongo

* Handle >100 bulk delete operations

* Add unit tests for DocumentsTableComponent

* More improvements to table unit tests

* Fix import. Disable selection test for now

* Add more DocumentsTab unit react tests

* Remove selection test

* Add more unit tests. Add lcov coverage report to display in vscode

* Move unit tests to correct file

* Add unit test on command bar

* Fix build issues

* Add more unit tests

* Remove unneeded call

* Add DocumentsTab for Mongo API

* Fix linting errors

* Update fluent ui v9 dependency. Color columns separation. Fix refresh button placement to not interfere with header cell width.

* Revert @fluentui/react-components to a safe version that compiles

* Add confirmation window when documents have been deleted

* Fix mongo unit tests

* Fix format

* Update src/Common/dataAccess/deleteDocument.ts

Co-authored-by: Ashley Stanton-Nurse <ashleyst@microsoft.com>

* Update src/Common/dataAccess/deleteDocument.ts

Co-authored-by: Ashley Stanton-Nurse <ashleyst@microsoft.com>

* Update src/Common/dataAccess/deleteDocument.ts

Co-authored-by: Ashley Stanton-Nurse <ashleyst@microsoft.com>

* Fix bug with markup. Simplify code.

* Protect against creating React editor without parent node

* Replace rendering tests with snapshot match

* Add test screenshot to troubleshoot e2e test

* Revert "Add test screenshot to troubleshoot e2e test"

This reverts commit 1b8138ade0.

* Attempt 2 at troubleshooting failing test

* Revert "Attempt 2 at troubleshooting failing test"

This reverts commit 3e51a593bf.

* Delete button now shows if one or more rows are selected

---------

Co-authored-by: Vsevolod Kukol <sevoku@microsoft.com>
Co-authored-by: Ashley Stanton-Nurse <ashleyst@microsoft.com>
2024-05-29 09:09:13 +02:00
sunghyunkang1111
19d1e0d1df allow serverless accounts to have vector search embeddings (#1844) 2024-05-20 17:24:04 -07:00
sunghyunkang1111
ceeead8458 Vector search for NoSQL accounts (#1843)
* Add container vector policy and indexing policy support

* Add vector search capability

* hide vector settings for shared throughput DB

* update package-lock

* fix pipeline

* remove comments

* Address comments

* Address comments
2024-05-20 13:30:30 -05:00
sunghyunkang1111
4da3363cf7 add capacityMode (#1826)
* add capacityMode

* add check for capacityMode for serverless
2024-05-17 12:19:23 -05:00
jawelton74
ff4bc78d6c Remove preview label from Computed Properties. (#1842) 2024-05-17 06:57:35 -07:00
SATYA SB
b6e3e5ea1c Screen Reader does not announce status message after invoking 'Add Row' control under 'Add Table Row' pane. (#1837)
* [accessibility-3100026]: [Screen Reader - Azure Cosmos DB - Add Table Row]: Screen Reader does not announce status message after invoking 'Add Row' control under 'Add Table Row' pane.

* Fixed format.

* Snap update.

---------

Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2024-05-14 09:57:50 +05:30
SATYA SB
9e9d270b65 [accessibility-3102877]:[Programmatic Access - Azure CosmosDB – Data Explorer]: Ensures every ARIA input field has an accessible name. (#1835)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2024-05-14 09:56:53 +05:30
SATYA SB
f56e5e64b9 [accessibility-3102916]:[Keyboard Navigation - Azure CosmosDB - Data … (#1834)
* [accessibility-3102916]:[Keyboard Navigation - Azure CosmosDB - Data Explorer]: Keyboard focus is moving to non-interactive control after checkbox control of Advanced button.

* Updated Snap.

---------

Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2024-05-14 09:56:16 +05:30
Asier Isayas
14e5efcebf Point Mongo requests to old backend (#1838)
* point mongo requests to old backend

* point mongo requests to old backend

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-05-09 13:42:59 -04:00
Ashley Stanton-Nurse
5c3f18f5f8 add link to keyboard shortcuts doc to home tab (#1836) 2024-05-07 12:30:46 -07:00
jawelton74
6ebc48ad28 Remove some Notebooks code (#1832)
* Remove onNewNotebookClicked, openUploadFilePanel functions and
UploadFilePane.

* Remove resetNotebookWorkspace function.

* Remove Notebooks related resource tree node generation.

* Fix test snapshots.
2024-05-02 07:14:31 -07:00
jawelton74
298197b1b8 Revert "First set of changes for Notebooks removal. (#1816)" (#1830)
This reverts commit b023250e67.
2024-05-01 07:21:50 -07:00
Ashley Stanton-Nurse
81a5b7cb6d add shortcuts for the Items tab (#1827)
* add shortcuts for the Items tab

* Add shortcut to clear Items tab filter.
2024-04-30 10:03:27 -07:00
jawelton74
b023250e67 First set of changes for Notebooks removal. (#1816)
* First set of changes for Notebooks removal.

* Fix unit test snapshots.
2024-04-29 15:46:24 -07:00
Asier Isayas
92246144f7 Enable Legacy Mongo Shell in Fairfax (#1829)
* enable Mongo Proxy and LMS in sovereign clouds

* remove mooncake

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-04-29 16:25:58 -04:00
SATYA SB
a08415e7bc [3100018:[Programmatic Access - Azure Cosmos DB - Edit Property]: Text Area edit field does not have a label under 'Edit Property' pane. (#1819)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2024-04-29 22:26:27 +05:30
SATYA SB
b94ce28e96 [accessibility-2724013]:[Screen reader - Cosmos DB - Data Explorer -> Entities -> Add entity]: Screen reader announces incorrect role when focus lands on the "Edit" and "Delete" buttons. (#1822)
Co-authored-by: Satyapriya Bai <v-satybai@microsoft.com>
2024-04-29 22:23:49 +05:30
sunghyunkang1111
f8f7ea34bd Copilot rewording (#1824)
* Copilot rebranding to query advisor

* fix the subquery link
2024-04-26 14:09:55 -05:00
Asier Isayas
cbd5e6bf76 open Legacy Mongo SHell with correct base URL in sovereign clouds (#1823)
Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-04-26 14:55:47 -04:00
Ashley Stanton-Nurse
618c5ec0fe Add button (and keyboard shortcut) to download query (#1817) 2024-04-24 15:11:51 -07:00
Asier Isayas
afc82845b5 activate Token Controller (#1820)
Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-04-24 15:04:01 -04:00
Ashley Stanton-Nurse
f4bcee5461 initialize new documents with their partition key (#1815)
* initialize new documents with their partition key

* refmt
2024-04-23 15:47:04 -07:00
Ashley Stanton-Nurse
17207624a9 add more intl-friendly tab nav shortcuts (#1814) 2024-04-23 15:46:41 -07:00
jawelton74
d36e511b18 Update d3, webpack-dev-server, typedoc dependencies. (#1812)
* Update d3, webpack-dev-server, typedoc dependencies.

* Fix unit test failures.

* Revert change to snapshot as it doesn't seem required when running in
github.
2024-04-23 10:15:48 -07:00
Ashley Stanton-Nurse
c1a28793ba bind F5 to execute query (#1813) 2024-04-23 09:08:29 -07:00
Asier Isayas
acf5acfdb4 Remove Legacy Mongo Shell feature flag (#1810)
* LMS Mongo Proxy support

* change stirng to url for get mongo shell url

* fix tests

* enable feature flag

* fixed unit test

* add mongoshell to path

* remove LMS feature flag

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-04-23 08:20:27 -04:00
jawelton74
7b81767ded Enable new backend for Settings API in Prod. (#1791) 2024-04-22 14:34:20 -07:00
jawelton74
c12eced120 Update node-fetch, react-dev-utils and azure/identity dependencies. (#1809) 2024-04-22 07:10:16 -07:00
jawelton74
2b15a4d43d Update package.json (#1807) 2024-04-19 15:03:11 -07:00
Ashley Stanton-Nurse
c220a8b070 [Task 3071878] Tab Navigation Keyboard Shortcuts (#1808)
* [Task 3071878] Tab Navigation Keyboard Shortcuts

* throw in development on duplicate handlers

* refmt
2024-04-19 13:44:30 -07:00
Ashley Stanton-Nurse
a5a5a95973 [Task 3061766] Additional Keyboard Shortcuts (#1805)
* [Task 3061766] Additional Keyboard Shortcuts

refmt and fix lints

shortcuts for: discard, new item/sproc/udf/trigger, delete
item/sproc/udf/trigger

copilot shortcut

* remove 'Ctrl+I' due to conflict with Monaco Autocomplete
2024-04-19 09:43:27 -07:00
Asier Isayas
e3fab9b5bf Add 'mongoshell' to Legacy Mongo Shell path (#1806)
* LMS Mongo Proxy support

* change stirng to url for get mongo shell url

* fix tests

* enable feature flag

* fixed unit test

* add mongoshell to path

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-04-18 15:39:13 -04:00
Asier Isayas
98000a27f0 Legacy Mongo Shell Mongo Proxy support (#1802)
* LMS Mongo Proxy support

* change stirng to url for get mongo shell url

* fix tests

* enable feature flag

* fixed unit test

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-04-17 19:01:12 -04:00
Ashley Stanton-Nurse
af664326ea Fix issues with the command bar when switching through React and Trigger tabs (#1804)
* fix bug in trigger tab that takes over the command bar while open

* clear context buttons when a react tab is active

* restore unintentionally removed code

* reformat
2024-04-17 15:57:29 -07:00
Ashley Stanton-Nurse
a44ed1f45c [Task 3061766] Global Keyboard Shortcuts, implemented through the Command Bar (#1789)
* keyboard shortcuts using tinykeys

* refmt and fix lints

* retarget keyboard shortcuts to the body instead of the root element of the React component tree

* refmt

* Update src/Explorer/Menus/CommandBar/CommandBarUtil.tsx

Co-authored-by: Laurent Nguyen <laurent.nguyen@microsoft.com>

* add Save binding to New Item command bar

---------

Co-authored-by: Laurent Nguyen <laurent.nguyen@microsoft.com>
2024-04-17 11:19:09 -07:00
JustinKol
e0cb3da6aa Is executing is false (#1801) 2024-04-16 18:47:43 -04:00
JustinKol
6c9673975a Added hyphen to prohibited characters in keyspace name title (#1800) 2024-04-16 09:24:14 -04:00
JustinKol
d35e2a325e Cassandra API create table error messages swallowed by the Portal and shown as "undefined". (#1790)
* changed error message variable

* changed other error messages

* Added check in case responseJSON is missing

* created error const
2024-04-15 15:47:58 -04:00
sunghyunkang1111
00a816c488 set the value in the editor for results (#1799) 2024-04-13 15:19:56 -05:00
jawelton74
953bef404b Set backend endpoints in testExplorer to use MPAC. (#1797) 2024-04-11 15:43:46 -07:00
Asier Isayas
dfcb771939 Activate Mongo Proxy and Cassandra Proxy in Prod (#1794)
* activate Mongo Proxy and Cassandra Proxy in Prod

* fix bug that blocked local mongo proxy and cassandra proxy development

* fix pr check tests

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-04-09 13:45:36 -07:00
jawelton74
6925fa8e4e Replace Entra app client secret auth with OpenID Connect in E2E tests. (#1792)
* Use Az login with OpenID connection to get test credentials.

* Set subscription id environment variable.

* Update testExplorer and cleanup job.

* Retrieve access token in test case and pass to testExplorer.

* Add debug tracing for tests.

* Set up other mongo test to use Az CLI creds.

* Revert subscription id retrieval.

* Add CLI credentials retrieval to rest of tests.

* Fix missing imports.

* Clean up redundant code.

* Remove commented import statement.
2024-04-09 10:55:08 -07:00
jawelton74
7f6338b68b Change copilot settings call to use new backend endpoint. (#1781)
* Change copilot settings call to use new backend endpoint.

* Refactor EndpointUtils function for new backend enablement.
2024-04-04 10:18:50 -07:00
Ashley Stanton-Nurse
db50f42832 [Task #3061771] Correct render order issues on undo (#1785)
* fix #3061771 by correcting render order issues on undo

* clarifying comment

* fix lints

* push an undo stop before executing edits

* tidy up some unnecessary comments
2024-04-04 09:17:09 -07:00
Ashley Stanton-Nurse
f533eeb0fc add support for react dev tools in the cosmos explorer (#1788) 2024-04-04 09:16:23 -07:00
sunghyunkang1111
3c5d899e47 add the new message to the bottom to avoid contract breaking (#1786) 2024-04-02 17:54:53 -05:00
Ashley Stanton-Nurse
b44778b00a fix #3061738 by unclobbering some Monaco styles we clobber (#1784) 2024-04-02 10:51:19 -07:00
sunghyunkang1111
1464745659 Add activate/close tab contracts and add to queryTab (#1783) 2024-04-02 11:49:33 -05:00
Asier Isayas
18cc2a4195 Activate Mongo and Cassandra Proxies in MPAC (#1776)
* Fix API endpoint for CassandraProxy query API

* activated mongo proxy

* added mpac

* Activate CassandraProxy API endpoints for MPAC

* Run npm format

* Set CASSANDRA_PROXY_OUTBOUND_IPS_ALLOWLISTED when we detect new
Cassandra Proxy endpoints in IP rules.

* query documents API fix

* simplify ip check

---------

Co-authored-by: Senthamil Sindhu <sindhuba@microsoft.com>
Co-authored-by: Asier Isayas <aisayas@microsoft.com>
Co-authored-by: Jade Welton <jawelton@microsoft.com>
2024-04-02 09:34:58 -07:00
sindhuba
86f2bc171f Remove notebooks UI (#1779)
* Fix API endpoint for CassandraProxy query API

* Remove notebooks UI components

* Fix tests

* Address comments

* Fix unit tests

* Remove commented code
2024-04-01 08:44:42 -07:00
jawelton74
cabedf4a29 Enable new backend endpoint to be passed to Data Explorer via message. (#1782) 2024-04-01 07:54:04 -07:00
sunghyunkang1111
5aa6b0abe1 fix opening collections (#1780)
* fix opening collections

* fix opening collections

* fix opening collections

* fix opening collections
2024-03-28 12:10:32 -05:00
Vsevolod Kukol
f24b0bcf1b Show the Feedback button in Portal only (#1775)
This feature is not supported on any other platform incl. Hosted.
2024-03-28 16:05:38 +01:00
JustinKol
56408a97d7 Add container ids to tabs (#1772)
* Added container ids to tabs

* prettier run

* Updated for undefined scenarios

* prettier

* added ellipsis to long container names

* added slice

* prettier

* Added ellipsis to long DB names in tabs

* Added undefined DB case

* Replaced dots with ellipsis character

* corrected undefined return value
2024-03-26 12:36:04 -04:00
Vsevolod Kukol
0df68c4967 Fix initial container loading in Fabric (#1771)
* Fix initial container loading in Fabric

There is a rendering issue where the documents table doesn't resize properly if explorer is loaded in the beackground (invisible).
To workaround this, track DE visibility from Fabric RPC and open the first container only once DE becomes visible. If DE has been already shown, open the container right away.

* Preserve glitchy behavior if Fabric UX doesn't send isVisible

* Preserve Fabric visibility in global status
and fix a race condition where visibility might change during initialization.
2024-03-26 17:22:15 +01:00
Asier Isayas
e09930d9d0 Support Token API in new Portal Backend (#1773)
* added support for generate token

* fix checks

* fix checks

* deactivate mongo proxy

* fix tests

* remove mongo proxy from mpac

* change endpoints to prod

* npm run format

* add await

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-03-22 13:18:02 -04:00
sunghyunkang1111
da2e874ae6 Fix bugs on data transfer and bring back query explanation and remove query prompt from editor (#1777)
* Fix minor issues

* add back preview tag

* bring back query explanation and remove prompt in editor
2024-03-21 11:23:42 -05:00
Vsevolod Kukol
a524138ac9 Don't show the new Home button in Fabric (#1774)
as the whole Home tab feature is not supported there.
2024-03-20 00:28:24 +01:00
sindhuba
39b0fb9e2c Fix API endpoint for CassandraProxy query API (#1769) 2024-03-18 10:49:33 -07:00
sunghyunkang1111
ac22e88d9c rebranding of inline copilot (#1767)
* rebranding of inline copilot

* rebranding of inline copilot

* rebranding of inline copilot

* fix styling
2024-03-18 12:15:24 -05:00
Laurent Nguyen
91d9e27049 Turn off fetching authorization token (#1766) 2024-03-14 21:56:26 +01:00
JustinKol
f881f7fd2f Enabled the ability to close the home tab (#1765) 2024-03-13 16:32:59 -04:00
vchske
4c74525b5d Adding computed properties to Settings tab for containers (#1763)
* Adding computed properties to Settings tab for containers

* Fixing files for prettier and a test snapshot
2024-03-12 14:55:14 -07:00
sindhuba
1a6d8d5357 Add CassandraProxy support in DE (#1764) 2024-03-11 15:17:01 -07:00
sunghyunkang1111
56c0049e9a add feedback policies integration with copilot (#1745)
* add feedback policies integration with copilot

* remove teaching bubble and welcome modal

* force prod phoenix endpoint in MPAC

* force prod phoenix endpoint in MPAC
2024-03-06 10:33:21 -06:00
MokireddySampath
b3837a089d color of the link has been changed to get the approved color contrast ratio of 4.5:1 (#1710) 2024-03-06 12:57:05 +05:30
MokireddySampath
e68aaebca6 Asterisk has beenadded beside the heading of input to show that it is a mandatory input (#1749) 2024-03-06 12:56:34 +05:30
MokireddySampath
6e1c4fd037 Bug 1242529: [Usable - Azure Cosmos DB - Input Parameters]: Aria-label is not descriptive enough for the 'Close(x)' button of 'Input Parameters' blade. (#1760)
* screen reader name for the button has been changed to read out the name of the dialog box

* tests have been updated
2024-03-06 12:56:07 +05:30
MokireddySampath
0039adf1c2 Border has been added to distinguish clear notifications from text (#1750) 2024-03-06 12:54:44 +05:30
MokireddySampath
5d4e9d82bb Bug 1240907: Aria-label is not descriptive enough for 'More(...)' button present under 'SQL API' section. (#1748)
* screen reader name for the more button has been modified as suggested

* e2e test have been updated

* e2e tests updated
2024-03-06 12:48:46 +05:30
MokireddySampath
47bdc9c426 styling changes have been made o remove the overlaping of focus outlines (#1721) 2024-03-06 12:47:57 +05:30
MokireddySampath
b8457e3bf9 defect2278780 (#1472)
* arialabel has been added to close button of invitational youtube video

* heading role has been addedd and tag has been changed to h1

* outline has been restored to choose columns link in entities page

* Update QuickstartCarousel.tsx

* Update SplashScreen.tsx

* Update TableEntity.tsx

* outline for edit entity has been added on focus

* keyboard accessibility added to rows in table entities

* Update queryBuilder.less

* Update TableEntity.tsx

* Update PanelComponent.less

* Update DataTableBindingManager.ts

* Update DataTableBindingManager.ts

* Update DataTableBindingManager.ts

* Update DataTableBindingManager.ts

* Update DataTableBindingManager.ts
2024-03-06 12:43:44 +05:30
Vsevolod Kukol
533e9c887c Small fixes for Fabric PuPr (#1761)
* Hide the RU Threshold Message in Fabric

Fabric is RO and the Settings button is hidden, hence the message doesn't make sense. If customers hit the limits they can go to Portal and change the settings there.

* Change the toolbar font size and icon color in Fabric
2024-03-06 01:41:50 +01:00
jawelton74
76ad930930 Improve error handling when acquiring aad tokens (#1746)
* Mostly working - some cosmetic changes remaining.

* Cosmetic changes and other tidy ups.

* More clean up.

* Move msal back to dependencies. Fix typo.

* msal should be prod dependency

* Revert msal package update as it is causing issues with unit test
execution.

* Add tracing for unhandled exceptions when acquiring tokens.
2024-03-04 16:08:13 -08:00
JustinKol
932f211038 Revert "Revert "Adding CESCVA feedback button (#1736)" (#1753)" (#1759)
This reverts commit 5a64fc2582.
2024-03-04 17:19:12 -05:00
Asier Isayas
b480c635ca fix create mongo collection and delete mongo document switching (#1758)
Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-02-29 12:10:15 -05:00
Laurent Nguyen
16eb096fdb Don't show Settings buttons for Fabric readonly (#1757)
* Don't show Settings buttons for Fabric readonly

* Fix format
2024-02-28 19:34:33 +01:00
Vsevolod Kukol
e9571c0f2d Update layout and colors for Fabric per req from Design (#1756) 2024-02-27 18:25:35 +01:00
Asier Isayas
c9abcc1728 Prompt Mongo and Cassandra users to allow list Mongo and Cassandra proxies in Azure Portal (#1754)
* Mongo Proxy backend API

* merge main into current

* allow mongo proxy endpoints to be constants

* allow mongo proxy endpoints to be constants

* fix test

* show ip address warning for Mongo and Cassandra accounts

* show ip address warning for Mongo and Cassandra accounts

* removed string from prod

* make mongo proxy endpoint mandatory

* added MongoProxyEndpointsV2

* added MongoProxyEndpointsV2

* moved mongo and cassandra endpoints to Constants

* moved mongo and cassandra endpoints to Constants

* moved mongo and cassandra endpoints to Constants

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-02-22 15:53:01 -05:00
Laurent Nguyen
a36f3f7922 Hide Save/Open query buttons and New Document/Save/Update buttons for Fabric read-only (#1755)
* Remove save query button and new document buttons for Fabric. Introduce a isReadOnly flag in Fabric context

* Fix user context init
2024-02-22 18:34:30 +01:00
JustinKol
5a64fc2582 Revert "Adding CESCVA feedback button (#1736)" (#1753)
This reverts commit 9cebe5f9ba.
2024-02-21 13:30:04 -05:00
Laurent Nguyen
12366bb645 Revert "Hide buttons for Fabric or when no write access (#1742)" (#1751)
This reverts commit f403b086ad.
2024-02-21 17:22:17 +01:00
JustinKol
9cebe5f9ba Adding CESCVA feedback button (#1736)
* Adding CESCVA feedback button

* Feedback message logic added
2024-02-20 13:00:31 -05:00
vchske
5d80ecb462 Fixing terminal tab to display correct API type for network warning (#1747) 2024-02-16 16:22:24 -08:00
vchske
f87611a39d Fixing manual throughput cost estimate (#1740)
* Fixing manual throughput cost estimate

* Fix test and prettier errors
2024-02-14 09:55:45 -08:00
sunghyunkang1111
a914fd020c Partition Key Change with Container Copy (#1734)
* initial commit

* Add change partition key logic

* Update snapshot

* Update snapshot

* Update snapshot

* Update snapshot

* Cleanup code

* Disable Change on progress job

* add the database information in the panel

* add the database information in the panel

* clear in progress message and remove large partition key row

* hide from national cloud

* hide from national cloud

* Add check for public cloud
2024-02-13 14:00:27 -06:00
JustinKol
e43b4eee5c Correcting import for MessageTypes (#1743) 2024-02-13 10:35:14 -05:00
Asier Isayas
8b0b3b07d6 Add Mongo Proxy to Data Explorer (Standalone and Portal) (#1738)
* Mongo Proxy backend API

* merge main into current

* allow mongo proxy endpoints to be constants

* allow mongo proxy endpoints to be constants

* fix test

* check for allowed mongo proxy endpoint

* check for allowed mongo proxy endpoint

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-02-09 10:58:10 -05:00
Laurent Nguyen
f403b086ad Hide buttons for Fabric or when no write access (#1742) 2024-02-09 15:10:57 +01:00
jawelton74
f8cfc6c21c Remove references to addCollectionDefaultFlight parameter. (#1741) 2024-02-08 11:49:40 -08:00
Asier Isayas
35ca7944ae Limit RU threshold only to NoSQL (#1739)
* limit RU threshold only to NoSQL

* limit RU threshold only to NoSQL

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-02-07 11:31:13 -05:00
sindhuba
6d98b4a500 Remove localStorage for NPS (#1733)
* Remove localStorage for NPS

* Run npm format

* Update comment
2024-02-06 09:54:50 -08:00
JustinKol
2d06eef9cc Added CESCVA MessageType for FE (#1737) 2024-02-06 12:46:25 -05:00
Asier Isayas
31f7178669 Change RU Threshold to 5000 (#1735)
* ru threshold beta

* use new ru threshold package

* fix typo

* fix merge issue

* fix package-lock.json

* fix test

* fixed settings pane test

* fixed merge issue

* sync with main

* fixed settings pane check

* fix checks

* fixed aria-label error

* fixed aria-label error

* fixed aria-label error

* fixed aria-label error

* remove learn more

* change default RU threshold to 5000

* change default RU threshold to 5000

* change default RU threshold to 5000

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-02-02 11:52:37 -05:00
JustinKol
c0b54f6e84 Added TableAPI whitespace check and trim values (#1731)
* Added TableAPI whitespace check and trim values

* Reverted value is not required unless Row or PrimaryKey

* Prettier Run

* Add full whitespace check on Keys

* Prettier formatting

* Fixed type

* Added whitespace check for tabs, vertical tabs, formfeeds, line breaks, etc

* Fixed logic
2024-02-01 12:51:23 -05:00
jawelton74
cd3eb5b5b3 Fix regression in Quickstart workflow. (#1732) 2024-01-30 16:31:46 -08:00
Asier Isayas
dbb0324a64 RU Threshold (#1728)
* ru threshold beta

* use new ru threshold package

* fix typo

* fix merge issue

* fix package-lock.json

* fix test

* fixed settings pane test

* fixed merge issue

* sync with main

* fixed settings pane check

* fix checks

* fixed aria-label error

* fixed aria-label error

* fixed aria-label error

* fixed aria-label error

* remove learn more

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2024-01-30 16:21:29 -05:00
sindhuba
e207f3702b Add more logs for NPS (#1729) 2024-01-24 16:46:28 -08:00
MokireddySampath
f496220ed6 Empty coumnheader has been given the icon with name of description (#1718) 2024-01-23 13:28:13 +05:30
MokireddySampath
eb790d09b5 role of heading has been added to the text that is visually appearing… (#1701)
* role of heading has been added to the text that is visually appearing as heading

* Update WelcomeModal.test.tsx.snap
2024-01-23 00:08:27 +05:30
MokireddySampath
323305e485 state of the buttons will now be updated by screen reader (#1716) 2024-01-20 09:17:47 +05:30
sunghyunkang1111
70635e426f Fix the teaching bubble popup and enable copilot card (#1722)
* Fix the teaching bubble popup and enable copilot card

* add close copilot button title

* fix compilation
2024-01-19 09:37:17 -06:00
sindhuba
5a5bf34d4d Update logic for NPS survey for existing accounts > 90 days (#1725)
* Update logic for NPS survey for existing accounts > 90 days

* Remove lint error

* Address comments

* Fix error in code
2024-01-19 07:08:11 -08:00
Laurent Nguyen
0975591945 Fabric: clean up RPC and support show/hide toolbar message (#1680)
* Use Promise for allResourceToken fabric message. Cleanup token message handling and add debounce.

* Improve rpc and update initalization flow

* Fix format

* Rev up message names for new version

* Refactor RPC with Fabric

* Build fix

* Fix build

* Fix format

* Update Message types

* Fix format

* Fix comments

* Fabric toolbar style and support to show/hide it (#1720)

* Add Fabric specific Toolbar design

* Add Fabric message to show/hide the Toolbar

* Fix CommandBarUtil formatting

* Update zustand state on setToolbarStatus to trigger a redraw of the command bar with updated visibility

---------

Co-authored-by: Laurent Nguyen <laurent.nguyen@microsoft.com>

* Fix format

---------

Co-authored-by: Vsevolod Kukol <sevoku@microsoft.com>
2024-01-18 17:13:04 +01:00
sunghyunkang1111
5d13463bdb Copilot settings (#1719)
* gating copilot with AFEC

* Add enable sample DB in settings

* Add enable sample DB in settings

* Add enable sample DB in settings

* PR comments
2024-01-09 13:32:20 -06:00
MokireddySampath
c4cceceafc Status attribute added for the message to be readout by screenreader (#1709) 2024-01-04 20:43:44 +05:30
MokireddySampath
532a453f5a Aria label has been updated to the button(Enable copilot/Disable copilot) (#1706) 2024-01-04 19:38:05 +05:30
MokireddySampath
9355a3ae04 Altt text and role has been added to the 'copilot icon' (#1705) 2024-01-04 19:37:50 +05:30
MokireddySampath
14456c2102 label has been added to the textfield of copilot promptbar (#1704) 2024-01-04 19:37:35 +05:30
MokireddySampath
0c9264e8b3 Bug 2819239:Screen reader does not announce the loading information which appears on invoking the 'Send' button. (#1703)
* Alert has been added and content also added accordign to the loader state

* Snapshot of tests have been updated
2024-01-04 19:37:16 +05:30
MokireddySampath
0dd1032357 Bug 2817823: [Programmatic access - Cosmos DB Query Copilot - Query]: Accessible name is not defined for the 'Like', 'Dislike' and 'Send' buttons present on the page. (#1700)
* text color of link has been changed to get the contrast ratio of atleaast 4.5:1

* screen reader names have been added to the buttons

* Update QueryCopilotPromptbar.tsx
2024-01-04 19:35:12 +05:30
MokireddySampath
5011d12f16 text color of link has been changed to get the contrast ratio of atleaast 4.5:1 (#1699) 2024-01-04 19:34:58 +05:30
MokireddySampath
a7e5ff2a9f status role has been added for the screen reader to announce the status message displayed (#1697) 2024-01-04 19:34:26 +05:30
MokireddySampath
ad1391f623 visual and arialabel were different which has been changed as required and tests have been updated (#1685) 2024-01-04 19:34:14 +05:30
MokireddySampath
a2a5407b15 Label has been added to the text field on selecting autoscale in throughputc (#1676) 2024-01-04 19:33:55 +05:30
Laurent Nguyen
e9181f19d7 Fix datatables issue and indicator not loading for Table API > Entities. Upgrade jquery. Fix right panel resize issue. (#1713)
* Fix datatables issue and indicator not loading for Table API > Entities

* Fix jquery and datatables compile issues. Add patch for datatables.net-colreorder error in types

* Fix side panel size. Fix bug resizing side panel.

* Update PanelContainerComponent unit test snapshot

* Fix commented code
2024-01-03 14:52:34 +01:00
JustinKol
c91ac39248 Query Max Retry settings (#1688)
* Added query retry settings

* prettier run

* Fixed tests and queryDocuments

* Fixed tests

* corrected logic

* Updated tests and logic

* Removed optional flag

* Added default value text

* Reworded text

* moved retry options to CosmosClient

* removed unused references to retryOptions

* Reverting formatting

* reverting

* revert

* prettier run

* Correct default and added options directly to the client

* Prettier run and unit test update

* Corrected tooltip and constant name

* Added inSeconds to WaitTime
2023-12-29 08:12:20 -05:00
Armando Trejo Oliver
c82a4737c6 Add support for Dogfood (#1715)
* Add support for Dogfood

* Format
2023-12-20 05:53:02 -08:00
jawelton74
c6aefacc4e Fix the Nuget Publish MPAC action in CI. (#1712) 2023-12-13 11:44:46 -08:00
bogercraig
bf7c0aac63 Enabling endpoint discovery to test region failure in a non-dev environment. (#1711) 2023-12-13 10:44:17 -08:00
Laurent Nguyen
1bf4683894 Make Data Explorer work on node v18 (#1654)
* Upgrade packages to enable npm i with node 18

* Fix crypto and querystring issue

* Fix webpack errors during npm start

* Upgrade monaco editor. Fix alias in webconfig

* Remove deprecated file-loader. Upgrade webpack to latest.

* Fix format

* Upgrade webpack, eslint and typescript

* Update p-retry and fluentui packages

* Revert monaco package upgrade

* Fix notebook compile errors

* Fix lint errors

* Update jest snapshots

* Fix unit tests

* Update node version to 18

* Fix compile error

* Fix compile error

* Fix format

* Turn off warning overlay for webpack devServer

* Fix format

* Re-add monaco webpack plugin and upgrade monaco-editor

* Update package-lock.json

* Fix build issue

* Move MonacoWebpackPlugin to previous place in webpack.config.js

* update package-lock.json

* Fix package-lock.json

* Update package-lock.json

* Fix export ChoiceItem not found warning for self serve. Remove warning turn off in webpack config.

* Update checkout and setup actions in for ci tests

* Disable Gallery callout

* Fix disable gallery header

* Totally disable New gallery callout

* Upgrade all github actions to latest
2023-12-13 10:24:40 -08:00
sunghyunkang1111
59a50d72fe Remove copilot feature registration check (#1708)
* Remove copilot banner

* fix test
2023-12-11 14:42:10 -06:00
bogercraig
b19aa3fbca Reverting enabling endpoint discovery since it didn't have time during CCOA to bake in MPAC. (#1698) 2023-11-28 13:29:27 -08:00
MokireddySampath
0f69b7998f outline offset has been added for the focus indicator to be visible on navigation (#1551) 2023-11-22 00:08:59 +05:30
MokireddySampath
acd4787b3d WCAG 1.3.1,WCAG 4.1.2: Ensures every form element has a label (textarea) (#1549) 2023-11-22 00:08:32 +05:30
MokireddySampath
4ec6e7b8cc aria posinset has been removed, since it is not an attribute that is supported by the HTML elements used (#1547) 2023-11-22 00:08:17 +05:30
MokireddySampath
4fcbf7f0ea Alert is being updated for every change, hence the screenreader readsout the alert everytime a change occursin the input (#1544)
* Alert is being updated for every change, hence the screenreader readsout the alert everytime a change occursin the input

* Update DeleteCollectionConfirmationPane.tsx

* Update DeleteCollectionConfirmationPane.tsx
2023-11-22 00:07:33 +05:30
MokireddySampath
d0c75e4490 role has been changed to buttton for the graphic images of edit and delete buttons (#1652) 2023-11-22 00:07:02 +05:30
MokireddySampath
50bd17dd61 role=presentation is removed for the image in add new clause button, since it is not accepted format (#1653) 2023-11-22 00:06:35 +05:30
MokireddySampath
3d300cc1e4 heading has been changed to follow the hierarchy down the page (#1656) 2023-11-22 00:06:09 +05:30
MokireddySampath
6e956d27ad Provisioned throughput checkbox is not aligned (#1661) 2023-11-22 00:05:42 +05:30
MokireddySampath
b419bec5a3 Bug 2748872: "Back" button is not keyboard accessible which is present under "Email" screen. (#1665)
* Keyboard navigation was not present to the back button on the add row table dialog which has been added through this commit

* Update PanelComponent.less
2023-11-22 00:02:05 +05:30
MokireddySampath
d305eb9f9b Aria-label text link hs been changed to match the visble link (#1666) 2023-11-22 00:01:45 +05:30
MokireddySampath
05f3bef5b9 Dependency has been added tot he useeffect for tabs to avoid rerendering continuosly (#1682) 2023-11-22 00:00:03 +05:30
bogercraig
6af1925d15 Enabling enableEndpointDiscovery to test DE Region Outage Resiliency (#1694)
* Setting enableEndpointDiscovery to true to test client resilience during region outage.
When this is set to false, it can impact the SDK's failover behavior.
2023-11-16 11:56:39 -08:00
sunghyunkang1111
b9cbfc924f do not throw error when checking for initial checking of copilot enablement (#1693) 2023-11-14 17:22:12 -06:00
sindhuba
1aa4c18119 Increase NPS sample size and remove constraints (#1692)
* Increase NPS sample size and remove constraints

* Run npm format

* Run npm format:check
2023-11-14 22:26:57 +05:30
sunghyunkang1111
0ab07419ce fix the phoenix endpoint (#1691) 2023-11-10 18:53:23 -06:00
sunghyunkang1111
40b8127a6f P1 bugs for copilot (#1689)
* P1 bugs for copilot

* P1 bugs for copilot

* P1 bugs for copilot

* Update branding and AFEC

* Update branding and AFEC

* add timeout for ARM calls

* increase test timeout

* fix formatting

* fix formatting

* fix formatting

* fix formatting

* don't call ARM when connectionstring login
2023-11-10 16:55:39 -06:00
sunghyunkang1111
0e124f4881 Copilot user db (#1672)
* Implement copilot for user database

* Fix minor bugs

* fix bugs

* Add user database copilot

* Add placeholder text on copilot

* Add AFEC adn killswitch

* Add new v2 sampledatabase endpoint

* Add telemetry

* fix telemetry bug

* Add query edited telemetry

* add authorization header

* Add back to the staging env for phoenix

* point to stage for phoenix

* Preview commit for test env

* Preview link for staging

* change the staging url

* fix lint, unit tests

* fix lint, unit tests

* fix formatting
2023-11-09 11:55:25 -06:00
vchske
a5e1b37ba6 Bugbash updates (#1684)
* Minor changes to vcore mongo quickstart based on feedback

* Text change vcore to vCore
2023-11-08 16:04:06 -08:00
jawelton74
15d111e3db Add directions to use AAD login if account blocked from connection (#1683)
string login.
2023-11-01 15:46:54 -07:00
Asier Isayas
1726e4df51 Remove enableResourceGraph feature flag (#1681)
* fetch subs and accounts via graph

* fixed subscription rendering

* add feature flag enableResourceGraph

* add feature flag enableResourceGraph

* remove enableResourceGraph feature flag

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2023-10-27 14:09:21 -04:00
vchske
bc68b4dbf9 Minor changes to vcore mongo quickstart based on feedback (#1678) 2023-10-26 16:46:01 -07:00
vchske
15e35eaa82 Adds restarting vcore mongo shell if user enters wrong password (#1675)
* Adds restarting vcore mongo shell if user enters wrong password

* Deleted unnecessary comment
2023-10-26 16:40:59 -07:00
Asier Isayas
f69cd4c495 Fetch subs and accounts via MS graph (#1677)
* fetch subs and accounts via graph

* fixed subscription rendering

* add feature flag enableResourceGraph

* add feature flag enableResourceGraph

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2023-10-26 12:00:39 -04:00
Laurent Nguyen
661f6f4bfb Clear console and properly handle error message when querying database or containers (#1679) 2023-10-26 15:55:48 +00:00
JustinKol
3a703b0bd0 Explorer null handling (#1658)
* Cassandra null value handling

* prettier run

* Added boolean and date

* Reverted null handling switch statement and added editing warning

* ran prettier

* putting new line back in

* prettier run

* changed warning message

* updated snapshot

* fixed undefined condition

* removed toString from undefined
2023-10-25 10:12:42 -04:00
jawelton74
70c031d04b Check for accounts that are restricted from connection string login. (#1673)
* Call Portal Backend to check for accounts that are restricted from
connection string login.

* Remove debug logging and revert to actual backend endpoint.

* Use React hooks for displaying error message.

* Move accountrestrictions route under guest.

* Check restrictions before resource token check.

* Revert test changes.
2023-10-23 12:04:19 -07:00
MokireddySampath
b949f60c2a Defect2271490 (#1474)
* arialabel has been added to close button of invitational youtube video

* heading role has been addedd and tag has been changed to h1

* outline has been restored to choose columns link in entities page

* header text color changed to meet luminosity ratio requirement

* capacity calculator link has been added with underline on focus

* add property is readout twice while using screenreader

* arialabel added to the add property button

* screenreader content changed to announce the entire alert

* alert message is partially readout on error

* Update fulldatatables.less

* Update queryBuilder.less

* Update TableEntity.tsx

* Update ThroughputInput.less

* Update ThroughputInput.tsx

* Update ThroughputInput.test.tsx.snap

* Update NewVertexComponent.tsx

* Update PanelInfoErrorComponent.tsx

* Update AddTableEntityPanel.tsx

* Update AddTableEntityPanel.test.tsx.snap

* Update SplashScreen.tsx

* Update QuickstartCarousel.tsx

* Update RightPaneForm.tsx

* Update fulldatatables.less
2023-10-23 18:04:59 +05:30
vchske
deb0ebcf92 Updating vcore mongo quickstart text based on feedback (#1669)
* Updating quickstart text based on feedback

* Escaping apostrophe
2023-10-20 12:32:22 -07:00
Laurent Nguyen
2d3048eafe Fabric: handle resource tokens (#1667)
* Update contracts for new all resource messages

* Add timestamp to token message signature

* Reconstruct resource tree with databases and collections parsed from token dictionary keys

* Create FabricDatabase and FabricCollection to turn off interaction

* Remove unnecessary FabricCollection derived class

* Handle resource tokens

* Bug fix

* Fix linting issues

* Fix update document

* Fix partitition keys

* Remove special case for FabricDatabase tree node

* Modify readCollections to follow normal flow with Fabric

* Move fabric databases refresh to data access and remove special case in Explorer

* Revert Explorer.tsx changes

* Disable database context menu and delete container context menu

* Remove create database/container button for Fabric

* Fix format

* Renew token logic

* Parallelize read collections calls to speed up

* Disable readDatabaseOffer, because it is too slow for now

* Reduce TOKEN_VALIDITY_MS a bit to make sure renewal happens before expiration. Receving new tokens new refreshes databases

* Add container element for Main app in HTML

* Do not handle "openTab" message anymore

* Fix style of main div

* Simplify conditional load of the fabric .css

* Fix format

* Fix tsc can't find dynamic less import

---------

Co-authored-by: Armando Trejo Oliver <artrejo@microsoft.com>
2023-10-19 23:12:52 +02:00
Asier Isayas
8075ef2847 Upgrade Cosmos SDK to 4.0.0 (#1664)
* upgrade cosmos sdk to 4.0.0

* added explicit any test

* fixed package-lock.json

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2023-10-19 15:22:12 -04:00
Asier Isayas
94158504a8 Cancel query timeout (#1651)
* cancel query option

* query timeout

* run prettier

* removed comments

* fixed npm run compile errors

* fixed tests

* fixed unit test  errors

* fixed unit test  errors

* fixed unit test  errors

* fixed unit test  errors

* fixed unit test  errors

* increased min timeout

* added automatican cancel query option

* added react string format

* npm run format

* added unless automatic cancellation has been enabled

---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2023-10-19 13:21:39 -04:00
Laurent Nguyen
9b032ecae4 Turn off "New Database" for Fabric (#1663)
* Turn off "New Database" for Fabric

* Fix format
2023-10-18 08:30:45 +00:00
jawelton74
14d7677056 Add feature for disabling connection string login and enable this for aad redirect. (#1660)
* Add redirect for /aad to /?feature.enableAadDataPlane=true

* Add feature to hide the connection string login link. Enable this new
feature for the aad redirect.
2023-10-16 13:18:40 -07:00
sunghyunkang1111
d376a7463c P1, P2 bug fixes for private preview (#1657)
* P1 bug fix for private preview

* Add updated snapshot files

* Fix failing unit test

* Fix unit tests and update snapshot
2023-10-12 21:54:01 -05:00
Laurent Nguyen
9669301d14 Remove obsolete unit test (#1655) 2023-10-12 08:00:08 +02:00
Laurent Nguyen
dcd8d1637b Implement retrieval of authorization token for Fabric via iframe rpc (#1647)
* For Fabric, send message to get Authorization token from iframe parent

* tokenProvider: set date header and return token

* Expect account endpoint on initialize message from Fabric

* Fix format

---------

Co-authored-by: artrejo <artrejo@microsoft.com>
2023-10-10 12:25:58 -07:00
Laurent Nguyen
f36fccd3ef Auto-select first item in DocumentsTab. Fix selection highlighting (#1645)
* Auto-select first document in documentsTab

* Fix style row selection by making selector more specific
2023-10-10 07:19:35 +02:00
jawelton74
8ff9a84004 Add redirect for /aad to /?feature.enableAadDataPlane=true (#1649) 2023-10-09 11:31:36 -07:00
sunghyunkang1111
e42e24b175 Redesign copilot (#1650)
* Add copilot toggle button

* take out toggle button when closing tab

* Update snapshots

* Fix the prettier issue

* fix prettier
2023-10-09 12:42:25 -05:00
Laurent Nguyen
44d6f29edd Revert "For Fabric, send message to get Authorization token from iframe parent"
This reverts commit 9db06af552.
2023-10-06 14:35:30 +00:00
Laurent Nguyen
9db06af552 For Fabric, send message to get Authorization token from iframe parent 2023-10-06 14:33:46 +00:00
Asier Isayas
3754d2c32c Cancel Query Option (#1646)
* cancel query option
---------

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2023-10-05 10:37:59 -04:00
FAIZ CHACHIYA
ca861a0d77 For connection-string based authentication, the request would be made… (#1644)
* For connection-string based authentication, the request would be made with low priority request header and for AAD based authentication, users can select the priority-request option from the settings panel

* removed unused imports

* prettier checks

---------

Co-authored-by: Faiz Chachiya <faizchachiya@microsoft.com>
2023-10-04 14:18:54 -07:00
JustinKol
07d242f972 Fixed setup save queries within serverless accounts (#1626)
* Fixed setup save queries within serverless accounts

* Fixed format

* ran prettier
2023-10-04 14:23:22 -04:00
sunghyunkang1111
68b45e77a8 clear query results and handle error with no query generated (#1640)
* clear query results and handle error with no query generated

* clear query results and handle error with no query generated

* Update the query guidelines link

* Update the query guidelines link
2023-10-04 12:20:56 -05:00
JustinKol
12e8490350 Copy json results button (#1631)
* copy json button

* fixed formating issue

* moved icon to float right

* fixed formatting
2023-10-03 15:01:05 -04:00
Laurent Nguyen
90c1439d34 Update prettier to latest. Remove tslint (#1641)
* Rev up prettier

* Reformat

* Remove deprecated tslint

* Remove call to tslint and update package-lock.json
2023-10-03 17:13:24 +02:00
sunghyunkang1111
e3c168b7be Reset the state to initial query every time (#1635) 2023-10-02 11:28:37 -05:00
sunghyunkang1111
9ad9f7bf51 Add word wrap for the query explanation (#1634)
* Add word wrap for the query explanation

* Update test snap
2023-10-02 11:28:25 -05:00
sunghyunkang1111
332554e21c Disable query saving for copilot private preview (#1633) 2023-10-02 11:28:12 -05:00
sunghyunkang1111
9981889120 Fit content to modal (#1632)
* Fit content to modal

* update test snap
2023-10-02 11:27:58 -05:00
Laurent Nguyen
d2beea3b06 Update package-lock.json to fix dependencies resolution (#1639) 2023-09-29 20:33:01 +02:00
sunghyunkang1111
4f9054ef37 update graph endpoint (#1637) 2023-09-28 13:42:40 -05:00
Laurent Nguyen
d9e142d7a6 Initial implementation of two-way communication with Fabric host (#1622)
* Listen to iframe messages. Test posting message.

* Plug new container message to show New Container dialog

* Rename message action to type

* Fix format

* Fix format

* Remove console.log() statement

* Rework fabric init flow. Implement open Collection Tab from fabric.

* Rename method to better match its purpose

* Update src/hooks/useKnockoutExplorer.ts

Use connectionString from message

Co-authored-by: Vsevolod Kukol <sevoku@microsoft.com>

* Fix format

* For openTab action open first collection if not specified. Clean up FabricContract.

* Reformat FabricContracts

* Highlight current node selection using them token

* Reformat

* Automatically expand nodes in resource tree if underlying database or collection is expanded. Fix AllowedOrigins. Cleanup code.

* Fix format

* Fix lint issue

* Don't show the home screen for Fabric (#1636)

* Fix formatting

* Database name to open can be overridden by value in session storage

---------

Co-authored-by: Vsevolod Kukol <sevoku@microsoft.com>
2023-09-28 17:26:50 +02:00
sunghyunkang1111
dfdb44bdc9 fix preview links (#1629)
* fix preview links

* fix preview links
2023-09-27 19:59:33 -05:00
MokireddySampath
0a06c1c4f6 Changes made for the screenreader to readout the label and suffix ass… (#1437)
* Changes made for the screenreader to readout the label and suffix associated with the input

* Update SubSettingsComponent.tsx

* Update SubSettingsComponent.tsx

* Update SubSettingsComponent.tsx

* Update SubSettingsComponent.test.tsx.snap

* Update SubSettingsComponent.tsx

* Update SubSettingsComponent.test.tsx.snap

* Update SubSettingsComponent.test.tsx.snap

* Update SubSettingsComponent.tsx

* Update SubSettingsComponent.test.tsx.snap
2023-09-27 20:49:19 +05:30
MokireddySampath
73b6bdcd3a defect2262640 (#1476)
* arialabel has been added to close button of invitational youtube video

* heading role has been addedd and tag has been changed to h1

* outline has been restored to choose columns link in entities page

* Update QuickstartCarousel.tsx

* Update SplashScreen.tsx

* Update TableEntity.tsx

* outline for edit entity has been added on focus

* keyboard accessibility added to rows in table entities

* learn more link under analytical store

* Column header is populated with text

* aria label has been changed for  the screen readers to read placeholder text along with label text

* Update queryBuilder.less

* Update TableEntity.tsx

* Update ThroughputInputAutoPilotV3Component.tsx

* Update ThroughputInputAutoPilotV3Component.tsx

* Update ThroughputInputAutoPilotV3Component.test.tsx.snap

* Update ThroughputInput.less

* Update PanelComponent.less

* Update DataTableBindingManager.ts

* Update AddCollectionPanel.tsx

* Update AddCollectionPanel.test.tsx.snap

* spec.ts files updated for the tests

* update to container.spec files

* Update container.spec.ts

* Update container32.spec.ts

* Update AddCollectionPanel.tsx

* Update AddCollectionPanel.tsx

* Update AddCollectionPanel.test.tsx.snap

* Update container.spec.ts

* Update container.spec.ts

* Update container32.spec.ts

* Update container.spec.ts

* Update container.spec.ts
2023-09-27 20:47:40 +05:30
MokireddySampath
492c42ccda info button in stats tab is made accessible with keyboard (#1503)
* arialabel has been added to close button of invitational youtube video

* heading role has been addedd and tag has been changed to h1

* outline has been restored to choose columns link in entities page

* Update QuickstartCarousel.tsx

* Update SplashScreen.tsx

* Update TableEntity.tsx

* outline for edit entity has been added on focus

* keyboard accessibility added to rows in table entities

* learn more link under analytical store

* Column header is populated with text

* aria label has been changed for  the screen readers to read placeholder text along with label text

* Update queryBuilder.less

* Update TableEntity.tsx

* Update ThroughputInputAutoPilotV3Component.tsx

* Update ThroughputInputAutoPilotV3Component.tsx

* Update ThroughputInputAutoPilotV3Component.test.tsx.snap

* Update ThroughputInput.less

* Update PanelComponent.less

* Update DataTableBindingManager.ts

* Update AddCollectionPanel.tsx

* Update AddCollectionPanel.test.tsx.snap

* spec.ts files updated for the tests

* update to container.spec files

* info button in stats tab is made accessible with keyboard

* Update AddCollectionPanel.tsx

* Update AddCollectionPanel.tsx

* Update AddCollectionPanel.test.tsx.snap

* Update container.spec.ts

* Update container.spec.ts

* Update container.spec.ts

* Update container32.spec.ts

* Update container.spec.ts

* Update container.spec.ts

* info icons are added as a column item and keyboard focus has been added to them

* Update QueryTabComponent.tsx
2023-09-27 20:47:10 +05:30
MokireddySampath
e48402ae1b Focus order not logical on invoking entities in table (#1505)
* arialabel has been added to close button of invitational youtube video

* heading role has been addedd and tag has been changed to h1

* outline has been restored to choose columns link in entities page

* Update QuickstartCarousel.tsx

* Update SplashScreen.tsx

* Update TableEntity.tsx

* outline for edit entity has been added on focus

* keyboard accessibility added to rows in table entities

* learn more link under analytical store

* Column header is populated with text

* aria label has been changed for  the screen readers to read placeholder text along with label text

* Update queryBuilder.less

* Update TableEntity.tsx

* Update ThroughputInputAutoPilotV3Component.tsx

* Update ThroughputInputAutoPilotV3Component.tsx

* Update ThroughputInputAutoPilotV3Component.test.tsx.snap

* Update ThroughputInput.less

* Update PanelComponent.less

* Update DataTableBindingManager.ts

* Update AddCollectionPanel.tsx

* Update AddCollectionPanel.test.tsx.snap

* spec.ts files updated for the tests

* update to container.spec files

* info button in stats tab is made accessible with keyboard

* focus order after invoking entities has been made to move logicallt from the entities tab instead of the table getting focus

* Update AddCollectionPanel.tsx

* Update AddCollectionPanel.test.tsx.snap

* Update QueryTabComponent.tsx

* Update container.spec.ts

* Update container.spec.ts

* Update container.spec.ts

* Update container32.spec.ts

* Update container.spec.ts

* Update container.spec.ts

* Update DataTableBindingManager.ts
2023-09-27 20:46:45 +05:30
MokireddySampath
a3bd126a21 Dialog box of azure synapse closes on pressing escape button (#1543) 2023-09-27 20:46:26 +05:30
MokireddySampath
d15feb3478 arialabel has been changed according to react attributes (#1548) 2023-09-27 20:46:04 +05:30
MokireddySampath
cbc722031c defect2278312 (#1473)
* arialabel has been added to close button of invitational youtube video

* heading role has been addedd and tag has been changed to h1

* outline has been restored to choose columns link in entities page

* Update QuickstartCarousel.tsx

* Update SplashScreen.tsx

* Update TableEntity.tsx

* outline for edit entity has been added on focus

* keyboard accessibility added to rows in table entities

* learn more link under analytical store

* Update queryBuilder.less

* Update TableEntity.tsx

* Update PanelComponent.less

* Update DataTableBindingManager.ts

* Update DataTableBindingManager.ts
2023-09-27 20:45:25 +05:30
MokireddySampath
b9d93c7070 dropdown,input elements have been updated to grasp screenreaderconten… (#1440)
* dropdown,input elements have been updated to grasp screenreadercontent for all the elements

* Update EntityValue.tsx

* Update TableEntity.tsx

* Update AddTableEntityPanel.tsx

* entityvalue.tsx has been removed from tsconfig.strict file since the changes for the files are not getting compiled
2023-09-27 20:40:52 +05:30
MokireddySampath
9c04cfcc18 outline invisible on higher contrast themes (#1469)
* arialabel has been added to close button of invitational youtube video

* heading role has been addedd and tag has been changed to h1

* outline has been restored to choose columns link in entities page

* header text color changed to meet luminosity ratio requirement

* capacity calculator link has been added with underline on focus

* add property is readout twice while using screenreader

* arialabel added to the add property button

* screenreader content changed to announce the entire alert

* focus indicator outline invisbile on higher contrast themes

* Update fulldatatables.less

* Update queryBuilder.less

* Update queryBuilder.less

* Update TableEntity.tsx

* Update ThroughputInput.less

* Update ThroughputInput.tsx

* Update ThroughputInput.test.tsx.snap

* Update NewVertexComponent.tsx

* Update PanelInfoErrorComponent.tsx

* Update RightPaneForm.tsx

* Update AddTableEntityPanel.tsx

* Update SplashScreen.tsx

* Update QuickstartCarousel.tsx

* Update AddTableEntityPanel.test.tsx.snap
2023-09-27 20:40:19 +05:30
FAIZ CHACHIYA
7b568df150 Walmart enable priority based execution feature (#1625)
* changed the variable enablePriorityBasedThrottling to enablePriorityBasedExecution

* Update the arm client version to '2023-09-15-preview' to fetch the status for the 'enablePriorityBasedExecution' property and performed the respective changes for priority based execution to grab the changes from the DatabaseAccount data model

* formatting changes to all the committed files

* review comments - removed the variable and added the check in the if loop itself

* check style changes

---------

Co-authored-by: Faiz Chachiya <faizchachiya@microsoft.com>
2023-09-25 22:41:46 +05:30
sunghyunkang1111
5c7c0eae61 rollback msgraph changes (#1628) 2023-09-25 12:08:56 -05:00
Laurent Nguyen
16b05c2a75 Prevent prettier from converting CRLF to LF (#1624) 2023-09-25 18:09:53 +02:00
Armando Trejo Oliver
bb82915cc6 Add wildcard to allow any fabric test origin (#1617) 2023-09-24 17:53:55 -07:00
bogercraig
c59d31f4c0 File Upload Tooltip (#1621)
* Added tooltip to the filename and status columns.  There is an InfoTooltip function that can reduce the boilerplate.

* Changed tooltip to be constructed with the DetailsList column and changed orientation to rightCenter.
That orientation prevents issues with topCenter orientation getting off center from the width of the cell.
Also looks a bit nicer, but will get feedback.

* Updated formatting.

* Removing uneccessary column formatting.

---------

Co-authored-by: Craig Boger <craig.boger@microsoft.com>
2023-09-20 19:34:22 -04:00
sunghyunkang1111
8fa2721eab Update graph endpoint (#1623)
* Update graph endpoint

* Update graph endpoint
2023-09-20 10:39:37 -05:00
vchske
754354dbf9 Adds unit tests for vcore quickstart feature code (#1618)
* Safety checkin

* Adding vcoremongo to Main

* Safety checkin

* Adding vcoremongo to Main

* Safety commit

* Safety checkin

* Adding vcoremongo to Main

* Safety commit

* Integrating mongo shell

* Safety checkin

* Adding vcoremongo to Main

* Safety commit

* Integrating mongo shell

* Safety checkin

* Safety commit

* Enable mongo shell in its own tab

* Safety checkin

* Adding vcoremongo to Main

* Safety commit

* Integrating mongo shell

* Safety checkin

* Safety commit

* Safety commit

* Integrating mongo shell

* Safety checkin

* Safety commit

* Enable mongo shell in its own tab

* Adding message

* Integrated mongo shell

* Moving Juno endpoint back to prod

* Fixed command bar unit tests

* Fixing spelling

* Adds unit tests for vcore quickstart feature code

* Fix lint
2023-09-19 17:12:41 -07:00
vchske
ae5811306b Minor QOL changes (#1619) 2023-09-19 17:06:40 -07:00
Armando Trejo Oliver
f84deea9bc Fix query copilot help links (#1620) 2023-09-19 14:40:57 -07:00
Predrag Klepic
260c99e15c [Query Copilot V2] Explanation bubble added buttons (#1609)
* Fixing naming convention

* Additional implementation for Explanation

* Added snaps

* Removing snapshots

* re-updated snapshots

---------

Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-09-19 10:17:51 +02:00
v-darkora
c1c12019da Add feature flag for fixed output editor height or calculated height (#1606) 2023-09-18 11:30:17 +02:00
Armando Trejo Oliver
4e5358185f Add Fabric edog origin to allowed ancestors (#1616) 2023-09-16 19:45:07 -07:00
Vsevolod Kukol
b4bc93ac03 Fix active tabs border on Fabric (#1614) 2023-09-15 22:15:33 +02:00
Vsevolod Kukol
c61788198f Allow iframe within Fabric Extension iframe (#1613) 2023-09-15 21:44:44 +02:00
Vsevolod Kukol
379395567c Initial Fabric support (#1607)
* Add Platform.Fabric to run in context of Fabric

* Use separate StyleConstants

We want to have more flexibility with Styles at runtime
but Constants depend on ConfigContext and therefore
get loaded very early at startup.

* Add Fabric specific styles and Fluent theme

documentDBFabric.less contains all styles for Fabric.
We use React.lazy to import them conditionally at
runtime preventing webpack from preprocessing
them into main.css.

* Restyle CommandBar for Fabric
with more roundness and native colors.

* Disable Notebooks when running in Fabric

* Disable Synapse and Scripts commands for Fabric

* Fix code formatting issues

* Fetch encrypted token from sessionStorage for fabric platform

* Fix Tabs style

* Dark refresh icons for Fabric

* Use new ResourceTree2 for Fabric

* Fluent tree should have a fixed width
otherwise the action buttons jump around on hover.

* Disable remaining Script actions in Fabric

* Revert accidentally committed change
which broke a test

* Fix cross-origin error second try

* Adjust @FabrixBoxMargin css

* Hide Database Scale node on Fabric

* Remove all Collection child nodes on Fabric

* Add a comment about why we need FabricPlatform.tsx

* Fix equality checks

* Fix more Colors for Fabric

* Switch resource tree to "medium" size

* Fix formatting again

* Fix formatting again

* Disable no-var-requires error on some intended var import.

* Increase memory limit for build

* Use standard Segoe UI font for Fabric

* Improve Tabs design for Fabric

* Fix active Tab style bug in Portal
introduced with 39a7765aef

---------

Co-authored-by: Laurent Nguyen <laurent.nguyen@microsoft.com>
2023-09-15 17:33:27 +02:00
Laurent Nguyen
c2d2ff3dee Update CSP header in web.config to allow iframe within fabric (#1611) 2023-09-15 06:58:15 +02:00
sindhuba
53fd738982 Add additional checks for NPS survey (#1610)
* Add additional checks for NPS survey

* Fix variable name

* Fix lint errors
2023-09-14 11:53:42 -07:00
vchske
c07000a5c2 Adding vcore mongo quickstart (#1600)
* Safety checkin

* Adding vcoremongo to Main

* Safety checkin

* Adding vcoremongo to Main

* Safety commit

* Safety checkin

* Adding vcoremongo to Main

* Safety commit

* Integrating mongo shell

* Safety checkin

* Adding vcoremongo to Main

* Safety commit

* Integrating mongo shell

* Safety checkin

* Safety commit

* Enable mongo shell in its own tab

* Safety checkin

* Adding vcoremongo to Main

* Safety commit

* Integrating mongo shell

* Safety checkin

* Safety commit

* Safety commit

* Integrating mongo shell

* Safety checkin

* Safety commit

* Enable mongo shell in its own tab

* Adding message

* Integrated mongo shell

* Moving Juno endpoint back to prod

* Fixed command bar unit tests

* Fixing spelling
2023-09-12 18:03:59 -07:00
Armando Trejo Oliver
135a409f0c Enable copilot by default (#1608) 2023-09-12 15:40:26 -07:00
Laurent Nguyen
93b0101d4c Create new ResourceTree based on FluentUI Tree (#1603)
* Alternate tree running fluentui v9 Tree component

* Fix tree update after sp, udf and trigger load

* Enable scrolling for subtrees

* Clean up duplicates

* Restore current tree

* Reformat

* Update package-lock.json
2023-09-12 17:23:13 +02:00
v-darkora
0408a53121 Change deafult schema feature flag (#1604) 2023-09-12 07:17:10 -07:00
Predrag Klepic
12ed591634 Adjusted Extecute Query logic (#1605)
Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-09-11 17:22:30 +02:00
Predrag Klepic
76408e2f98 [Query Copilot V2] Wire and adjust Output bubble with backend communication (#1599)
* Initial wiring of copilot backend and bubble

* Additional changes in explanation bubbles

* Changes based on checks

* test snapshots updated

---------

Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-09-06 19:49:27 +02:00
sindhuba
8c2ca4ab8e Support NPS for PostGres (#1598) 2023-09-06 08:22:54 -07:00
vchske
98bf84d09d Adding contract to open vcore mongo connection string blade (#1601)
* Adding a contract to open vcore mongo networking blade

* prettier fix

* Adding contract to open vcore mongo connection string blade
2023-09-01 16:37:24 -07:00
bogercraig
d4c831ff91 Users/bogercraig/blank ttl default value (#1596)
* Initial rough of keeping textfield blank.  Still need to disable save button.

* Rough implementation with state moved up to settings component.  Allows for discarding of new TTL when TTL is already enabled.

* Updating unit tests to include new display variable.

* Brought formatting back from master.

* Updating unit test snapshots.

* Ran prettier and renormalized modified files.

* Correct lint issues.

* Undo prettier changes to add collection code and testing snapshot.

* Restoring AddCollectionPanel to match master.  Not modifying snapshot.

---------

Co-authored-by: Craig Boger <craig.boger@microsoft.com>
2023-09-01 14:46:49 -04:00
vchske
1eb566ab57 Adding a contract to open vcore mongo networking blade (#1597)
* Adding a contract to open vcore mongo networking blade

* prettier fix
2023-08-31 17:50:15 -07:00
Predrag Klepic
d155407b58 [Query Copilot] Phoenix Gateway flag true by default (#1595)
* Phoenix Gateway flag true by default

* Additional changes for clearness

* removal of console log

---------

Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-08-31 17:01:11 -07:00
Karthik chakravarthy
f8ff0626d9 Remove token from the URL for the websocket connections (#1591) 2023-08-30 15:54:20 -04:00
Predrag Klepic
c8e7e69aa5 [Query Copilot] Phoenix container implementation (#1594)
* Phoenix implementation

* removing comments

---------

Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-08-30 16:50:55 +02:00
Predrag Klepic
b992742e20 [Query Copilot] Explanation bubble implementation (#1586)
* Explanation bubble implementation

* Explanation bubble unit tests

* Merged with main

* updated snapshot

---------

Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-08-30 13:08:58 +02:00
v-darkora
0207f3cc04 Fix teaching bubble timeout display (#1593) 2023-08-29 16:15:23 +02:00
v-darkora
6a8e87f45f [Query Copilot v2] Implementing output bubble (#1587)
* Implementing output bubble

* Fix lint

* Run prettier
2023-08-29 08:56:53 +02:00
sindhuba
f7370fd341 Remove NPS feature flag (#1592)
* Remove NPS feature flag

* Fix comment on indentation
2023-08-28 11:06:59 -07:00
Predrag Klepic
425e375d50 Reintroduce feature flags (#1590)
Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-08-28 16:56:13 +02:00
Armando Trejo Oliver
55846b98bd Send undefined poolId instead of "default" pool (#1589) 2023-08-24 16:05:09 -07:00
Armando Trejo Oliver
3d02f07262 Add poolId as parameter to allocateContainer (#1588) 2023-08-24 12:56:31 -07:00
Predrag Klepic
449118a1bf [Query Copilot] V2 Backend integration (#1584)
* Initial implementetation of backend integration

* Added parameters and interfaces moved

* Initial client implementation

* Additional changes for React FC's

* Updated snapshot of Footer

* Additional Copilot implementation

* Test adjustments and client implementation

* Additional test implementations

* Naming convetion for functions

* Changing {} to any

* Additional changes to the type

* Additional test changes

* Removal of prevention

* adding comment

* Additional changes to tests

* Moving logic based on comments

* client implementation along with corrected tests

---------

Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-08-24 09:07:29 +02:00
jawelton74
8405dbe8da Fix spelling of Refresh for self-serve blades. (#1585) 2023-08-23 16:56:12 -07:00
v-darkora
19100ec437 [Query Copilot V2] Unit tests for V2 Copilot (#1580)
* Add tests for V2 of copilot and fix query parameter feature flag

* Fix merge changes
2023-08-21 16:29:00 +02:00
Predrag Klepic
ebd40cb9b0 [Query Copilot] Query Copilot button dropdown and shortcut (#1582)
* Copilot dropdown implementation

* additional changes

* added unit test for key event

* Additional test changes

---------

Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-08-21 16:17:06 +02:00
Predrag Klepic
986dbe7d54 [Query Copilot] Adding feature flags for phoenix and Schema (#1583)
* Adding feature flags for phoenix and schema

* Feedback uri modified

* Additional Constant changes

* Reverting PriorityLevel

* Additional changes in tests

---------

Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-08-21 16:16:32 +02:00
Predrag Klepic
143f7d8f2c [Query Copilot] Copilot V2 Retrieving bubble (#1579)
* Changing order of the features

* test name changed

* updates snapshots

* Bubble implementation

* Bubble tests implemented

* Correction for CopilotSampleDB implementation

* rollback to previous query tab changes

---------

Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-08-21 11:19:04 +02:00
FAIZ CHACHIYA
b646f9f4cb Wmt priority execution feature (#1546)
* Execute the queries with high/low priority

* improvement made to the Cosmos client and created separate plugin class for setting priority header

* added test cases for the priority execution utility

* removed unwanted code

* fix compile time issues

* fix compile time issues

* fixed lint and stylinkg issues

* fixed lint and styling issues

* skip the lint check for src/Utils/PriorityBasedExecutionUtils.ts

* incorporating review comments, added the default priority level changes

* changed the priority to default instead of low

* removed the unwanted if condition

---------

Co-authored-by: Faiz Chachiya <faizchachiya@microsoft.com>
2023-08-18 15:40:35 +05:30
Predrag Klepic
0f52db73e7 [Query Copilot] Fix failing comparison for CopilosSampleDB (#1581)
* Fix failing comparison for CopilosSampleDB

* using constant

---------

Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-08-18 10:48:18 +02:00
Predrag Klepic
9c1b9e6ff6 [Query Copilot] Allocation of container and copilot request sent to Phoenix endpoint (#1576)
* Switch to tools federation endpoints for query copilot

* Remove extra / in url

* Initial allocateContainer implementation

* Additional feedback modal changes

* updated tests

* PhoenixClient reverted to previous endpoint

* Changes based on PR comments

* Update based on tests

* updated endpoint

* Back to previous implementation and test improve

* removing notebook

---------

Co-authored-by: Victor Meng <vimeng@microsoft.com>
Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-08-18 10:47:19 +02:00
MokireddySampath
19041ffedd Border at the bottom has been added for the tabs to differntiate from unselected tabs (#1509)
* Border at the bottom has been added  for the tabs to differntiate from unselected tabs while using contrast themes

* Update Tabs.tsx

* Update Tabs.tsx
2023-08-17 23:11:25 +05:30
v-darkora
ceb66ed5b8 [Query Copilot V2] Restructure code for V2 of copilot (#1577)
* Initial folder and code restructure

* Add snapshots

* Remove flag for local testing

* Remove unnecessary code

* Fix snapshot

* Update tests
2023-08-16 10:10:21 +02:00
Predrag Klepic
96b88ac344 [Query Copilot] Version 2 initial code (#1566)
* Query Copilot Sidecar initial commit

* additional improvements with the Welcome pop

* Additional implementation and messages for sidecar

* introducing copilot version

* Renaming from car to bar

* Image names changed

* fixing PR errors

* additional changes related with the versions

* Additional implementations and fixes

* Removing unused interface

* Additional styling changes and state management

* Additional changes related with Sidebar

---------

Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-08-15 10:01:07 +02:00
MokireddySampath
bcedf0a29f Max value has been added to throughput for unsharded and sharded collections (#1506)
* arialabel has been added to close button of invitational youtube video

* heading role has been addedd and tag has been changed to h1

* outline has been restored to choose columns link in entities page

* Update QuickstartCarousel.tsx

* Update SplashScreen.tsx

* Update TableEntity.tsx

* outline for edit entity has been added on focus

* keyboard accessibility added to rows in table entities

* learn more link under analytical store

* Column header is populated with text

* aria label has been changed for  the screen readers to read placeholder text along with label text

* Update queryBuilder.less

* Update TableEntity.tsx

* Update ThroughputInputAutoPilotV3Component.tsx

* Update ThroughputInputAutoPilotV3Component.tsx

* Update ThroughputInputAutoPilotV3Component.test.tsx.snap

* Update ThroughputInput.less

* Update PanelComponent.less

* Update DataTableBindingManager.ts

* Update AddCollectionPanel.tsx

* Update AddCollectionPanel.test.tsx.snap

* spec.ts files updated for the tests

* update to container.spec files

* info button in stats tab is made accessible with keyboard

* focus order after invoking entities has been made to move logicallt from the entities tab instead of the table getting focus

* For unsharded collections the max value has been added

* Update AddCollectionPanel.tsx

* Update AddCollectionPanel.test.tsx.snap

* Update DataTableBindingManager.ts

* Update QueryTabComponent.tsx

* Update QueryTabComponent.tsx

* Update container.spec.ts

* Update container.spec.ts

* Update container32.spec.ts

* Update container.spec.ts

* Update container.spec.ts
2023-08-14 21:51:58 +05:30
MokireddySampath
67133017ce Defect2266802 (#1455)
* arialabel has been added to close button of invitational youtube video

* heading role has been addedd and tag has been changed to h1

* outline has been restored to choose columns link in entities page

* header text color changed to meet luminosity ratio requirement

* Update queryBuilder.less

* Update TableEntity.tsx

* Update QuickstartCarousel.tsx

* Update SplashScreen.tsx

* Update SplashScreen.tsx
2023-08-14 21:50:24 +05:30
MokireddySampath
b5d7ab0a30 Improper arialabel aria-name has been removed (#1561) 2023-08-14 21:49:15 +05:30
MokireddySampath
6dba4937ce Fix 1586730 : WCAG 4.1.1: Ensures every id attribute value used in ARIA and in labels is unique (input[aria-labelledby="TextFieldLabel339"]) (#1562)
* id has been removed for the input elements in add table row dialog since they have no significance in selection of elements and they are repetetive which is not a good practice

* Update EntityValue.tsx

* Update EntityValue.tsx
2023-08-14 21:48:48 +05:30
MokireddySampath
1a3ca94efb Bug 2262682:Screen reader is not announcing the updated deleting status information after deleting the container. (#1563) 2023-08-14 21:48:25 +05:30
Predrag Klepic
9f7783f3f9 [Query Copilot] Revise Copilot UI texts (#1569)
* Revise Copilot UI texts

* Test snapshots updated

---------

Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-08-09 21:43:55 +02:00
sindhuba
daa26d289b Fix sendMessage in DE (#1570)
* Fix issue in sendMessage in DE

* Run npm format
2023-08-09 09:28:25 -07:00
sindhuba
879cb08949 Fix issue with feature flag (#1567) 2023-08-08 08:03:42 -07:00
sindhuba
92f43c28a7 Add logic in DE to show NPS Survey (#1565)
* Send messages from DE to Portal to display NPS Survey

* Address comments
2023-08-04 13:24:30 -07:00
bogercraig
5f0c7bcea2 Users/bogercraig/endpointvalidation (#1554)
* Adding example endpoint with trailing forward slash.

* Move backend and ARM endpoint validation to configContext for initialization from config.json.

* Added debugging script and attempts to relocate endpoint validation list.

* Move default endpoint list to endpoint validation code and allow falling back to the default list during unit tests if configContext is not initialized.

* Remove leftover debugger statements.

* Remove test debug script in package.json for debugging unit tests in browser.

* Run prettier on modified files.

* Overwriting with package.json from master.

* Overwriting with version from master.

* Remove test ARM endpoint.

* Replace ternary operator with || for more concise arguments per Victor's feedback.

---------

Co-authored-by: Craig Boger <craig.boger@microsoft.com>
2023-08-03 14:47:50 -04:00
Predrag Klepic
fa55d528ad [Query Copilot] Maintain Query Copilot state when switching tabs (#1559)
* Sample implementation for saving states

* Maintaining Query Copilot state

* Fixing failed PR checks

* Additional changes based on checks

* snapshots updated

* Changes based on merging previous PR

* test mock changed

* Fixing minor bug for close button

* Destruct of queryCopilotState

* passing only function in Tabs component

* Maintaining copilot state with zustand store

* additional test changes

* test snapshot updated

---------

Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-08-03 09:23:31 +02:00
Predrag Klepic
c873fed7aa Disable Query Copilot Tab flickering (#1564)
Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-08-02 17:37:37 +02:00
v-darkora
7ec5290293 [Query Copilot] Update feature flag after sample data connection info fetch (#1560)
* Update feature flag if sample data exists

* Add additional conditional

* Revert useknockout to starting condition

* Use tracked property for rendering conditiona
2023-07-28 09:43:12 +02:00
v-darkora
4005128211 [Query Copilot] Add telemetry for query copilot (#1555) 2023-07-27 11:41:41 -07:00
v-darkora
38d13cc74e [Query Copilot] Generate query on enter (#1558) 2023-07-27 10:45:42 -07:00
Predrag Klepic
4ab93a5a32 [Query Copilot] Updated Copilot links (#1556)
Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-07-27 10:43:24 -07:00
Predrag Klepic
44e25c0769 [Query Copilot] New Query button added on Items section (#1552)
Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-07-27 10:42:17 -07:00
MokireddySampath
8ea8f0230f role has been changed to heading (#1453)
* arialabel has been added to close button of invitational youtube video

* heading role has been addedd and tag has been changed to h1

* Update QuickstartCarousel.tsx

* Update QuickstartCarousel.tsx

* Update SplashScreen.tsx
2023-07-27 07:30:27 +05:30
MokireddySampath
655b998b84 outline has been added to choose columns links (#1454)
* arialabel has been added to close button of invitational youtube video

* heading role has been addedd and tag has been changed to h1

* outline has been restored to choose columns link in entities page

* Update QuickstartCarousel.tsx

* Update SplashScreen.tsx

* Update TableEntity.tsx

* outline for edit entity has been added on focus
2023-07-27 07:29:54 +05:30
Predrag Klepic
9e2f6a9c89 [Query Copilot] QueryCopilotUtilities.ts tests (#1550)
* Improving test coverage

* Not leaving empty functions

* Additional test editing

* Correction of the unit test

* Changes made so the tests work correctly

* removing problematic tests

* QueryCopilotUtilities

* Changes based on Lint suggestion

* Changes based on lint

* Additional lint suggestion solved

* sample implementation

* removing console log

* Fixing non empty lint function error

* Changed any to void in mocked function

---------

Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-07-25 09:16:10 +02:00
Predrag Klepic
42e11d5160 [Query Copilot] Hide error message bar when request is successful (#1542)
Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-07-19 16:05:09 -07:00
Predrag Klepic
10037d844e [Query Copilot] Improving test coverage (#1539)
* Improving test coverage

* Not leaving empty functions

* Additional test editing

* Correction of the unit test

* Changes made so the tests work correctly

* removing problematic tests

---------

Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-07-19 10:13:04 +02:00
victor-meng
13434715b3 Properly check if a container is query copilot sample container (#1540) 2023-07-18 22:50:31 -07:00
v-darkora
676434cac5 [Query Copilot] Adding tests for the welcome modal (#1538) 2023-07-18 17:38:36 -07:00
Predrag Klepic
3d5580865a Query Results no longer blocked for clicking/copying content (#1537)
Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-07-17 11:15:01 -07:00
Predrag Klepic
7375cc717c [Query Copilot] Scrollable Copilot tab, improved history and minor fixes (#1536)
Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-07-17 11:10:41 -07:00
v-darkora
de3e56bb99 [Query Copilot] Add unit tests for Welcome Modal (#1535) 2023-07-14 15:18:38 -07:00
Predrag Klepic
53cd78452b [Query Copilot] Dropdown hide and buttons disabled in specific occasions (#1534)
Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-07-14 15:01:16 -07:00
v-darkora
fb6eb635c1 [Query Copilot] Handle response if it returns a 500 status (#1533) 2023-07-13 10:50:49 -07:00
v-darkora
fb6c0caca6 [Query Copilot] Update sample data resource tree item stylings (#1530)
* Update sample data resource tree item stylings

* Clean up sample data tree

---------

Co-authored-by: Victor Meng <vimeng@microsoft.com>
2023-07-13 09:17:29 +02:00
Predrag Klepic
e9f3c64239 [Query Copilot] Not disabling create database/container buttons for Sample Database (#1531)
Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-07-12 16:38:42 -07:00
MokireddySampath
bb6ee5deec Required attribute added for the input in delete dialog (#1524) 2023-07-12 22:30:23 +05:30
MokireddySampath
5796b28045 alt text added for the representative images in the splashscreen home page (#1525) 2023-07-12 22:30:04 +05:30
MokireddySampath
9635d14599 removing the connect value for ariacontrols variable (#1527) 2023-07-12 22:29:43 +05:30
MokireddySampath
c58d5765c2 aria label attribute updated with label name for the input (#1532) 2023-07-12 22:29:18 +05:30
victor-meng
708f4316b4 Fix "items" button in sample data resource tree does not open documents tab (#1528) 2023-07-11 16:35:54 -07:00
Karthik chakravarthy
cf0c51337f Change websocket authentication from url token to getting token from payload (#1487)
* Change websocket authentication from url to message body

* Add new message type

* Validation checks

* Remove flight and always send token in payload
2023-07-11 15:45:41 -04:00
victor-meng
1d6c0bbd1e Fix issue with executing queries in the query copilot tab (#1522) 2023-07-11 11:59:26 -07:00
Predrag Klepic
ed9ee07e81 Reverse cross partition query behavior in DE Query settings pane (#1521)
Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-07-10 11:30:53 -07:00
v-darkora
e9ea887fe7 [Query Copilot] Pass user email to query feedback (#1516)
* Pass user email to query feedback AB#2501550

* Await page.frame

* Make contact no by default

* Add hook to check if it sohuld render the modal in the main component
2023-07-10 10:59:05 +02:00
Predrag Klepic
b6d576b7b6 [Query Copilot] Resource tree styling and New query button (#1519)
* Styling implemented related with the work item

* Sample container New query button implementation

* Fixing related with the not rendering Sample Data

* Fix race condition when rendering sample data resource tree

* Remove export keyword for updateContextForSampleData

* Copilot New Query should open Copilot tab

* showing buttons in sample command bar

---------

Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
Co-authored-by: Victor Meng <vimeng@microsoft.com>
2023-07-10 09:14:14 +02:00
v-darkora
0eaa5d004b [Query Copilot] Pin panel footer to the bottom, remove gap between panel and console (#1511)
* Move footer when save button is enabled to the bottom, remove gap between notification console and right panel

* Change the way panel height is calculated

* Remove unnecessary operator

* Change condition

* Fix snapshot

* Update panel height after animation ends and use different css for showing save button to the bottom of the page

* Fix ts compile
2023-07-07 09:09:15 +02:00
v-darkora
3bef1ed136 [Query Copilot] Add learning bubble to query copilot input if text (#1507)
* Add learning bubble to query copilot input if user does not click for 30 seconds

* Change the way popup is shoed, on input changed update state
2023-07-07 09:08:41 +02:00
v-darkora
eb21193ae4 [Query Copilot] Disable command bar buttons when sample container is used (#1514)
* Disable command bar buttons when sample container is used and point only to copilot tab

* Make disabled assignement for buttons simmpler
2023-07-07 09:08:08 +02:00
v-darkora
90178178c4 [Query Copilot] Add toggle on feedback buttons (#1512)
* Add toggle on feedback buttons, clear state when new query generated or deleted

* Update test
2023-07-06 09:49:59 +02:00
v-darkora
ebfc9d4b36 Add welcome popop for query copilot (#1493) 2023-07-06 09:49:34 +02:00
sindhuba
4742ee0e7b Add new message type for NPS (#1520)
* Add new message type for NPS Survey

* Add new message type for NPS
2023-07-05 14:16:59 -07:00
sunghyunkang1111
b98829109e Do not show network connection message when securedbyperimeter (#1517) 2023-07-05 09:47:05 -05:00
jawelton74
ea4563f840 Initial commit. (#1518) 2023-07-05 07:36:21 -07:00
Predrag Klepic
3a961870d9 [Query Copilot] Polishing UI of Query Copilot (#1513)
* Implementation of filtering suggestion and history

* Error message if query is not received

* Exclamation mark on fail and button disabled

* Changed from hook to const for suggestions

* Test snapshots and formatting updated

* Fix based on comment

---------

Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-07-03 22:49:40 +02:00
Armando Trejo Oliver
ceed162491 Add Sample Data to Resource Tree (#1499)
* Add Sample Data to Resource Tree

* Format

* Fix strict build

* Fix lint

* Fixed implementation to show Sample data container

* Udated logic based on TokenCollection

* Re-configure copilot flag

---------

Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-06-29 17:47:46 +02:00
Predrag Klepic
f3c96b91bd [Query Copilot] Sample Prompt implementation and other (#1489)
* Sample Prompts and ComboBox implementation

* Adding DeletePopup and SamplePrompts

* Implementation of Delete/Copy code buttons

* Adjusted changes based on the comments for Modal

* Reverded implementation of inline prompt

* Updated function

* Replacing const to function

* Unused icons deleted

* Comments removed

* Additional styling based on designs

* Test snapshots

* Implementation of popup for copying code

* Tests updated/added

* Background color changed

* Resolving lint issue

* CopyPopup snapshot updated

* Merged with master

* Implementations fixed based on comments

* Test Snapshots updated

* Query copilot updated

* Resolving minor bug with Delete popup

---------

Co-authored-by: Predrag Klepic <v-prklepic@microsoft.com>
2023-06-28 10:11:03 +02:00
victor-meng
444f1b66fd Query copilot UI part 3 (#1490) 2023-06-27 13:43:10 -07:00
MokireddySampath
42e24d0e99 add property is readout twice while using screenreader (#1463)
* arialabel has been added to close button of invitational youtube video

* heading role has been addedd and tag has been changed to h1

* outline has been restored to choose columns link in entities page

* header text color changed to meet luminosity ratio requirement

* capacity calculator link has been added with underline on focus

* add property is readout twice while using screenreader

* Update fulldatatables.less

* Update queryBuilder.less

* Update TableEntity.tsx

* Update ThroughputInput.less

* Update ThroughputInput.tsx

* Update ThroughputInput.tsx

* Update ThroughputInput.test.tsx.snap

* Update QuickstartCarousel.tsx

* Update SplashScreen.tsx
2023-06-27 10:10:13 +05:30
MokireddySampath
c11b6838e5 aria label added to add property button (#1464)
* arialabel has been added to close button of invitational youtube video

* heading role has been addedd and tag has been changed to h1

* outline has been restored to choose columns link in entities page

* header text color changed to meet luminosity ratio requirement

* capacity calculator link has been added with underline on focus

* add property is readout twice while using screenreader

* arialabel added to the add property button

* Update fulldatatables.less

* Update queryBuilder.less

* Update TableEntity.tsx

* Update ThroughputInput.less

* Update ThroughputInput.tsx

* Update ThroughputInput.test.tsx.snap

* Update ThroughputInput.test.tsx.snap

* Update AddTableEntityPanel.tsx

* Update AddTableEntityPanel.test.tsx.snap

* Update QuickstartCarousel.tsx

* Update SplashScreen.tsx
2023-06-27 10:08:59 +05:30
MokireddySampath
1350122f76 arialabel has been added to close button of invitational youtube video (#1449) 2023-06-27 10:04:58 +05:30
MokireddySampath
7c88a4d65b defect2270063 (#1477)
* arialabel has been added to close button of invitational youtube video

* heading role has been addedd and tag has been changed to h1

* outline has been restored to choose columns link in entities page

* Update QuickstartCarousel.tsx

* Update SplashScreen.tsx

* Update TableEntity.tsx

* outline for edit entity has been added on focus

* keyboard accessibility added to rows in table entities

* learn more link under analytical store

* Column header is populated with text

* aria label has been changed for  the screen readers to read placeholder text along with label text

* role and alt text has been added to presentation images

* Update queryBuilder.less

* Update TableEntity.tsx

* Update ThroughputInputAutoPilotV3Component.tsx

* Update ThroughputInputAutoPilotV3Component.tsx

* Update ThroughputInputAutoPilotV3Component.test.tsx.snap

* Update ThroughputInput.less

* Update DataTableBindingManager.ts

* Update AddCollectionPanel.test.tsx.snap

* Update PanelComponent.less

* Update AddCollectionPanel.tsx
2023-06-26 23:55:00 +05:30
v-darkora
0b6cb8ee3d [Query Copilot] Adding loading spinner for Copilot tab (#1494)
* Add loading spinner for react tabs

* Run prettier and import useTabs instead of passing it
2023-06-26 09:13:30 +02:00
vchske
15e8c66aa4 Fix for softAllowedMaximumThroughput issue when using sdk (#1501) 2023-06-23 12:04:56 -07:00
victor-meng
c606d95765 Reset error state if query execution is successful (#1497) 2023-06-22 23:21:41 -07:00
sindhuba
8092841ce5 Improve error message while deleting a collection (#1495) 2023-06-21 15:04:36 -07:00
vchske
4617fa9364 Update throughput settings tab with new elasticity properties (#1461)
* Adding RU thermometer to settings throughput tab

* Finalizing RU thermometer on throughput settings

* Updated snapshot

* Fixing formatting

* Fixing lint errors

* Rerun prettier

* Fixing Offer properties

* Fixing Types

* Updating ARM clients, and enabling new elasticity properties

* Updating snapshots

* Updating an issue caused by updating ARM client

* Latest changes based on feedback

* Fixing lint and unit tests

* Minor fix

* Minor text change

* Changed some formatting
2023-06-16 15:54:29 -07:00
victor-meng
a282ad9242 integrate copilot UI with backend (#1478) 2023-06-16 00:25:23 -07:00
microsoft-github-policy-service[bot]
b954b14f56 Microsoft mandatory file (#1276)
Co-authored-by: microsoft-github-policy-service[bot] <77245923+microsoft-github-policy-service[bot]@users.noreply.github.com>
2023-06-08 18:32:42 -07:00
vchske
ed9c7dbb6b Text fix based on feedback (#1471) 2023-06-06 17:25:17 -07:00
victor-meng
aadbb50e7d Implement query copilot UI (#1452) 2023-06-06 11:43:53 -07:00
bogercraig
abff435e88 Hierarchical Partitioning - Expose container type and hashkey version for all containers. (#1458)
* Able to find needed data without RP calls.  Quick test blurb on settings page for SQL accounts.

* Added hierarchical partition message for SQL accounts.

* Rearranging import to match master and bypass auto formatting.

* Update snapshot tests with new partition hierarchy message.

* Updating formatting

---------

Co-authored-by: Craig Boger <craig.boger@microsoft.com>
2023-05-24 15:42:42 -04:00
sindhuba
d1c4059320 Fix gremlin timeout (#1457)
* Increase Gremlin request timeout from 6min to 1hr

* Increase query MAX_RESULT_SIZE limit from 10k to 100k.

* Run npm format

---------

Co-authored-by: Laurent Nguyen <laurent.nguyen@microsoft.com>
2023-05-23 13:49:40 -07:00
sunghyunkang1111
9b214a3171 Remove preview tag for hierarchical_partition_key (#1447)
* Remove preview tag for hierarchical_partition_key
2023-05-18 14:28:53 -05:00
MokireddySampath
ba66aa939b Defect 2280249 (#1432)
* autoscale and manual radiobuutton fixes

* alt text attribute for images

* Revert "alt text attribute for images"

This reverts commit 5a660551c6.

* alt text for decorative images

* sev2 accessibilitydefects in data explorer

* Commit to my local branch

* role has been added to graphic tag

* Update TableEntity.tsx

* Update ThroughputInput.tsx

* Update ThroughputInput.test.tsx.snap

* Update TreeComponent.tsx

* Update TableEntity.tsx

* Update AddCollectionPanel.tsx

* Update AddCollectionPanel.tsx

* Update AddCollectionPanel.tsx

* Update AddCollectionPanel.tsx

* Update AddCollectionPanel.tsx

* Update SplashScreen.tsx

* Update TreeComponent.test.tsx.snap

* Update TreeComponent.test.tsx.snap
2023-05-09 23:42:04 +05:30
MokireddySampath
f9af595eee 2276949test (#1433)
* autoscale and manual radiobuutton fixes

* alt text attribute for images

* Revert "alt text attribute for images"

This reverts commit 5a660551c6.

* alt text for decorative images

* sev2 accessibilitydefects in data explorer

* Commit to my local branch

* Autofocus removed

* Update TableEntity.tsx

* Update TableEntity.tsx

* Update TableEntity.tsx

* Update ThroughputInput.tsx

* Update ThroughputInput.test.tsx.snap

* Update TreeComponent.tsx

* Update TreeComponent.test.tsx.snap

* Update AddCollectionPanel.tsx

* Update SplashScreen.tsx
2023-05-09 23:33:05 +05:30
MokireddySampath
7ce8c7a5a1 anchor link removed, since interactive elements cannot be nested (#1434)
* anchor link removed, since interactive elements cannot be nested

* Update Tabs.tsx
2023-05-09 23:32:36 +05:30
MokireddySampath
9ad3f589cc aria required and asterisk has been added to indicate mandatory input for new vertex key input (#1435) 2023-05-09 23:32:09 +05:30
MokireddySampath
9267b2cc18 role has been corrected to combobox for the dropdown (#1438) 2023-05-09 23:29:56 +05:30
MokireddySampath
c7d1b2dcdb Defect2280542 (#1441)
* Changes made for the screenreader to readout the label and suffix associated with the input

* Added an empty href to restore the chactristics of link in high contrast mode

* Update SubSettingsComponent.tsx

* Update SubSettingsComponent.tsx

* Update SubSettingsComponent.tsx

* Update SubSettingsComponent.tsx

* Update SubSettingsComponent.test.tsx.snap

* Update SubSettingsComponent.test.tsx.snap

* Update SubSettingsComponent.test.tsx.snap
2023-05-09 23:29:25 +05:30
MokireddySampath
a526410e44 Defect 2280429 (#1416)
* autoscale and manual radiobuutton fixes

* alt text attribute for images

* Revert "alt text attribute for images"

This reverts commit 5a660551c6.

* alt text for decorative images

* sev2 accessibilitydefects in data explorer

* Revert "sev2 accessibilitydefects in data explorer"

This reverts commit b84d5b572c.

* Sev2 accessibilitydefects

* Revert "Sev2 accessibilitydefects"

This reverts commit a4e60f106c.

* accessibilitydefects-data explorer

* Accessibility sev-2 defects-2

* corrections for 2278347,2278096 and fix for 2264174

* corrections for 2278347,2278096 and fix for 2264174

* fix for defect 2276938

* wrong aria attibute used

* refresh, expand, collapse tree does not have proper label for screenreader

* wrong role is assigned to anchor link

* descriptive alt added for iconspresent for DATA and NOTEBOOK accordion headers

* Update CollapsedResourceTree.tsx

* Update ResourceTreeContainer.tsx

* Update ResourceTreeContainer.tsx

* Update TableEntity.tsx

* Update treeComponent.less

* Update MiddlePaneComponent.tsx

* Update PanelInfoErrorComponent.tsx
2023-04-25 21:04:29 +05:30
MokireddySampath
58cb85156c Defect 2278539 (#1415)
* autoscale and manual radiobuutton fixes

* alt text attribute for images

* Revert "alt text attribute for images"

This reverts commit 5a660551c6.

* alt text for decorative images

* sev2 accessibilitydefects in data explorer

* Revert "sev2 accessibilitydefects in data explorer"

This reverts commit b84d5b572c.

* Sev2 accessibilitydefects

* Revert "Sev2 accessibilitydefects"

This reverts commit a4e60f106c.

* accessibilitydefects-data explorer

* Accessibility sev-2 defects-2

* corrections for 2278347,2278096 and fix for 2264174

* corrections for 2278347,2278096 and fix for 2264174

* fix for defect 2276938

* wrong aria attibute used

* refresh, expand, collapse tree does not have proper label for screenreader

* wrong role is assigned to anchor link

* Update MiddlePaneComponent.tsx

* Update treeComponent.less

* Update CollapsedResourceTree.tsx

* Update ResourceTreeContainer.tsx

* Update TableEntity.tsx

* Update ResourceTreeContainer.tsx
2023-04-25 21:04:12 +05:30
MokireddySampath
dd5ccade2b Defect 2280418 (#1414)
* autoscale and manual radiobuutton fixes

* alt text attribute for images

* Revert "alt text attribute for images"

This reverts commit 5a660551c6.

* alt text for decorative images

* sev2 accessibilitydefects in data explorer

* Revert "sev2 accessibilitydefects in data explorer"

This reverts commit b84d5b572c.

* Sev2 accessibilitydefects

* Revert "Sev2 accessibilitydefects"

This reverts commit a4e60f106c.

* accessibilitydefects-data explorer

* Accessibility sev-2 defects-2

* corrections for 2278347,2278096 and fix for 2264174

* corrections for 2278347,2278096 and fix for 2264174

* fix for defect 2276938

* wrong aria attibute used

* refresh, expand, collapse tree does not have proper label for screenreader

* Update treeComponent.less

* Update TableEntity.tsx

* Update MiddlePaneComponent.tsx
2023-04-25 21:03:51 +05:30
MokireddySampath
38ebef6c02 Defect 2276941 (#1413)
* autoscale and manual radiobuutton fixes

* alt text attribute for images

* Revert "alt text attribute for images"

This reverts commit 5a660551c6.

* alt text for decorative images

* sev2 accessibilitydefects in data explorer

* Revert "sev2 accessibilitydefects in data explorer"

This reverts commit b84d5b572c.

* Sev2 accessibilitydefects

* Revert "Sev2 accessibilitydefects"

This reverts commit a4e60f106c.

* accessibilitydefects-data explorer

* Accessibility sev-2 defects-2

* corrections for 2278347,2278096 and fix for 2264174

* corrections for 2278347,2278096 and fix for 2264174

* fix for defect 2276938

* wrong aria attibute used

* aria-label for table max RU/s input element is not defined properly

* Update TableEntity.tsx

* Update treeComponent.less

* Update MiddlePaneComponent.tsx
2023-04-25 21:03:35 +05:30
MokireddySampath
7ad5862e8f Defect 2280272 (#1412)
* autoscale and manual radiobuutton fixes

* alt text attribute for images

* Revert "alt text attribute for images"

This reverts commit 5a660551c6.

* alt text for decorative images

* sev2 accessibilitydefects in data explorer

* Revert "sev2 accessibilitydefects in data explorer"

This reverts commit b84d5b572c.

* Sev2 accessibilitydefects

* Revert "Sev2 accessibilitydefects"

This reverts commit a4e60f106c.

* accessibilitydefects-data explorer

* Accessibility sev-2 defects-2

* corrections for 2278347,2278096 and fix for 2264174

* corrections for 2278347,2278096 and fix for 2264174

* fix for defect 2276938

* wrong aria attibute used

* Update treeComponent.less
2023-04-25 21:03:12 +05:30
sindhuba
755b732532 Remove Enable Azure synapse link for Cassandra (#1427) 2023-04-10 10:18:57 -07:00
sindhuba
1b5a9b83ff Remove Enable Azure Synapse link button for Tables API (#1425) 2023-04-07 08:47:23 -07:00
Armando Trejo Oliver
fb8871cfbf Load Legacy Mongo Shell V2 by default (#1424)
- Load Legacy Mongo Shell V2 by default
- Add/Keep feature flags to load from portal BE and V1
- Skip code coverage if skipCodeCoverage environment variable is set to "true"
2023-04-06 10:13:05 -07:00
Armando Trejo Oliver
874cec26fc Fix CORS issue using Mongo Shell from new origin (#1422)
* Fix CORS issue using Mongo Shell from new origin

* Add unit tests for getMongoShellOrigin and getMongoShellUrl

* Fix lint errors
2023-04-04 18:19:18 -07:00
Armando Trejo Oliver
9d2d0e4754 Add feature flags to test Legacy Mongo Shell (#1421)
Add feature flags to test Legacy Mongo Shell
2023-04-04 10:28:42 -07:00
MokireddySampath
c7c894d6d9 Sampath accessibility sev 2 2 (#1404)
* autoscale and manual radiobuutton fixes

* alt text attribute for images

* Revert "alt text attribute for images"

This reverts commit 5a660551c6.

* alt text for decorative images

* sev2 accessibilitydefects in data explorer

* Revert "sev2 accessibilitydefects in data explorer"

This reverts commit b84d5b572c.

* Sev2 accessibilitydefects

* Revert "Sev2 accessibilitydefects"

This reverts commit a4e60f106c.

* accessibilitydefects-data explorer

* Accessibility sev-2 defects-2

* corrections for 2278347,2278096 and fix for 2264174

* color for placeholder changed to 767474, margin is set to accommodate height between treeheader elements

* padding added for databaseheader, removed margin and restored padding to treenodeheader
2023-04-03 22:11:40 +05:30
Asier Isayas
547954c3dc Lazy loading containers (#1411)
Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2023-03-30 14:53:36 -07:00
sindhuba
7f220bf8be Add additional teaching bubbles in Quickstart (#1407)
* Add additional teaching bubbles in Quickstart

* Run npm format

* Fix lint error

* Add unit tests

* Add Mongo teaching bubbles for Try CosmosDB and Launch full screen

* Add additional tests for UrlUtility

* Run npm format

* Add tests for Notebook Utils
2023-03-27 15:33:55 -07:00
jawelton74
1ee6abf890 Change AAD endpoint from /common to /organizations. (#1408) 2023-03-27 10:47:04 -07:00
MokireddySampath
72c3605dbe Sampath accessibility sev 2 (#1400)
* autoscale and manual radiobuutton fixes

* alt text attribute for images

* Revert "alt text attribute for images"

This reverts commit 5a660551c6.

* alt text for decorative images

* sev2 accessibilitydefects in data explorer

* Revert "sev2 accessibilitydefects in data explorer"

This reverts commit b84d5b572c.

* Sev2 accessibilitydefects

* Revert "Sev2 accessibilitydefects"

This reverts commit a4e60f106c.

* accessibilitydefects-data explorer

* Remove extra white space

---------

Co-authored-by: Victor Meng <vimeng@microsoft.com>
2023-03-14 23:49:21 +05:30
MokireddySampath
a7a38807df Defect2236159 (#1396)
* autoscale and manual radiobuutton fixes

* alt text attribute for images

* Revert "alt text attribute for images"

This reverts commit 5a660551c6.

* alt text for decorative images
2023-02-28 09:11:52 +05:30
sindhuba
1285ffc440 Refresh collection automatically when container is created using Quickstart pop up (#1394)
* Quickstart Refresh collection automatically when container is created

* Fix unit tests

* Fix unit tests and address comments

* Minor fixes in message handler

* Minor changes to fix tsconfig.strict.json

* Resolve npm compile:strict errors by fixing the code implementation

* Remove cache refresh code in configureHosted function

* Fix spacing

* Run npm format
2023-02-24 10:58:36 -08:00
jawelton74
b4bca3d41a Updates user to use for nuget push. (#1393) 2023-02-16 17:51:57 -08:00
jawelton74
2a47e4311c Set overwrite to true for both blob uploads to storage. (#1392) 2023-02-16 16:23:24 -08:00
bogercraig
49d9f489d8 Users/bogercraig/add cdb live show link (#1391)
* Exchanged links on DE home page with link to the Azure Cosmos DB Live TV show.

* Adding back accidentally removed terminating ,

* Added cdb TV to Postgres quick start splash page.

* Removing cdb tv description from next steps and moved up.

* Moved cdb tv to the tips and learn more column on postgres getting started page.

* Shortening postgrest cdb tv line.

* Removing link from PG since only 1 episode so far for PG.

* Adding terminating comma back.  Formatting.

* Consolidating Cosmos DB Live TV to a single variable.

* Updating prettier formatting.
2023-02-15 09:24:55 -05:00
sindhuba
31cc129aa7 Update address sample data for SQL and Mongo (#1389) 2023-02-07 18:34:10 -08:00
MokireddySampath
99af4acca4 autoscale and manual radiobuutton fixes (#1387) 2023-02-07 11:48:45 +05:30
victor-meng
80dd161a6f Remove networking warning message for sql, gremlin, and tables api (#1388) 2023-02-06 12:51:04 -08:00
MokireddySampath
850f1dfb97 rework for defect-1704149 (#1384) 2023-02-04 01:51:11 +05:30
sunghyunkang1111
a827e79317 remove feature flag and add preview text in the button (#1383) 2023-02-03 10:15:35 -06:00
MokireddySampath
7dbccff41d fix for defect 1703851&1703931 (#1379) 2023-02-01 22:20:03 +05:30
victor-meng
9184684e75 Improve network settings warning message (#1380) 2023-01-25 15:04:39 -08:00
sunghyunkang1111
701f486d8f Add hierachical partition key in add containers in SQL (#1377)
* Add hierachical partition key in add containers in SQL

* Add hierachical partition key in add containers in SQL

* fix unit test cases and update snapshot

* add learn more links and feature flag

* update snapsho

* separate subpartition key logic

* separate subpartition key logic
2023-01-23 09:09:29 -06:00
victor-meng
5059917edf Only show networking settings warning for Mongo and Cassandra accounts (#1376) 2023-01-18 11:12:10 -08:00
Asier Isayas
ab1409efb1 Show delete database error (#1373)
Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2023-01-13 14:06:24 -05:00
MokireddySampath
5de9e682ba Defect1711833 (#1370)
* keyboard navigation for defects 1722611,1722618

* Fixes for keyboard navigation of add new clause,edit,remove property,insert filter line, remove filter line

* Revert "keyboard navigation for defects 1722611,1722618"

This reverts commit 9383609a22.

* html,css changes corected after reversion

* Revert "html,css changes corected after reversion"

This reverts commit 712e0e0c1e.

* committing changes for the keyboard navigation

* format fixes

* changes to addcollectionpanel.test.tsx snp file

* changes in infotooltip for defct

* Revert "changes in infotooltip for defct"

This reverts commit ca9833e208.

* commit for tooltip in defect 1704149

* Revert "commit for tooltip in defect 1704149"

This reverts commit 44766e8213.

* InfoTooltip changes

* update snapshot

* defect1722595 Bug 1722595: [Screen readers  Azure Cosmos DB  Scale& Settings: Screen reader (NVDA) is not announcing status message which is displayed on the screen after radio button is selected under scale tab.

* more options in delete entity dialog is not accessible through keyboard

* Revert "more options in delete entity dialog is not accessible through keyboard"

This reverts commit 23a05ef18e.

* more options in delete entity dialog is not accessible throgh keyboard

* remove native html with role='alert' for messagebar

* role added for messagebar fluentui component
2023-01-10 21:32:29 +05:30
jawelton74
b2ab979360 Display large partition key message for SQL API accounts only. (#1371) 2023-01-09 14:22:32 -08:00
vchske
2f32a676d0 Fixes issue when CRUD with no parition key for all APIs (#1362)
* Fixes issue where empty partition key is treated like nonexistent key for Tables API

* Updated format

* Refactor fix

* Prettier

* Fixes issue when CRUD with no parition key for all APIs

* Format fix

* Refactor to explicitly check for Tables
2022-12-13 11:36:39 -08:00
victor-meng
950c8ee470 Fix "Change network settings" button send the wrong message type (#1360) 2022-12-09 15:48:23 -08:00
vchske
b0eaac5b84 Fixes issue where empty partition key is treated like nonexistent key… (#1359) 2022-12-09 15:14:46 -08:00
victor-meng
952491a3ad Empty commit to trigger new build (#1351) 2022-11-14 13:46:27 -08:00
victor-meng
5dde66b032 Add check and guidance for networking settings (#1348) 2022-11-10 10:46:55 -08:00
jawelton74
5b1db2778c Fix typo in 'tutorial' in Quick start. (#1346) 2022-10-27 09:59:14 -07:00
Armando Trejo Oliver
1213788f9c Remove share-link feature (#1345)
* Remove share-link feature

Cosmos DB supports sharing access to an account data using AAD/RBAC now so this feature is unnecessary.

* Fix format issues

* Fix unit tests

* undo package changes
2022-10-20 10:58:37 -07:00
victor-meng
1ce3adff0f Hide launch quick start button and postgres teaching bubbles if account is a replica (#1344) 2022-10-19 17:12:41 -07:00
victor-meng
00eb07da11 Add retries when checking if account is allowed to access phoenix (#1342) 2022-10-19 17:12:24 -07:00
victor-meng
afe59c1589 Postgres fixes (#1341) 2022-10-11 16:03:58 -07:00
victor-meng
53b5ebd39c Add firewall notification in quickstart tab (#1337) 2022-10-10 19:30:52 -07:00
sunghyunkang1111
5b365e642f show introductory video and password reset for first time try postgresql (#1338) (#1340) 2022-10-10 18:53:54 -05:00
victor-meng
333b3de587 Add new message type for opening postgres networking blade (#1336) 2022-10-06 14:25:10 -07:00
victor-meng
e909ac43f4 Integrate PSQL shell in quick start guide (#1333) 2022-10-06 11:32:19 -07:00
vchske
8433a027ad Text changes for API rebranding (#1330)
* Text changes for API rebranding

* Text changes and bug fixes for API rebranding

* Format updates
2022-10-05 17:35:03 -07:00
victor-meng
81dfd76198 Implement connection string tab for postgres (#1334) 2022-10-05 17:32:05 -07:00
sunghyunkang1111
7c77ffda6c Add password reset callout (#1332)
* Add password reset callout

* Add create password text

* Add password reset callout
2022-10-04 11:50:47 -04:00
jawelton74
a34d3bb000 Disable wild card index for Mongo 16MB documents (#1331)
* Disable wild card index option if Mongo 16 MB document capability is
present.

* Formatted with prettier
2022-09-29 15:36:00 -07:00
victor-meng
42731d1aae Quickstart UI changes (#1327) 2022-09-27 14:03:28 -07:00
Armando Trejo Oliver
3abbb63adc Add support for psql shell (#1324)
Add support for psql shell
- add new terminal type
- handle missing documentEndpoint property
2022-09-22 15:39:35 -07:00
victor-meng
2e618cb3c4 Use my own ms account to upload nuget packages (#1325) 2022-09-21 16:10:07 -07:00
victor-meng
beca0d6608 Properly load a postgres account in data explorer (#1323) 2022-09-20 10:42:09 -07:00
victor-meng
d54c896d74 Postgre quickstart UI (#1319) 2022-09-14 14:42:09 -07:00
Karthik chakravarthy
d6a58fd45f Gallery loading issue (#1321) 2022-09-14 14:57:32 -04:00
Srinath Narayanan
a851f78b1c Moved notebooks to latest API version (#1320)
* Moved notebooks to latest API version

* fixed lint errors
2022-08-31 02:38:52 +05:30
Karthik chakravarthy
a4061a96b1 Hide connect btn and only show when phoenix notebooks or features are used (#1318) 2022-08-22 19:07:01 -04:00
victor-meng
06c3b6fe94 Whitelist AGC endpoint in data explorer (#1317) 2022-08-16 10:15:26 -07:00
Karthik chakravarthy
89c7ebdd20 Hide connect button incase Phoenix Notebooks flight is false (#1314)
* Hide connect button id flight notebooks is false and show only if features are used
2022-08-10 09:29:23 -04:00
victor-meng
d0c2f72ed3 Add teaching bubbles for mongo quickstart (#1313) 2022-08-03 13:54:01 -07:00
Karthik chakravarthy
c2673ec707 Refactor text messages (#1312) 2022-07-27 12:05:56 -04:00
vchske
759a4ca5cf Reverting cosmos sdk to 3.16.2 (#1311) 2022-07-26 13:17:01 -07:00
victor-meng
9078878f44 Update params for creating collection via mongo proxy (#1310) 2022-07-25 16:15:48 -07:00
vchske
139a9cb22c Updating SDK to 3.16.3 (#1308)
* Updating SDK to 3.16.3

* Updating package-lock Cosmos DB SDK to 3.16.3

* Updating package-lock's Cosmos DB SDK to 3.16.3
2022-07-18 15:22:27 -07:00
victor-meng
c5ef0e608e Fix aggregated query metrics show incorrect number (#1302) 2022-07-12 10:39:40 -07:00
victor-meng
d66e85f431 Allow users to delete TablesDB database when enableSDKOperations feature flag is set (#1300) 2022-07-06 10:54:49 -07:00
victor-meng
0996489897 Improve quickstart teaching bubble telemetries and make the home page a tab (#1299) 2022-07-06 10:54:35 -07:00
victor-meng
f83634c50d Upgrade js sdk version (#1297) 2022-06-28 17:52:46 -07:00
Mathieu Tremblay
b9dffdd990 Rename properties from notebookService to phoenixService in phoenix c… (#1263)
* Rename properties from notebookService to phoenixService in phoenix client


Co-authored-by: kcheekuri <kcheekuri@microsoft.com>
2022-06-21 14:19:45 -04:00
Karthik chakravarthy
13811b1d44 Update allocate call (#1290) 2022-06-21 08:48:18 -04:00
Tanuj Mittal
1643ce4dbb Log errors by Schema Analyzer (#1293) 2022-06-21 05:07:49 +05:30
Karthik chakravarthy
7abd65ac4b Enable phoenix based of allowed subscription and flights (#1291)
* Enable phoenix based of allowed subscription and flights
2022-06-15 17:08:06 -04:00
Tanuj Mittal
c731eb9cf9 Fix Official Samples not loading when Gallery tab is opened (#1282) 2022-06-09 02:30:49 +05:30
siddjoshi-ms
c534b2d74b Sqlx az portal cost estimate (#1264)
* added isZoneRedundant to rp call

* Pass region item everywhere

* cost breakdown string added
2022-06-08 10:16:43 -07:00
victor-meng
98fb7a5fd6 Upgrade JS SDK version to 3.16.1 (#1287) 2022-06-03 13:19:29 -07:00
chandrasekhar gunturi
e34f68b162 adding Materializedviews under selfserve (#1247)
* adding Materializedviews under selfserve

* ran npm format & fixed few links

* modified required key & changed URLs

* modifying links to aka.ms

* modifying few descriptions

* Delete VSWorkspaceState.json

* Delete .suo

* modifying URLs & adding missing keys

Co-authored-by: Chandra sekhar Gunturi <chguntur@microsoft.com>
2022-06-03 12:51:54 +05:30
victor-meng
7ab57c9ec4 Add telemetry for new quick start (#1285) 2022-06-01 15:26:10 -07:00
victor-meng
7e1343e84f Add check of account creation time to show carousel (#1284)
Co-authored-by: artrejo <ato9000@users.noreply.github.com>
2022-06-01 15:25:56 -07:00
victor-meng
46ca952955 Add condition for showing quick start carousel (#1278)
* Add condition for showing quick start carousel

* Show coach mark when carousel is closed

* Add condition for showing quick start carousel and other UI changes

* Fix compile error

* Fix issue with coach mark

* Fix test

* Add new sample data, fix link url, fix e2e tests

* Fix e2e tests
2022-05-23 20:52:21 -07:00
Srinath Narayanan
d13b7a50ad phoenix errors added (#1272) 2022-05-23 16:28:45 +05:30
victor-meng
dfd5a7c698 Use undefined as the partition key value when deleting and updating documents (#1274) 2022-05-20 16:39:21 -07:00
victor-meng
2ab60a7a40 Add connect tab for new quick start (#1273)
* Add connect tab

* Error handling

* Add button to open quick start blade

* Handle scenario where user don't have write access
2022-05-20 16:38:38 -07:00
victor-meng
dc83bf6fa0 Update recent items UI and add to new home page (#1275)
* Update recent items UI and add to new home page

* Update text and links for different APIs

* Update home page text and carousel images
2022-05-20 16:37:50 -07:00
victor-meng
c2f3471afe Add carousel for quick start (#1271)
* Add carousel for quick start

* Put carousel behind feature flag

* Install type definition for react-youtube

* Install type definition for react-youtube

* Remove @types/youtube-player

* Move feature flag outside of quickstarttutorial component
2022-05-16 18:23:54 -07:00
victor-meng
60525f654b Add teaching bubbles after creating sample DB (#1270)
* Add teaching bubbles after creating sample DB

* Add teaching bubble while creating sample container

* Remove test code

* Update tests and always show teaching bubbles in add collection panel when launched from quick start

* Fix snapshot
2022-05-16 17:45:50 -07:00
victor-meng
37122acc33 Fix issue with reading and saving mongo documents with shard key (#1269) 2022-05-11 18:12:12 -07:00
victor-meng
0b6bb7a985 Fix stored procedures, UDF, and triggers sometimes don't show up in the resource tree after expanding (#1267) 2022-05-05 18:27:13 -07:00
Srinath Narayanan
fcfc52a80c Added support for multi line descriptions in self serve framework (#1266)
* Added support for multi line descriptions

* test snapshot change

* addresse pr comments
2022-05-06 00:01:06 +05:30
Armando Trejo Oliver
9cb4632f32 Update subscription for preview PRs (#1265)
* Update subscription for preview PRs

* Fix command line args

* Replace subid for sub name

* Remove --subscription from az storage commands

* revert other changes
2022-05-04 20:11:13 -07:00
victor-meng
ebbfc5f517 New quick start - create sample container (#1259)
* Update links and texts

* Remove unintended change

* Quick start - create sample container

* Small adjustments + fix test

* Hide coach mark behind feature flag

* Add snapshot test for AddCollectionPanel to increase coverage

* Fix snapshot

* Fix snapshot 2...

* Change runner account name

* Change portal runner account name
2022-05-04 18:24:34 -07:00
Armando Trejo Oliver
d05a05716f Fix Emulator Quick Start Links (#1255) 2022-05-04 15:30:48 -07:00
Srinath Narayanan
da1169d0e2 Added publicgallery flight (#1262)
* added publicgallery flag

* fixed PR comments
2022-05-04 03:50:44 +05:30
victor-meng
27423e2321 Create new home page (#1257)
* initial commit

* Remove test code

* Rename icon

* Fix feature flag

* Update links and texts

* Remove unintended change
2022-05-02 13:45:54 -07:00
victor-meng
56731ec051 Fix error when reading document with no partition key (#1256) 2022-04-27 11:12:57 -07:00
victor-meng
22f7d588a1 Add support for multi-partition key (#1252) 2022-04-21 13:37:02 -07:00
Rama krishnan Raghupathy
9e7bbcfab6 Change Headers meant to unblock merge prviate preview customers (#1251) 2022-04-14 18:01:11 -07:00
Karthik chakravarthy
cea3978ca6 Make Phoenix enabled based of config context (#1250)
* Have phoenix enabled based of config context irrespective of hosted or portal explorer

* Add telemetry start and success

* Add error code in failure case
2022-04-12 16:25:24 -04:00
victor-meng
2e3e547a46 Fix scale tab not showing the correct throughput mode and value and remove freetierautoscalethroughput feature flag (#1245) 2022-03-31 12:13:08 -07:00
Karthik chakravarthy
06f6df83ad Add UX for error Information for Phoenix workspace connection (#1234)
* Add UX for error Information

* update text messages
2022-03-30 08:59:37 -04:00
victor-meng
8b22027cb6 Fix settings tab shows no selected value (#1237) 2022-03-25 15:13:56 -07:00
Armando Trejo Oliver
496f596f38 Fix Parent Origin Regex (#1239)
Not all regex are escaped properly
2022-03-25 12:59:18 -07:00
Mathieu Tremblay
d1587ef033 Update Tab title from 'Items' to id + ' - Items' to make it easier to differentiate (#1233) 2022-03-11 15:50:44 -05:00
Karthik chakravarthy
5c8016ecd6 Enable phoenix for MPAC by default, and for PROD will enable phoenix only based on flight (#1232)
* Enable phoenix to MPAC by default and for prod based on flight

* phoenix flag setting based of configContext
2022-03-01 13:38:30 -05:00
victor-meng
605117c62d Update autoscale throughput limits (#1229)
* Change minimum autoscale throughput and default autoscale throughput for free tier account to 1000

* Fix unit tests

* Update snapshot

* Fix cassandra add collection panel

* Address comments

* Add feature flag/flight

* Remove console.log
2022-02-25 18:21:58 -08:00
Tanuj Mittal
7a809cd2bc Always schedule memory call (#1231)
* Always schedule memory call

* Memory heart beat issue-fix

Co-authored-by: kcheekuri <kcheekuri@microsoft.com>
2022-02-25 13:41:43 -05:00
Karthik chakravarthy
0a51e24b94 Phoenix UX fixes (#1230) 2022-02-25 13:41:13 -05:00
victor-meng
f36a881679 Add List, Map, and Set column types for cassandra (#1228) 2022-02-18 15:25:47 -08:00
victor-meng
b7f0548cca Set toolTip for "Request Charge" and "Showing Results" metrics (#1212) 2022-01-31 10:02:04 -08:00
Armando Trejo Oliver
4728dc48d7 Add Mooncake and Fairfax BE and Mongo endpoints to allowed endpoints (#1213) 2022-01-28 18:43:34 -08:00
Karthik chakravarthy
9358fd5889 Clean computeV2 code (#1194)
Cleans compute V2 code used in the Phoenix notebooks flow.
Fix the issue with 'Setup Notebooks' in quick start menu.
2022-01-26 07:31:38 -05:00
Armando Trejo Oliver
f5da8bb276 Validate endpoints from feature flags (#1196)
Validate endpoints from feature flags
2022-01-24 13:06:43 -08:00
Asier Isayas
de5df90f75 Removing serverless check to show synapse link options (#1188)
* removing serverless check to show synapse link enablement

* fixing tests

* fixing fomatting

Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2022-01-13 15:27:43 -05:00
victor-meng
66421ad276 Add headers to unblock merge private preview customers (#1190) 2022-01-13 11:35:20 -08:00
Deborah Chen
e70fa01a8b Updating text to match backend value for large partition keys(#1186) 2022-01-11 10:45:41 -08:00
Srinath Narayanan
79b6f3cf2f FIxed bugs in JupyterLabAppFactory (#1187)
* initial commit for closing terminal

* added extra case

* lint changes and hostee explorer fixes

* fixed lint errors

* fixed compile error

* fixed review comments

* modified mongo shell logic

* added cassandra hell changes

* fixed compile error
2022-01-11 18:24:27 +05:30
Srinath Narayanan
b765cae088 Close mongo and casssandra terminal tabs once the shells are exited (#1183)
* initial commit for closing terminal

* added extra case

* lint changes and hostee explorer fixes

* fixed lint errors

* fixed compile error

* fixed review comments
2022-01-11 01:28:35 +05:30
Srinath Narayanan
591782195d added phoenixfeatures flag (#1184) 2022-01-10 23:40:41 +05:30
Karthik chakravarthy
c7ceda3a3e Disable auto save for notebooks under temporary workspace (#1181)
* disable autosave only for temporary notebooks

* Add override epic description
2022-01-10 09:38:54 -05:00
Sunil Kumar Yadav
b19144f792 Fixed querytab corresponding command bar (#1180)
Co-authored-by: sunilyadav <v-yadavsunil@microsoft.com>
2021-12-27 11:41:42 -08:00
Sunil Kumar Yadav
e61f9f2a38 Fixed inconsistent use of collection id and name (#1179)
Co-authored-by: sunilyadav <v-yadavsunil@microsoft.com>
2021-12-27 11:40:12 -08:00
Karthik chakravarthy
025d5010b4 Add Pop-up on save click for temporary notebooks (#1177)
* Disable auto save for notebooks

* Changing auto save interval

* Remove auto save tabwise

* Remove auto save tabwise-1

* update file
2021-12-22 13:15:33 -05:00
Karthik chakravarthy
be28eb387b Removal of feature flag notebooksTemporarilyDown (#1178)
* Removal of feature flag notebooksTemporarilyDown

* Update flag

* Add Vnet/Firewall check for enabling phoenix
2021-12-22 13:15:12 -05:00
victor-meng
529202ba7e Add support for date type to cassandra column types (#1176) 2021-12-16 14:51:18 -08:00
vaidankarswapnil
de58f570cd Fix Radio buttons present under 'Settings' blade like ‘Custom and Unlimited’ along with its label ‘Page options’ are not enclosed in fieldset/legend tag (#1175)
* Fix a11y setting pane radiobuttons issue

* Update test snapshot issue

* Implemented fieldset and legend for ChoiceGroup in HTML

* cleanup
2021-12-15 12:22:15 -08:00
Sunil Kumar Yadav
6351e2bcd2 fixed unshared collection error for cassandra (#1172)
* fixed unshared collection error for cassandra

* fixed shared props value

Co-authored-by: sunilyadav <v-yadavsunil@microsoft.com>
2021-12-15 11:56:40 -08:00
Sunil Kumar Yadav
d97b991378 fixed screenreader copy issue (#1173)
Co-authored-by: sunilyadav <v-yadavsunil@microsoft.com>
2021-12-15 11:54:39 -08:00
Karthik chakravarthy
b7daadee20 Hide commandbar btns when phoenix flag is false (#1174)
* Hide commandbar btns when phoenix flag is false

* Showing notebooks based on phoenix
2021-12-14 09:02:49 -05:00
Karthik chakravarthy
b327bfd0d6 Update Api end points and add brs for allowlist (#1161)
* Update Api end points and add brs for allowlist
2021-12-13 09:23:33 -05:00
Karthik chakravarthy
469cd866e0 Bug Bash issues fixes (#1162)
* Bug Bash issues fixes

* Remove rename from root of Temporary Workspace context menu

* Update comments

* Update comments
2021-12-12 19:41:15 -05:00
victor-meng
ada95eae1f Fix execute sproc pane textfield focus issue (#1170)
* Fix execute sproc pane textfield focus issue

* Update snapshot
2021-12-08 15:41:27 -08:00
vaidankarswapnil
8a8c023d7b Fix Keyboard focus New Database button (#1167)
* Fix a11y new database button focus issue

* Update test snapshot and other issues

* fix issue for the menu button

* Issue fixed in Splash screen
2021-12-02 20:13:45 -08:00
Hardikkumar Nai
667b1e1486 1413651_Refresh_button_missing (#1169) 2021-12-02 20:12:57 -08:00
Sunil Kumar Yadav
203c2ac246 fixed horizontal scroll issue on zoom 400% (#1165)
Co-authored-by: sunilyadav <v-yadavsunil@microsoft.com>
2021-12-01 19:46:48 -08:00
victor-meng
5d235038ad Properly update table headers (#1166) 2021-11-30 15:36:35 -08:00
Srinath Narayanan
6b4d6f986e added github test env client id (#1168) 2021-12-01 03:38:38 +05:30
Karthik chakravarthy
e575b94ffa Add phoenix telemetry (#1164)
* Add phoenix telemetry

* Revert changes

* Update trace logs
2021-11-29 11:22:57 -05:00
vaidankarswapnil
42bdcaf8d1 Fix radio buttons present under 'Settings' blade like ‘Custom and Unlimited’ along with its label ‘Page options’ are not enclosed in fieldset/legend tag (#1100)
* Fix a11y setting pane radiobuttons issue

* Update test snapshot issue
2021-11-24 20:00:06 -08:00
victor-meng
94a03e5b03 Add Timestamp type to cassandra column types and wrap Timestamp value inside single quotes when creating queries (#1163) 2021-11-19 09:55:10 -08:00
victor-meng
1155557af1 Check for -1 throughput cap value (#1159) 2021-11-10 21:43:04 -08:00
tarazou9
27a49e9aa9 add juno test3 to allow list (#1158)
* add juno test3 to allow list

* remove extra line
2021-11-10 17:05:31 +05:30
Srinath Narayanan
fa8be2bc0f fixed quickstarts (#1157) 2021-11-10 17:05:17 +05:30
Karthik chakravarthy
3aa4bbe266 Users/kcheekuri/phoenix heart beat retry with delay (#1153)
* Health check retry addition

* format issue

* Address comments

* Test Check

* Added await

* code cleanup
2021-11-09 18:08:17 +05:30
siddjoshi-ms
2dfabf3c69 Sqlx currency code fix (#1149)
* using currency code from fetch prices api

* formatting & linting fixes

* Update SqlX.rp.ts
2021-11-09 00:04:22 +05:30
victor-meng
a3d88af175 Fix throughputcap check (#1156) 2021-11-05 10:23:21 -07:00
Srinath Narayanan
5597a1e8b6 Changes to reset container workflow (#1155)
* reset changes

* undid config context changes

* renamed method
2021-11-04 21:55:41 +05:30
victor-meng
e3d5ad2ce8 Fix ARM api version (#1154) 2021-11-02 12:23:48 -07:00
victor-meng
64f36e2d28 Add throughput cap error message (#1151) 2021-10-30 19:45:16 -07:00
Srinath Narayanan
4ce1252e58 master/main fix (#1150) 2021-10-28 17:08:34 +05:30
Karthik chakravarthy
7d9faec81e Phoenix runtime - Reset workspace (#1136)
* Phoenix runtime - Reset workspace

* Format and Lint issues

* Typo issue

* Reset warning text change and create new context on allcation of new container

* Closing only notebook related

* resolved comments from previous PR

* On Schema Analyser allocate call

Co-authored-by: Srinath Narayanan <srnara@microsoft.com>
2021-10-22 10:41:13 -04:00
Karthik chakravarthy
22da3b90ef Phoenix Reconnect Integration (#1123)
* Reconnect integration

* git connection issue

* format issue

* Typo issue

* added constants

* Removed math.round for remainingTime

* code refctor for container status check

* disconnect text change
2021-10-22 14:34:38 +05:30
Srinath Narayanan
361ac45e52 Added notebooksDownBanner flight (#1146)
* set isNotebookEnabled to true

* lint and format fixes

* modified shell enabled

* added notebooks down banner flight

* fixed typo
2021-10-22 13:27:52 +05:30
Srinath Narayanan
8aa764079a Setting isNotebooKEnabled to true by default (#1145)
* set isNotebookEnabled to true

* lint and format fixes

* modified shell enabled
2021-10-22 11:48:40 +05:30
victor-meng
55837db65b Revert "Fix keyboard focus does not retain on 'New Database' button a… (#1139)
* Revert "Fix keyboard focus does not retain on 'New Database' button after closing the 'New Database' blade via ESC key (#1109)"

This reverts commit f7e7240010.

* Revert "Fix ally database panel open issue (#1120)"

This reverts commit ed1ffb692f.
2021-10-15 17:36:48 -07:00
victor-meng
9f27cb95b9 Only use the SET keyword once in the update query (#1138) 2021-10-15 12:33:59 -07:00
Hardikkumar Nai
271256bffb resolve_eslint_NodePropertiesComponent (#921)
* resolve_eslint_NodePropertiesComponent

* address commit

* Open new screen: Screen reader does not pass the 'Copied' information after selecting 'Copy' button.

* resolve lint error
2021-10-12 08:43:35 -07:00
vaidankarswapnil
aff7133095 Fix eslint issues for TableCommands and other files (#1132) 2021-10-12 08:07:06 -07:00
Hardikkumar Nai
bfd4948fb9 absulte_path setting (#984)
* absulte_path setting

* resolve build time error
2021-10-12 07:38:34 -07:00
victor-meng
1c54459708 If unsharded is checked, set partition key to undefined (#1128) 2021-10-11 12:09:38 -07:00
Sunil Kumar Yadav
df3b18d585 fixed eslint of NotebookComponentBootstrapper and NotebookReadOnlyRenderer (#1122) 2021-10-11 08:29:21 -07:00
Sunil Kumar Yadav
882f0e1554 fixed GraphExplorer.tsx ellint issue (#1124) 2021-10-11 08:21:52 -07:00
vaidankarswapnil
b67b76cc87 Fix eslint issues for QueryBuilderViewModal and QueryClauseViewModel (#1125) 2021-10-11 08:20:38 -07:00
vaidankarswapnil
734ee1e436 Fix eslint issues for ClauseGroup and ClauseGroupViewModel files (#1127) 2021-10-11 07:56:12 -07:00
Sunil Kumar Yadav
ff498b51e2 fixed eslint of Trigger.ts GithubOAuthService.ts etc (#1126) 2021-10-11 07:55:21 -07:00
vaidankarswapnil
ed1ffb692f Fix ally database panel open issue (#1120) 2021-10-06 07:53:46 -07:00
Karthik chakravarthy
f7fa3f7c09 Fix Unit Test: Mock the class to its instance (#1117)
* mock to instance

* Update jest.config.js

Co-authored-by: Jordi Bunster <jbunster@microsoft.com>
2021-10-05 13:06:26 -07:00
Jordi Bunster
6ebf19c0c9 Close tab fixes (#1107)
* Close tab fixes

Ensure that when promoting a new tab to being the 'active' tab
(as a consequence of, say, closing the active tab) that the newly
promoted tab has a chance to install its buttons and what not.

* Set new active tab even if undefined
2021-10-05 09:25:35 -07:00
Karthik chakravarthy
f968f57543 Allocation of container on demand (#1097)
* Allocation of container only on demand

* git notebook click emits connect to container and refresh notebooks

* git cleanup local repo

* Reconnect rename and memory heartbeat change

* Fix new notebook click event in case of git login

* Mongo proxy test replace with master file

* code refactor

* format check

* compile errors resolved

* address review comments

* rename environment to workspace

* Added content html rendering in Dialog

* format issue

* Added contentHtml in the dialog which renders jsx element
2021-09-30 12:53:33 -04:00
vaidankarswapnil
6ca8e3c6f4 Fix execute Query 'Results' and 'Query status' section controls gets truncated at 200% resize mode of 'Query1' blade (#1105)
* Fix a11y querytab results section zoom section issue

* Update test smapshot

* Update test snapshot

* Resolved test case issue
2021-09-27 11:03:01 -07:00
vaidankarswapnil
f7e7240010 Fix keyboard focus does not retain on 'New Database' button after closing the 'New Database' blade via ESC key (#1109)
* Fix a11y new database button focus issue

* Update test snapshot and other issues
2021-09-23 08:13:18 -07:00
Sunil Kumar Yadav
acc095a482 fixed graph input query JAWS screen reader issue (#1108) 2021-09-23 08:11:46 -07:00
Hardikkumar Nai
288e6410f3 Choose Column: Aria Position set is not defined for check box present under choose column dialog box. (#1104) 2021-09-23 07:59:10 -07:00
Hardikkumar Nai
9ac3392271 Scale and Settings: 'Learn more' link is not adapting the high contrast mode after applying high contrast theme. (#1103) 2021-09-23 07:58:41 -07:00
Sunil Kumar Yadav
9a908dde9a fixed graph explorer visibility and graph expand keyboard accessibility issue (#1092)
* fixed graph explorer visibility issue

* fixed graph expand keyboard accessibility issue
2021-09-23 07:57:42 -07:00
siddjoshi-ms
ddd2e63fe7 Telemetry added for calculate cost function (#1018)
* Added telemetry for sql cost calculation
2021-09-22 09:49:45 -07:00
Hardikkumar Nai
34c59b4872 Scale and Settings: Text content of 'Info status message' and 'Warning' message is not visible properly at high contrast black mode. (#1090) 2021-09-22 07:40:18 -07:00
Jordi Bunster
7d28af4fc7 Make these required fields (#1101) 2021-09-21 15:50:44 -07:00
Sunil Kumar Yadav
50b99ceb42 fixed horizontal scrollbar issue on 400% resize mode (#1099) 2021-09-21 09:06:49 -07:00
Sunil Kumar Yadav
15a26d6500 fixed notification content visible issue on 400 resize mode (#1098) 2021-09-21 09:06:17 -07:00
Sunil Kumar Yadav
a8150af269 fixed incorrect notification console expand collaped screenreader issue (#1095) 2021-09-21 09:04:47 -07:00
Sunil Kumar Yadav
6a9a0156a3 fixed entity choose column role accessibility issue (#1088) 2021-09-21 09:02:04 -07:00
vaidankarswapnil
ead28f043f Fix after activating "Refresh tree" button, 'Querying database' message appears but screen reader does not provide any information about it (#1091)
* Fix a11y refresh tree querying database msg

* Update test snapshot issue
2021-09-21 09:00:28 -07:00
vaidankarswapnil
b05e5a2145 Fix delete database warning message is not announced by the screen reader after selecting 'Delete Database' menu item (#1074)
* Fix a11y delete database confirmation ississue

* Resolved lint issue - Removed Unnecessary semicolon

* Resolved compilation issue for extractFeature.ts and update test snapshot issue

Co-authored-by: Armando Trejo Oliver <ato9000@users.noreply.github.com>
2021-09-21 08:58:03 -07:00
Hardikkumar Nai
5e8aa491ba Load Graph: Name, role and state properties are not defined for 'full screen graph view' control present under 'Graph' tab section. (#1083) 2021-09-21 08:57:08 -07:00
Hardikkumar Nai
a730c08292 New SQL Query: Luminosity contrast ratio is 2.6:1 which is less than 3:1 for Close(X) icon button of Query 1 tab control (#1089) 2021-09-21 08:56:16 -07:00
Hardikkumar Nai
3dce5cd129 Tooltip is not provided for 'More' control present on the page. (#1093) 2021-09-21 08:54:44 -07:00
siddjoshi-ms
7c186c3ef2 Update GraphAPICompute.rp.ts (#1065) 2021-09-20 15:13:07 -07:00
Sunil Kumar Yadav
d8840a0dfd fixed aria-required property missing issue (#1020) 2021-09-16 14:25:28 -07:00
vaidankarswapnil
f853c4ec2f Fix 'Advanced' expand/collapse control and other issues under 'New Collection' blade (#1021)
* Fix ally issues for newCollection panel's advanced section

* Resolved test snapshot issue

* Removed unnecessary changes
2021-09-16 14:25:17 -07:00
Sunil Kumar Yadav
9bf5f48165 Fixed add collection tooltip accessibility issue (#1022)
* Fixed add collection tooltip accessibility issue

* Remove commented code

* cleanup commented code
2021-09-16 14:24:47 -07:00
Sunil Kumar Yadav
0b2a204b70 fixed delete database field missing issue at 200% resize mode (#1066) 2021-09-16 14:24:34 -07:00
vaidankarswapnil
c28593b752 Fix expand/collapse tree button of Data Explorer page is not accessible through keyboard (#1067)
* Fix ally issues for newCollection panel's advanced section

* Resolved test snapshot issue

* Fix a11y data explorer expand/collapse using keyboard issue
2021-09-16 14:24:24 -07:00
Sunil Kumar Yadav
4cbbef9574 change area label of UDF (#1068) 2021-09-16 14:24:11 -07:00
vaidankarswapnil
300c952a9b Fix a11y QueryTab focus and close button issue using keyboard (#1069) 2021-09-16 14:23:55 -07:00
Sunil Kumar Yadav
38c3761260 fixed input parameter keyboard accessibility issue (#1071)
* fixed input parameter keyboard accessibility issue

* Fixed autofocus and role issue

* make autofocus on close button
2021-09-16 14:23:43 -07:00
vaidankarswapnil
3032f689b6 Fix delete container and database labels appearing text are not associated with the edit fields (#1072)
* Fix a11y issues for delete container and database

* Update test snapshot issues
2021-09-16 14:23:29 -07:00
Hardikkumar Nai
8b30af3d9e Settings: At 200% resize mode controls present under 'Settings' blade are not visible while navigating over them. (#1075) 2021-09-16 14:23:03 -07:00
Sunil Kumar Yadav
e10240bd7a fixed setting keyboard accessibility issue (#1081) 2021-09-16 14:22:47 -07:00
vaidankarswapnil
ae9c27795e Fix execute query keyboard focus moves to hidden element under 'Results' section of executed Query 1 blade (#1082)
* fix a11y quertTab results section hidden element focus issue

* Removed commented code

* Resolved lint issues
2021-09-16 14:21:19 -07:00
Karthik chakravarthy
d7997d716e Data pane expand issue (#1085)
* Data pane expand issue

* Data pane expand issue-1

* Data pane expand issue format

* Data pane expand issue formating
2021-09-15 19:50:36 -04:00
victor-meng
af0dc3094b Temporarily lower test coverage threshold (#1084) 2021-09-15 16:38:51 -07:00
victor-meng
665270296f Fix throughput cost estimate in add collection panel (#1070) 2021-09-15 13:05:55 -07:00
Asier Isayas
2d945c8231 allowing azure client secret to be null in dev mode (#1079)
Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2021-09-14 12:33:09 -04:00
Asier Isayas
8866976bb4 fixed hasFlag test (#1076)
Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2021-09-14 12:28:33 -04:00
Asier Isayas
d10f3c69f1 MongoClient Feature Flag (#1073)
Adding a feature flag for Mongo Client that allows a user to specify a mongo endpoint and an API so that users can test specific APIs locally.

Example:

https://localhost:1234/hostedExplorer.html?feature.mongoproxyendpoint=https://localhost:12901&feature.mongoProxyAPIs=createDocument|readDocument

The above link says to test APIs createDocument and readDocument on https://localhost:12901

Co-authored-by: artrejo <ato9000@users.noreply.github.com>
Co-authored-by: Asier Isayas <aisayas@microsoft.com>
2021-09-13 16:25:21 -04:00
kcheekuri
7e4f030547 Hidding container connection status behind the feature flag and initi… (#1019)
* Hidding container connection status behind the feature flag and initializing scratch issue

* maintaining connecting status UX part at notebooks context

* Changing scratch name to temporary and showing only after connected
2021-09-09 14:02:00 -04:00
siddjoshi-ms
05f46dd635 Sqlx approx cost bug fixes (#975)
* function naming changed

* bug fix: replacing multiple occurences of space correctly now
2021-09-08 14:04:31 -07:00
Meha Kaushik
65882ea831 Self-Server for GraphAPI Compute (#1017)
* Self-Server for GraphAPI Compute

* Update GraphAPICompute.json
2021-09-07 23:42:39 -07:00
kcheekuri
95c9b7ee31 Users/kcheekuri/aciconatinerpooling (#1008)
* initial changes for CP

* Added container unprovisioning

* Added postgreSQL terminal

* changed postgres terminal -> shell

* Initialize Container Request payload change

* added postgres button

* Added notebookServerInfo

* Feature flag enabling and integration with phoenix

* Remove postgre implementations

* fix issues

* fix format issues

* fix format issues-1

* fix format issues-2

* fix format issues-3

* fix format issues-4

* fix format issues-5

* connection status component

* connection status component-1

* connection status component-2

* connection status component-3

* address issues

* removal of ms

* removal of ms

* removal of ms-1

* removal of time after connected

* removal of time after connected

* removing unnecessary code

Co-authored-by: Srinath Narayanan <srnara@microsoft.com>
Co-authored-by: Bala Lakshmi Narayanasami <balalakshmin@microsoft.com>
2021-09-03 23:04:26 -07:00
Zachary Foster
39dd293fc1 Fetch aad token against tenant's authority (#1004) 2021-08-30 14:21:32 -05:00
victor-meng
8eeda41021 Move synapse link out of advanced section in add collection panel (#989) 2021-08-19 12:18:21 -07:00
Hardikkumar Nai
960cd9fc55 Resolve ESlint Controls (#990) 2021-08-19 12:16:35 -05:00
Hardikkumar Nai
9ec0ac9f54 Resolve ESLint Contracts (#986) 2021-08-19 12:15:52 -05:00
Steve Faulkner
b66aeb814a Polyfill Buffer (#988) 2021-08-18 21:12:40 -05:00
Tanuj Mittal
410f582378 Fix notebooksTemporarilyDown feature flag (#983) 2021-08-17 07:27:41 +05:30
Hardikkumar Nai
678ca51c77 Update to Webpack 5 (#964)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-08-16 15:44:40 -05:00
Steve Faulkner
2dfd90ca0f Disable Notebooks Test (#980) 2021-08-16 11:35:21 -05:00
Srinath Narayanan
4110be10bd Removing author from publish notebook payload (#966)
* removing author from publish payload

* fixed failing tests
2021-08-15 13:15:30 +05:30
Srinath Narayanan
6e55e397b3 Changes for Disabling notebook related features (#979)
* notebook removal changes

* fixed failing tests
2021-08-14 12:09:22 +05:30
Tanuj Mittal
24d0a16123 Disable notebooks temporarily (#978)
* Disable notebooks temporarily

* Updates
2021-08-14 07:03:58 +05:30
Tanuj Mittal
f8ac36962b Add Security Warning Bar for untrusted notebooks (#970)
* Add Security Warning Bar for untrusted notebooks

* Update

* Another update

* Add a snapshot test

* UX updates

* More updates

* Add tests

* Update test snapshot

* Update string

* Update security message
2021-08-10 23:54:26 +05:30
Sunil Kumar Yadav
51f3f9a718 Move inputTypeahead to react (#946)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-08-04 09:46:18 -05:00
victor-meng
ee4404c439 Fix enable synapse link error (#918)
* Fix enable synapse error

* Default all ARM requests to JSON

Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-08-02 21:11:42 -05:00
Steve Faulkner
b65456f754 Fix bug in Dialog State store (#969) 2021-08-02 20:54:30 -05:00
victor-meng
56699ccb1b Fix new resource tree (#962) 2021-07-30 16:23:36 -07:00
victor-meng
042f980b89 Replace window.confirm and window.alert with modal dialog (#965) 2021-07-30 10:27:27 -07:00
t-tarabhatia
7e0c4b7290 Add changes to Partition Key A/B Test (#954) 2021-07-29 08:48:03 -05:00
victor-meng
a66fc06dad Turn off react resource tree (#963) 2021-07-28 21:29:45 -07:00
victor-meng
a8bc821dec Add initializeGitHubRepos function in useNotebooks store (#957) 2021-07-23 18:44:24 -07:00
victor-meng
1394aae944 Fix validateCollectionId for new tables account (#958) 2021-07-23 18:44:16 -07:00
victor-meng
fecac5625a Migrate resource tree for resource token to react (#956) 2021-07-22 17:11:19 -07:00
victor-meng
dc21032d69 Clean up EditTableEntityPanel (#955) 2021-07-22 16:18:48 -07:00
siddjoshi-ms
39a67dbc98 Sqlx estimated cost calculation (#925)
Adds cost estimate for the SqlX services in the Dedicated Gateway blade (queries the new FetchPrices API to retrieve price data)
2021-07-22 10:48:19 -07:00
Sunil Kumar Yadav
ed9cf01b50 Fixed resourse tree collapse issue (#953) 2021-07-22 11:12:35 -05:00
vaidankarswapnil
e443d17b2e Migrate Index page to React (#952) 2021-07-22 10:19:17 -05:00
victor-meng
401660ae15 Fix connect to github (#951) 2021-07-21 17:47:55 -07:00
Steve Faulkner
c5e4ee9c2b Upgrade Playwright (#939) 2021-07-21 19:32:53 -05:00
victor-meng
913fec4e69 Improve e2e stability (#949) 2021-07-21 16:22:31 -07:00
victor-meng
6d46e48490 Migrate resource tree to react (#941) 2021-07-20 11:40:04 -07:00
victor-meng
afacde4041 Fix AddTableEntityPanel (#945)
* Fix AddTableEntityPanel

* Add CSS

* Fix snapshot
2021-07-19 22:00:33 -07:00
vaidankarswapnil
8a3929775b Strict mode SwitchAccount and SwitchSubscription files (#940) 2021-07-15 10:54:07 -05:00
vaidankarswapnil
b115bb34ca Fix GitHub repos panel issues (#875)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
Co-authored-by: Tanuj Mittal <tamitta@microsoft.com>
2021-07-15 09:44:25 -05:00
Sunil Kumar Yadav
397231dca2 Fixed typescript strict issue of Statusbar, hostedUtils, StringUtils etc (#785) 2021-07-15 09:35:51 -05:00
Hardikkumar Nai
0bbf9de963 Resolve ESLint Errors (#934) 2021-07-15 08:53:07 -05:00
Sunil Kumar Yadav
103b3bf6c9 fixed typescript strict of CqlUtilities.test.ts CapabilityUtils.ts file (#787)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-07-15 00:51:36 -05:00
Sunil Kumar Yadav
7dd8bd567f fixed typescript strict useSidePanel.ts PanelContainerComponent.tsx etc (#802)
* fixed typescript strict useSidePanel.ts PanelContainerComponent.tsx SchemaAnalyzerSplashScreen.tsx files

* update snapshot
2021-07-14 21:42:46 -05:00
Tanuj Mittal
416358f540 Cleanup Schema Analyzer feature flag (#938) 2021-07-15 06:42:14 +05:30
Tanuj Mittal
62b483d740 Fix connect to GitHub (#937) 2021-07-14 17:10:19 -05:00
Tanuj Mittal
c665c4bb7a Fix notebooks not rendering (#936) 2021-07-14 16:55:03 -05:00
t-tarabhatia
887618e77e UX Changes for Default Partition Key A/B Experiment (#928) 2021-07-14 14:10:45 -05:00
victor-meng
8d6ccf8356 import ComponentRegisterer in Explorer (#935) 2021-07-13 19:59:39 -05:00
Zachary Foster
4614ab3427 Adds disableLocalAuth check for listKeys call (#931) 2021-07-13 08:20:13 -04:00
Hardikkumar Nai
71113e403e Resolve ESlint Errors (#932) 2021-07-12 22:38:16 -05:00
Tanuj Mittal
854bd2c149 Use window messaging to pass sensitive data to terminal iframe (#929)
* Use window messaging to pass sensitive data to terminal iframe

* Address feedback

* Format

* Update

* Add tests
2021-07-13 03:18:13 +05:30
Hardikkumar Nai
cfce78242c Remove Explorer.openBrowseQueriesPane (#889) 2021-07-12 09:40:43 -05:00
Hardikkumar Nai
ee3488d3a9 Resolve more ESLint (#920)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-07-12 08:55:19 -05:00
Hardikkumar Nai
e8d320e505 Resolve more ESLint (#922)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-07-12 00:12:38 -05:00
victor-meng
f8ab0a82e0 Move tabs manager to zustand (#915) 2021-07-08 21:32:22 -07:00
Hardikkumar Nai
f4eef1b61b Resolve Eslint for Tables.Constants (#914)
* resolve_eslint_Tables.Constants

* correct spelling mistake
2021-07-08 21:10:29 -05:00
victor-meng
c486c1193e Fix scale component not showing in settings tab (#926) 2021-07-07 11:22:54 -07:00
victor-meng
db34024259 Move notebook flags to zustand (#912) 2021-07-06 15:21:23 -05:00
victor-meng
98d7bb37d5 Move resource token collection to useDatabases zustand store (#916) 2021-07-06 14:05:38 -05:00
Hardikkumar Nai
45d0b3f706 Resolve ESLint QueriesGridComponent (#923) 2021-07-06 09:12:41 -05:00
Hardikkumar Nai
a1d5648bbc Remove Explorer.openAddCollectionPane (#905)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-06-27 23:39:28 -05:00
Steve Faulkner
447db01647 TypeScript 4.3 (#910) 2021-06-24 19:14:26 -05:00
victor-meng
4d2a6999d4 Move selectedNode to zustand (#903) 2021-06-24 13:56:33 -05:00
Hardikkumar Nai
a7239c7579 Remove Explorer.openDeleteDatabaseConfirmationPane (#908)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-06-24 00:21:27 -05:00
Jordi Bunster
c1d4008895 Bypass ko<->React adapter in SettingsTab (#732)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-06-24 00:07:10 -05:00
victor-meng
59655eed5f Remove route handlers (#909)
* Remove tab handlers

* Fix tests
2021-06-23 23:54:37 -05:00
Laurent Nguyen
6b35ab03f2 Switch notebook editor from Monaco back to Code Mirror (#901) 2021-06-23 14:05:52 -05:00
victor-meng
738a02a0f3 Replace subscriptions in resource tree with useDatabases hook (#904) 2021-06-23 13:45:29 -05:00
vaidankarswapnil
b392bed1b0 Migrate Stored Procedure tab to react (#894)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-06-23 11:49:57 -05:00
vaidankarswapnil
f255387ccd Migrate Mongo Shell tab to React (#900) 2021-06-22 23:39:58 -05:00
Steve Faulkner
f9bd12eaa6 Fix for QueryTab Load More (#907) 2021-06-22 15:21:58 -05:00
Steve Faulkner
39215dc4de Remove unused GitHubReposComponentAdapter (#902) 2021-06-18 13:55:54 -05:00
victor-meng
96e6bba38b Move databases to zustand (#898) 2021-06-18 13:25:08 -05:00
Sunil Kumar Yadav
c9fa44f6f4 Fix UDF placeholder text (#899) 2021-06-17 10:54:40 -05:00
Sunil Kumar Yadav
05f59307c2 Migrate userDefinedFunctionTab to React (#860) 2021-06-16 19:09:22 -05:00
vaidankarswapnil
1d449e5b52 Implemented spinner in EditorReact component (#897) 2021-06-16 19:02:33 -05:00
Steve Faulkner
6f68c75257 Allow dynamic MSAL Authority (#896) 2021-06-16 09:13:11 -05:00
Sunil Kumar Yadav
914c372f5b Migrate Trigger tab to React (#855)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-06-15 21:53:50 -05:00
Steve Faulkner
af71a96d54 Add tree and treeitem roles to Resource Tree (#895)
* Add tree and treeitem roles to Resource Tree

* Updates
2021-06-15 14:52:21 -05:00
Steve Faulkner
239c7edf7b Fix Incorrect Image Links (#892) 2021-06-14 20:52:02 -05:00
Hardikkumar Nai
0c6324a4c1 Remove Explorer.openTableSelectQueryPanel (#881)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-06-14 16:57:47 -05:00
Hardikkumar Nai
615bfeaf48 Remove Explorer openEditTableEntityPanel and openAddTableEntityPanel (#887)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-06-14 16:34:37 -05:00
Steve Faulkner
3bc58a80e4 Remove Explorer.isHostedDataExplorerEnabled (#890) 2021-06-14 14:46:14 -05:00
vaidankarswapnil
5da9724deb Migrate Mongo Query Tab to React(#854)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-06-14 14:23:19 -05:00
vaidankarswapnil
999fad3bad Migrate Query Tab to React (#852)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-06-14 14:15:13 -05:00
victor-meng
baa3252ba8 Properly style CassandraAddCollectionPane (#862) 2021-06-11 14:25:05 -07:00
Hardikkumar Nai
959d34d88d Remove Explorer.openCassandraAddCollectionPane (#888) 2021-06-10 23:41:24 -05:00
Steve Faulkner
ce3c2fcfb6 Remove settings component container dependency (#886) 2021-06-10 19:29:41 -05:00
Steve Faulkner
0a1a2bf421 Remove QueryUtils.queryAll and fix test (#885) 2021-06-10 19:29:19 -05:00
victor-meng
b0bbeb188a Fix query tab/pane related issues (#879) 2021-06-10 17:17:11 -07:00
Steve Faulkner
fc9f287d0a Remove Explorer.configure (#884) 2021-06-10 19:02:07 -05:00
Steve Faulkner
006230262c Remvoe Explorer.isServerlessEnabled (#883) 2021-06-10 18:16:43 -05:00
Steve Faulkner
6de77a4fba Update strict mode files (#882) 2021-06-10 12:44:57 -05:00
Hardikkumar Nai
c980af9a5c Remove method Explorer.openSettingPane (#880) 2021-06-10 08:09:38 -05:00
Steve Faulkner
c632342a43 Remove window.jQuery (#878) 2021-06-09 16:03:42 -05:00
Steve Faulkner
bcc9f8dd32 Migrate remaining notification console methods to zustand (#873) 2021-06-09 15:11:12 -05:00
Steve Faulkner
fc9f4c5583 Migrate notebooks workspaces to generated clients (#876) 2021-06-09 15:08:10 -05:00
Steve Faulkner
8f6cac3d35 Remove Unused Splitter (#874) 2021-06-09 08:35:25 -05:00
Steve Faulkner
2c296ede35 Remove unused KO->React Adapters (#863) 2021-06-07 23:14:05 -05:00
victor-meng
16b09df5fa Hide provision throughput checkbox for serverless account (#861) 2021-06-07 23:05:41 -05:00
Srinath Narayanan
ee60f61cfe Mongo tabs UX fixes (#851)
* Fixed mongo tabs UX

* changed logic for new tab index

* moved index to tabs base

* removed getIndex method
2021-06-08 00:17:55 +05:30
vaidankarswapnil
f296c00a1c Fixed graph style panel close issue (#858) 2021-06-07 10:38:13 -05:00
victor-meng
7d0be7d355 Show 10k RU instead of unlimited as max RU for unsharded collection (#845) 2021-05-28 20:11:31 -05:00
Steve Faulkner
04b3ef051a Revert "Upgrade Monaco Editor (#847)" (#850)
This reverts commit 5e2b8d7df0.
2021-05-28 15:49:29 -05:00
Steve Faulkner
b875407d49 Pure React Command Bar (#828) 2021-05-28 15:20:59 -05:00
Steve Faulkner
18ce8749ed Fix Enable Synapse Link (#849) 2021-05-28 15:20:19 -05:00
Steve Faulkner
5e2b8d7df0 Upgrade Monaco Editor (#847) 2021-05-28 13:58:35 -05:00
Steve Faulkner
da13a2b3cf Change CI cleanup to once per day 2021-05-28 09:16:36 -05:00
Zachary Foster
69b8196cf0 Removes feature flag from passing masterKey to SDK (#843)
* Remove Feature flag from master key usage

* Adds flag to fallback

* format
2021-05-28 08:12:33 -04:00
Steve Faulkner
5417e1e120 Enable Preview for Hosted Mode (#844) 2021-05-27 22:13:18 -05:00
Steve Faulkner
481ff9e7fe Migrate SidePanel state to Zustand (#799)
Co-authored-by: hardiknai-techm <HN00734461@TechMahindra.com>
2021-05-27 16:07:07 -05:00
Zachary Foster
e41b52e265 Redo user endpoint dynamic token (#827)
* Redo user endpoint dynamic token

* Fixes aad endpoint race condition, tenant switching, and account permissions

* Export const msalInstance

* Format

* fix import

* format

* Redo getMsalInstance

* format again

* Check for doc endpoint
2021-05-27 16:18:44 -04:00
Steve Faulkner
75d01f655f Show "Open Query" for SQL only (#830) 2021-05-26 15:12:36 -05:00
Hardikkumar Nai
50f83cde87 Remove Explorer.collectionCreationDefaults (#840)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-05-26 15:11:47 -05:00
Tanuj Mittal
6d03cec139 Disable caching for cellOutputViewer.html (#829) 2021-05-27 01:31:28 +05:30
Tanuj Mittal
cb1d60cc90 Hide hosted shells and schema analyzer if VNET, Firewall or Private endpoints is enabled (#826)
* Disable Schema Analyzer if VNET or Firewall is enabled

* Add support for private endpoint connections

* Fix lint warning
2021-05-27 01:31:13 +05:30
Steve Faulkner
0201e6ff92 Remove unused KO dynamic-list component (#838) 2021-05-25 22:40:53 -05:00
Sunil Kumar Yadav
1bcb4246f6 Migration Expand/Collapse Resource Tree to React (#815)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-05-25 15:26:36 -05:00
Steve Faulkner
e7e15c54b3 Cleanup Synapse+Spark Logic (#813) 2021-05-25 14:46:52 -05:00
Sunil Kumar Yadav
522fdc69ab Remove Explorer collection/database text properties (#821)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-05-25 08:32:40 -05:00
Steve Faulkner
bfdeae56d9 Upload to master commit SHA for preview (#823) 2021-05-25 07:42:40 -05:00
Zachary Foster
c42a10faa5 Rollback DB endpoint use by AAD (#822) 2021-05-24 21:21:52 -07:00
victor-meng
0d79f01304 Update free tier limits and messages (#786) 2021-05-24 15:42:54 -05:00
Srinath Narayanan
eae5b2219e Added self serve component telemetry (#820) 2021-05-25 01:06:57 +05:30
Zachary Foster
2fda881770 Use customer endpoint for RBAC AAD auth (#818) 2021-05-24 13:03:51 -05:00
Sunil Kumar Yadav
35f8fa8324 Add files to TS Strict (#803)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-05-21 19:28:08 -05:00
Steve Faulkner
0e413430dc Remove Unused Components (#819) 2021-05-21 19:02:39 -05:00
Sunil Kumar Yadav
afd7f43eb8 Add files to strict mode (#775) 2021-05-21 18:45:54 -05:00
Srinath Narayanan
3b6b987149 Sqlx bug fixes (#816)
* fixed bugs in sqlx

* fixed bug with discard
2021-05-22 01:49:07 +05:30
victor-meng
9787a5ce7c Fix throughput input (#808) 2021-05-21 13:12:13 -05:00
fnbalaji
addf4e248f Users/fnbalaji/dedicated gateway second cut (#812)
* src/SelfServe/Example/SelfServeExample.rp.ts.
Portal changes for DedicatedGateway

1. Change Sqlx endpoints to SqlDedicatedGateway endpoint

2. Remove D32s from the SKU list

3. Add telemetry

4. Remove SKU details field per discussion

5. Support dynamic instance scaling.

* format files to ensure format check and lint tests pass

* Lint fixes

* Lint fixes

* Added metrics blade link

* updated conditions for warning banner

* fixed lint error

* Incorporate metrics link and CR feedback

* Lint fixes

* CR feedback and fix links

* CR feedback and fix links

* Link fix

* More fixes to the Dedicated Gateway layout

* Format check

* Fix casing

Co-authored-by: Srinath Narayanan <srnara@microsoft.com>
2021-05-21 08:53:15 -07:00
Steve Faulkner
f4b0ea7d69 Update generated ARM clients to latest version (#807) 2021-05-20 20:34:29 -05:00
Steve Faulkner
e6b3f01f16 Remove unused packages (#811) 2021-05-20 15:11:21 -05:00
Steve Faulkner
42cf814700 Move <Dialog/> state to zustand (#806) 2021-05-20 09:54:26 -05:00
Steve Faulkner
4351af986e Update TS Strict files 2021-05-19 20:15:10 -05:00
Sunil Kumar Yadav
d06e27a037 fixed typescript strict of accordianComponent.tsx and schemaAnalyser (#804) 2021-05-19 20:11:25 -05:00
Steve Faulkner
735a81db47 Remove Explorer.setFeaturesFromFlights (#801) 2021-05-19 18:58:44 -05:00
Tanuj Mittal
ac753b0780 Enable Schema Analyzer in MPAC (#805) 2021-05-20 00:02:12 +05:30
Steve Faulkner
c2de2f2eec Remove show div after applyExplorerBindings (#797) 2021-05-18 23:41:44 -05:00
Srinath Narayanan
ae76fb0258 Mongo Shell Fixes (#738)
* initial commit for mongo shell refactor

* multile tabs for terminals

* added notebooks enabled check

* added vnet check

* minor edits

* removed console log

* fixes

* hide main 'open mongo shell' button

* addressed PR comments

* Added check for iprules and other fixes

* Updated snapshot

* addressed PR comments

* format errors fixed
2021-05-19 09:32:45 +05:30
Srinath Narayanan
dce52f848c Fixes for selfserve (#796)
* fixes

* more edits

* fixed test errors
2021-05-19 09:32:29 +05:30
Hardikkumar Nai
6e9144b068 Remove generic right pane component (#790)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-05-18 21:57:31 -05:00
Hardikkumar Nai
030a4dec3c Migrate Cassandra Add Container to React (#723) 2021-05-18 21:30:11 -05:00
Zachary Foster
2bc298fef1 [Hosted] AAD implementation for item operations (#643) 2021-05-18 17:59:09 -05:00
fnbalaji
48eeb8419d Portal changes for DedicatedGateway (#742)
* src/SelfServe/Example/SelfServeExample.rp.ts.
Portal changes for DedicatedGateway

1. Change Sqlx endpoints to SqlDedicatedGateway endpoint

2. Remove D32s from the SKU list

3. Add telemetry

4. Remove SKU details field per discussion

5. Support dynamic instance scaling.

* format files to ensure format check and lint tests pass

* Lint fixes

* Lint fixes

* Added metrics blade link

* updated conditions for warning banner

* fixed lint error

* Incorporate metrics link and CR feedback

* Lint fixes

* CR feedback and fix links

* CR feedback and fix links

* Link fix

Co-authored-by: Srinath Narayanan <srnara@microsoft.com>
2021-05-17 22:15:26 -07:00
Srinath Narayanan
62e205be6a Added documentation for Self Serve Model (#716)
* initial commit for docs

* Added readme

* modified selfServeutil docs

* updated docs

* moved documentation to docs folder

* Updated ReadME for selfserve

* added more comments

* Added more function types

* Update index.html

* Update index.html

* minro edits

* minor edits

* package.json updated

* Added Module decorators

* Added modules

* initial commit for mongo shell refactor

* undid changes

* addressed PR comments

* docs changes

* addressed PR comments

* More changes

* Added selfserveexample types file

* minor edits

* minor edits

* Addressed PR comments

* format changes

* added Metrics blade link

* documentation changes

* updated docs

* Addressed PR comments

* fixed format error
2021-05-18 04:40:15 +05:30
Zachary Foster
a06e213b81 Upgrades to msal-browser (#781)
* Replaces msal with msal-browser

* Remove unused id, logging in returns the tenant

* format

* Fix tenant switch

* Removes v1 forceRefresh
2021-05-17 14:10:54 -04:00
Laurent Nguyen
4f3b2f7996 Add 'import 'jquery-typeahead' to fix InputTypeahead in GraphExplorer (#793) 2021-05-17 10:57:12 -05:00
Steve Faulkner
5d1b659e2f Revert "Migrate Collapse/Open Resource Tree to React (#733)" (#792)
This reverts commit d7c62ac7f1.
2021-05-17 10:40:23 -05:00
Hardikkumar Nai
a52a156005 Remove Old Add Database Pane Code (#784)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-05-14 12:05:00 -05:00
Steve Faulkner
f9e8b5eaaa Remove Unused Knockout Components (#783) 2021-05-13 18:03:29 -05:00
vaidankarswapnil
a6b82c8340 Migrate graph style panel to react (#619)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-05-13 15:45:00 -05:00
Tanuj Mittal
404b1fc0f1 Prep Schema Analyzer for flighting (#760)
* Prepare for flighting Schema Analyzer

* Rename SchemaAnalyzerComponent -> SchemaAnalyzer

* Only show Schema option if notebooks enabled
2021-05-13 10:34:09 -07:00
Sunil Kumar Yadav
d7c62ac7f1 Migrate Collapse/Open Resource Tree to React (#733)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-05-12 20:03:52 -05:00
Sunil Kumar Yadav
8e6d274b11 Add Files to TypeScript Strict (#776)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-05-12 19:56:48 -05:00
Sunil Kumar Yadav
2d506f0312 Add Files to TypeScript Strict Mode (#777) 2021-05-12 19:23:10 -05:00
victor-meng
d76aaca0dd Improve lazy load database/collection offer logic (#768) 2021-05-12 19:13:15 -05:00
victor-meng
14e58e5519 Batch of small fixes for RightPaneForm and AddDatabasePane components (#780) 2021-05-12 19:12:03 -05:00
victor-meng
2f6dbd83f3 Fix throughput input component and add database panel (#773) 2021-05-12 13:56:24 -05:00
Steve Faulkner
0a6c7c0ff9 Add Mongo 3.2 End to End Test (#779) 2021-05-12 13:41:44 -05:00
Steve Faulkner
66281447df Pass undefined analyticalTTL if Synapse is disabled (#778) 2021-05-12 11:49:25 -05:00
victor-meng
c5f76ac2a9 Fix isFixedCollectionWithSharedThroughputSupported flag (#774) 2021-05-12 09:16:13 -05:00
Laurent Nguyen
861042c27e Fix bug publish screenshot (#762)
[Preview this branch](https://cosmos-explorer-preview.azurewebsites.net/pull/762?feature.someFeatureFlagYouMightNeed=true)

The main change in this PR fixes the snapshot functionality in the Publish pane-related components. Because the code cell outputs are now rendered in their own iframes for security reasons, a single snapshot of the notebook is no longer possible: each cell output takes its own snapshot and the snapshots are collated on the main notebook snapshot.
- Move the snapshot functionality to notebook components: this removes the reference of the notebook DOM node that we must pass to the Publish pane via explorer.
- Add slice in the state and actions in notebook redux for notebook snapshot requests and result
- Add post robot message to take snapshots and receive results
- Add logic in `NotebookRenderer` to wait for all output snapshots done before taking the main one collating.
- Use `zustand` to share snapshot between Redux world and React world. This solves the issue of keeping the `PanelContainer` component generic, while being able to update its children (`PublishPanel` component) with the new snapshot.

Additional changes:
- Add `local()` in `@font-face` to check if font is already installed before downloading the font (must be done for Safari, but not Edge/Chrome)
- Add "Export output to image" menu item in notebook cell, since each cell output can take its own snapshot (which can be downloaded)
![image](https://user-images.githubusercontent.com/21954022/117454706-b5f16600-af46-11eb-8535-6bf99f3d9170.png)
2021-05-11 18:24:05 +00:00
victor-meng
4ed8fe9e7d Remove old add collection pane (#767) 2021-05-10 20:10:48 -05:00
Srinath Narayanan
4c506da7b9 Added metrics blade link and fixed SelfServe bugs (#764)
* Added metrics blade link

* fixed lint error
2021-05-10 17:36:50 -07:00
Hardikkumar Nai
a81b1a40a3 Use @fluentui/react DocumentCard (#715)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-05-10 14:17:37 -05:00
Hardikkumar Nai
9d5c9d6296 Migrate Add Database Panel to React (#597)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-05-10 14:02:14 -05:00
Steve Faulkner
7efa8ca58f Remove unused Switch Directory Pane (#766) 2021-05-09 22:37:18 -05:00
Hardikkumar Nai
487fbf2072 Remove genericRightPaneComponent and create RightPaneWrapper with form (#679)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-05-09 19:22:44 -05:00
Sunil Kumar Yadav
aa308b3e4d Enable TypeScript noImplicitThis (#761) 2021-05-07 10:25:19 -05:00
Steve Faulkner
db227084be Remove IE11 from Coding Guidelines 2021-05-07 10:04:47 -05:00
victor-meng
d62baf327b Change create wildcard index default value to false for mongo 3.2 (#759)
* Change create wildcard index default value to false for mongo 3.2

* Update snapshots
2021-05-06 21:27:47 -05:00
Jordi Bunster
78eafe1aec Remove NotebookViewerTab (#749)
[Preview this branch](https://cosmos-explorer-preview.azurewebsites.net/pull/749)
2021-05-07 00:20:25 +00:00
Sunil Kumar Yadav
a91ea6c1e4 Remove old Add/Edit Table Entity code (#755) 2021-05-06 18:51:45 -05:00
victor-meng
5606ef3266 Fix table edit entity bug and add collection panel bug for connection string users (#757)
* Fix table edit entity bug and add collection panel bug for connection string users

* Remove parseInt for int64
2021-05-06 18:51:22 -05:00
Steve Faulkner
503f044a70 Update strict mode files (#753) 2021-05-06 12:35:24 -05:00
Hardikkumar Nai
23223cfb23 Upgrade Fluent UI v8 (#688)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-05-05 18:26:03 -05:00
Steve Faulkner
bd47e5ed49 Remove unused Explorer methods (#750) 2021-05-05 17:35:35 -05:00
Hardikkumar Nai
8c05ac740c Remove Explorer.databaseAccount (#717)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-05-05 16:54:50 -05:00
Hardikkumar Nai
fdd12b41c4 Remove Explorer.defaultExperience (#680)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-05-05 13:00:01 -05:00
Tanuj Mittal
d1d28885d0 Use CellOutputViewer for SchemaAnalyzer (#747) 2021-05-05 11:12:27 +05:30
Hardikkumar Nai
aab624e241 Create End to End Graph Test (#745) 2021-05-04 23:01:13 -05:00
Tanuj Mittal
181b53c858 Disable HTML in markdown cell for NotebookReadOnlyRenderer (#746)
[Preview this branch](https://cosmos-explorer-preview.azurewebsites.net/pull/746)

We have a custom implementation of `Markdown` cell that we use in `NotebookRenderer`. This custom implementation disables HTML rendering in markdown cells. This change uses the same for `NotebookReadOnlyRenderer` which we use for Gallery.
2021-05-04 21:43:39 +00:00
Srinath Narayanan
1fdb339fbf Enable the "Enable notebooks" button (#734)
* enable notebooks initial commit

* use only first write location

* addressed PR comments

* Minor edits
2021-05-04 13:06:27 -07:00
Jordi Bunster
b7579d5c8b eslint switch/case exhaustiveness check rule (#739) 2021-05-04 09:12:54 -07:00
vaidankarswapnil
038f3ee684 Move GitHub repos panel to react (#638)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-05-03 19:56:47 -05:00
victor-meng
4efacace16 add collection panel improvements (#630)
Co-authored-by: Jordi Bunster <jbunster@microsoft.com>
2021-04-30 10:23:34 -07:00
victor-meng
9878bf0d5e Fix table entity boolean and number type property values (#737) 2021-04-29 19:23:21 -05:00
Jordi Bunster
5e0523c7d9 Remove GraphExplorerAdapter (#736) 2021-04-29 16:46:31 -05:00
Jordi Bunster
9d0bc86197 Remove 'explorer' from a few Panes (#650)
While working on #549 I realized there were a few places where 'explorer' was only needed to expand the notifications console, so I stripped those out where it was easy.
2021-04-29 10:20:57 -07:00
Sunil Kumar Yadav
531df811da Remove userContext.defaultExperience (#730)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-04-28 14:25:04 -05:00
Steve Faulkner
5a019eb431 Remove Explorer.isPreferredAPIMongo (#557)
Co-authored-by: hardiknai-techm <HN00734461@TechMahindra.com>
2021-04-27 20:50:01 -05:00
Hardikkumar Nai
8f3cb7282b Migrate Publish Notebook Pane to React (#641)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-04-27 19:40:03 -05:00
Jordi Bunster
154db1dcd5 Get our previously strict files a bit tighter (#604)
Now they meet noUnusedParameters
2021-04-27 15:27:17 -07:00
Tanuj Mittal
e8b79d6260 Use postRobot to listen for GitHub OAuth messages (#729) 2021-04-27 22:22:52 +05:30
Jordi Bunster
10c4dd0f19 This is creating a warning in tests (#731) 2021-04-27 09:05:25 -07:00
Jordi Bunster
5cf16d01b5 use ES6 Map if we can (#602) 2021-04-27 08:14:21 -07:00
Jordi Bunster
127784abdd Bypass Knockout and adapters in GalleryTab (#728) 2021-04-27 08:14:07 -07:00
Jordi Bunster
c7b9ff6794 Lazy loaded Monaco (#720)
Lazy loaded Monaco
2021-04-25 21:31:10 -07:00
Hardikkumar Nai
71e7ad4547 Migrate String Input Pane to React (#678)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-04-25 20:22:46 -05:00
Sunil Kumar Yadav
67062c18aa Migration/edit table entity panel to react (#690)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-04-25 17:51:27 -05:00
Sunil Kumar Yadav
ab283cb8ff Update webpack v4.46.0 (#718) 2021-04-24 18:54:59 -05:00
Jordi Bunster
045a28b7a4 Remove 'any' from existing lazy loaded tabs (#721)
* Typesafe lazy loaded GalleryTab

* Typesafe lazy loaded NotebookViewerTab

* Typesafe lazy loaded NotebookManager
2021-04-23 19:54:21 -07:00
Jordi Bunster
b7c911d19a Remove Tabs from ComponentRegisterer (#713)
Now that Tabs are being rendered via Tabs.tsx the knockout component names are not needed either.
2021-04-23 19:53:48 -07:00
Jordi Bunster
5323f6ca4b Lazy load SchemaAnalyzerTab (#722) 2021-04-23 19:52:18 -07:00
Tanuj Mittal
5ecc3d67b0 Add support for Schema Analyzer (#411)
* New MongoSchemaTab

* Address feedback and updates

* Build fixes

* Rename to SchemaAnalyzer

* Format

Co-authored-by: Laurent Nguyen <laurent.nguyen@microsoft.com>
2021-04-22 21:45:21 -04:00
Tanuj Mittal
448566146f Add CellOutputViewer for SandboxOutputs (#686)
* Initial commit

* Optimizations

* Optimize notebookOutputViewer bundle size by lazy loading transforms

* Update package-lock.json

* More optimizations

* Updates

* Fix unit test and other updates

* Address feedback

* Update package-lock.json

* Update test snapshots

* Fix build

* Reduce cellOutputViewer bundle size

* Renaming
2021-04-22 13:37:12 -04:00
vaidankarswapnil
c6766dd69e Migrate new graph vertex panel to react (#702)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-04-22 09:47:59 -05:00
Hardikkumar Nai
9d411c57b0 Remove Explorer.isPreferredApiTable (#656)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-04-21 16:41:08 -05:00
Hardikkumar Nai
ff58eb3724 Migrate Copy Notebook Pane to React (#640)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-04-21 14:09:19 -05:00
Jordi Bunster
e49bcc524f Remove deprecated calls to logConsoleMessage (#608)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-04-21 13:52:01 -05:00
Hardikkumar Nai
cdd6d32990 Rename index.tsx to {class name}.tsx (#689)
* Rename index.tsx to {class name}.tsx

* Update tests

Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-04-21 13:35:32 -05:00
Steve Faulkner
c1dcd0e90b Disable Emulator Test (#712) 2021-04-21 13:33:19 -05:00
Steve Faulkner
e705c490c9 Retry E2E tests up to 3 times (#711) 2021-04-21 12:45:34 -05:00
Sunil Kumar Yadav
72ce5fc813 Migrate Add Table Entity Pane to React (#642)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-04-21 11:33:29 -05:00
Steve Faulkner
d5f3230f6f Retry flaky tests 2021-04-21 11:01:16 -05:00
victor-meng
a07aff1e8c resetData should not set isAutoPilotSelected flag (#708) 2021-04-21 10:11:33 -05:00
vaidankarswapnil
d58fececac Move setup notebooks panel to react (#673)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-04-20 21:51:03 -05:00
Steve Faulkner
b6d60dcc7b Remove unused @types/prop-types (#706) 2021-04-20 18:26:07 -05:00
Steve Faulkner
2fd6305944 Fix E2E tests. Add Playwright (#698) 2021-04-19 22:08:25 -05:00
Tanuj Mittal
914e969083 Add a feature flag to override Juno endpoint (#700)
* Add a feature flag to override Juno endpoint

* Fix build
2021-04-20 06:08:53 +05:30
Jordi Bunster
f2585bba14 TabsManager in react (#500) 2021-04-19 13:11:48 -07:00
Jordi Bunster
19cf203606 Misc fixes from #500 (#701)
* Ensure TabsBase.tabPath is always observable

* In tests, Date.getTime() is not different enough

* Add class name only in the Tab that needs it
2021-04-19 12:58:53 -07:00
dependabot[bot]
19e39ea62f Bump ssri from 6.0.1 to 6.0.2 (#699)
Bumps [ssri](https://github.com/npm/ssri) from 6.0.1 to 6.0.2.
- [Release notes](https://github.com/npm/ssri/releases)
- [Changelog](https://github.com/npm/ssri/blob/v6.0.2/CHANGELOG.md)
- [Commits](https://github.com/npm/ssri/compare/v6.0.1...v6.0.2)

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2021-04-19 11:28:35 -07:00
dependabot[bot]
f8510659de Bump typescript from 4.2.3 to 4.2.4 (#671)
Bumps [typescript](https://github.com/Microsoft/TypeScript) from 4.2.3 to 4.2.4.
- [Release notes](https://github.com/Microsoft/TypeScript/releases)
- [Commits](https://github.com/Microsoft/TypeScript/compare/v4.2.3...v4.2.4)

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2021-04-19 11:01:27 -07:00
Steve Faulkner
7265708c15 Fix Mongo Parition Keys for Connection String mode (#692) 2021-04-18 23:21:10 -05:00
Steve Faulkner
a53c203286 Parse Custom sproc parameters (#693)
* Parse Custom sproc parameters

* Fix PK value parsing too
2021-04-18 23:20:58 -05:00
Jordi Bunster
e0060b12e5 Keep active tab state in one place (manager) (#683)
With this change TabsBase objects will retain a reference to the TabsManager they belong to, so they can ask it if they're the active tab or not.

This removes the possibility for bugs like activating an unmanaged tab, or having more than one active tab, etc.
2021-04-18 17:48:39 -07:00
Jordi Bunster
a9fd01f9b4 Remove stfaul's subscription and account from URL (#694) 2021-04-18 11:22:27 -05:00
Hardikkumar Nai
d74da34742 Remove explorer.is preferred api graph (#655)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-04-17 16:24:17 -05:00
Hardikkumar Nai
02ea26da71 Remove Explorer.isPreferredCassandraAPI (#654)
Co-authored-by: Steve Faulkner <471400+southpolesteve@users.noreply.github.com>
2021-04-17 15:54:47 -05:00
Steve Faulkner
a264ea2275 Adds retry logic to Upload JSON (#684) 2021-04-16 13:23:03 -05:00
Steve Faulkner
649b6a93b4 Fix Stored Procedures for Non-Partitioned Collections (#685) 2021-04-15 22:22:40 -05:00
victor-meng
2bccb7885f Hide TTL in settings tab for Mongo API (#677)
* Hide ttl for mongo

* Fix typo

* Refine info message
2021-04-15 18:51:59 -05:00
Steve Faulkner
3f8e394952 Fix Upload Items (#682)
* Fix Upload Items

* Remove debugger

* Switch to bulk APIs

* Address TODO

Co-authored-by: Jordi Bunster <jbunster@microsoft.com>
2021-04-15 18:25:43 -05:00
Tanuj Mittal
f94f95e788 Hide favorite button from Standalone gallery (#675) 2021-04-15 05:27:04 +05:30
Tanuj Mittal
6dba2e4792 Fix height for SandboxFrame (#676) 2021-04-15 05:26:53 +05:30
Laurent Nguyen
5d4b193865 Fix Markdown Source style to show editor (#674) 2021-04-14 23:51:11 +05:30
Tanuj Mittal
68789c5069 Tighten notebook code cell output sandbox and enable it by default (#664)
* Tighten notebook code cell output sandbox

* Enable sandboxnotebookoutputs by default

* Address feedback
2021-04-14 23:36:44 +05:30
Hardikkumar Nai
1685b34e2a Remove Explorer.isPreferredDocumentDB (#653) 2021-04-13 20:53:14 -05:00
Hardikkumar Nai
56f430ebd8 Migrate Delete Collection Panel to React (#628) 2021-04-13 19:56:58 -05:00
Steve Faulkner
e8033f0bbc Alpha sort subscriptions and accounts in dropdown (#663) 2021-04-13 18:53:59 -05:00
Steve Faulkner
d96cecdfe8 Expose Settings in Hosted Mode (#660) 2021-04-13 18:13:24 -05:00
Steve Faulkner
d90a065e63 Fix feature flags in Portal (#659) 2021-04-13 15:43:05 -05:00
Jordi Bunster
f449328f26 Remove unused tab finder methods from Explorer (#549) 2021-04-13 12:42:00 -05:00
Laurent Nguyen
41800f9ee5 Fix Markdown HTML issue (#658)
This change enables notebooks to escape HTML (which is a vector for malicious attacks).
We import `MarkdownCell` from the `@nteract/stateful-components` sources so that we can point it to the version of `@nteract/markdown` which contains [this fix](e19c7cc590).
This is a temporary workaround from upgrading to `@nteract/stateful-components` to `7.0.0` which causes build and runtime issues see #599).
2021-04-13 17:07:33 +00:00
Steve Faulkner
7bdc31aa67 Fix for Mongo shard key loaded via ARM (#657) 2021-04-13 12:03:25 -05:00
Jordi Bunster
1e6ad113dd Add rel='noreferrer' (#651) 2021-04-12 17:24:11 -07:00
Hardikkumar Nai
05932e1d38 Resolve Lint errors in NotificationConsoleComponent.ts (#527) 2021-04-12 18:06:30 -05:00
Hardikkumar Nai
02e6d8442b Add GraphUtil to Eslint (#626) 2021-04-12 18:04:52 -05:00
Sunil Kumar Yadav
8cf09acc19 Migration/table query select pane to react (#615) 2021-04-12 17:53:56 -05:00
Jordi Bunster
5cd4e93c65 Fix preview URL branch display, include link in new PRs (#644)
* Make it easy to include preview links

* Fix display of currently previewed branch
2021-04-12 15:07:37 -07:00
Jordi Bunster
76e3b7e6f1 Warn on React hook misuse (#632) 2021-04-12 15:13:17 -05:00
Jordi Bunster
dc5679ffd3 Switch to accessibility insights's version of these tools (#603)
* Switch to accessibility insights's version of these tools

* auto-add files meeting strict checks
2021-04-12 15:12:19 -05:00
Jordi Bunster
88f5e7485a Pull request preview URLs (#625)
* Dynamic link to HEAD of a given PR

* Display pr name and link in notification console

* Pass along query string to Explorer

This means you can write a URL like:

https://cosmos-explorer-preview.azurewebsites.net/pull/123?feature.enableFoo=true

and when Explorer loads it'll have enableFoo set to true in the features
object.
2021-04-12 15:10:31 -05:00
Steve Faulkner
662c03580a Call readCollections for Mongo using ARM (#636) 2021-04-12 11:28:52 -05:00
Tanuj Mittal
14fd9054dd Sandbox all outputs in iFrame (#624) 2021-04-12 08:59:18 -07:00
Tanuj Mittal
37e0f50ef2 Fix telemetry from child windows of Data Explorer (#633)
* Fix telemetry from child windows of Data Explorer

* Address feedback
2021-04-09 12:52:41 +05:30
Jordi Bunster
3ab6b2a05d Apease eslint (#631) 2021-04-08 12:31:36 -07:00
Srinath Narayanan
f060d4b1b8 Made webpack changes (#629) 2021-04-07 16:10:26 -07:00
Steve Faulkner
e20c9569e8 Remove dynamic loading status (#616) 2021-04-07 13:31:50 -05:00
Srinath Narayanan
d2423f28dc Added className to SelfServeBaseClass (#627)
* Added className to SelfServeBaseClass

* addressed PR comments

* addressed PR comments

* fixed lint errors
2021-04-07 11:17:15 -07:00
Jordi Bunster
4f22d308b3 Move tabs state out into React (#621)
This PR is just about moving the tabs array. I'm hoping to let it bake for a bit before merging the rest of the tabs in react work.

Preview here: https://ms.portal.azure.com/?dataExplorerSource=https%3A%2F%2Fcosmos-explorer-preview.azurewebsites.net%2Fcommit%2Fda809beb82bb54dc82da18eda41caaf7b9b6597f%2Fexplorer.html#@microsoft.onmicrosoft.com/resource/subscriptions/b9c77f10-b438-4c32-9819-eef8a654e478/resourceGroups/stfaul/providers/Microsoft.DocumentDb/databaseAccounts/stfaul-sql/dataExplorer
2021-04-07 16:15:00 +00:00
Srinath Narayanan
9c6178d0ed Added debug for selfserve (#623) 2021-04-06 14:58:49 -05:00
Steve Faulkner
0f88176a27 Remvoe Explorer.subscriptionType (#622) 2021-04-06 14:35:14 -05:00
Steve Faulkner
cb7760b3f6 Remove Explorer.flight and Explorer.hasWriteAccess (#618)
* Remove Explorer.flight

* Update snapshots

* Remove Explorere.hasWriteAccess

* Update snapshot
2021-04-06 13:33:12 -05:00
Sunil Kumar Yadav
c75618862e Remove unused table-column-options-panel (#620)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-04-06 09:43:15 -05:00
Steve Faulkner
ba3f4829fa Add second App Insights instance (#609) 2021-04-05 18:03:17 -05:00
Srinath Narayanan
250faa5206 SelfServe - Telemetry and Localization improvements (#617)
* made selfServeTelemetry use existing functions

* removed "data" from SelfServeTelemetryType

* fixed localization bugs

* added comment
2021-04-05 14:08:57 -07:00
Jordi Bunster
b150e53814 Remove (unused) dbsettings tab (#607) 2021-04-05 13:51:44 -07:00
Sunil Kumar Yadav
de5a11ff1b Migration/browse queries pane to react (#598)
Co-authored-by: Steve Faulkner <471400+southpolesteve@users.noreply.github.com>
2021-04-04 22:04:34 -05:00
Jordi Bunster
b34c81b3ab TypeScript 4.2 (#600)
Co-authored-by: Steve Faulkner <471400+southpolesteve@users.noreply.github.com>
2021-04-04 22:00:32 -05:00
Sunil Kumar Yadav
2bf9313951 Migrate Load Query Pane to React (#579)
Co-authored-by: Steve Faulkner <471400+southpolesteve@users.noreply.github.com>
2021-04-02 15:44:50 -05:00
Sunil Kumar Yadav
36f8fc1d22 Migrate save query pane to react (#578)
Co-authored-by: Steve Faulkner <471400+southpolesteve@users.noreply.github.com>
2021-04-02 15:10:43 -05:00
Armando Trejo Oliver
1b9070605e Make MongoShell ready message handler backwards compatible (#606)
* Make MongShell message handler backwards compatible

* Fix test title and add one more test case
2021-04-02 12:38:53 -07:00
Steve Faulkner
bd9bdad78a Automated Preview URLs (#601) 2021-04-02 12:24:01 -05:00
Steve Faulkner
ba24eabe7c Remove File upload size check (#605) 2021-04-02 12:23:29 -05:00
Hardikkumar Nai
d8fe4ed77f Fix lint file system util (#481)
Co-authored-by: Steve Faulkner <471400+southpolesteve@users.noreply.github.com>
2021-03-31 22:28:16 -05:00
Sunil Kumar Yadav
75ea475217 [WIP]Cleanup/removed knockout database confirmation panel (#546)
* complete delete database component ui in react

* fixed functional issue and added feedback input

* test cases for deleteDatabaseConfirmationPanel

* Removed Q and fixed PR change request

* removed knockout database confirmation panel and references

* delete deleteDatabaseConfirmationPane.html

* remove test

Co-authored-by: Steve Faulkner <471400+southpolesteve@users.noreply.github.com>
2021-03-31 19:58:38 -05:00
Steve Faulkner
dc20aa96d2 Remove accidentally checked in screenshots 2021-03-31 19:49:45 -05:00
Hardikkumar Nai
5307f6bb5b Migrate Notebook Upload File to React (#581)
Co-authored-by: Steve Faulkner <471400+southpolesteve@users.noreply.github.com>
2021-03-31 19:25:45 -05:00
Sunil Kumar Yadav
c68e84a4b9 Migration/delete database confirmation in react (#542)
Co-authored-by: Steve Faulkner <471400+southpolesteve@users.noreply.github.com>
Co-authored-by: Steve Faulkner <stfaul@microsoft.com>
2021-03-31 17:44:07 -05:00
Hardikkumar Nai
6a69d3a77b Move upload items panel to react (#558)
Co-authored-by: Steve Faulkner <471400+southpolesteve@users.noreply.github.com>
2021-03-31 15:43:05 -05:00
Hardikkumar Nai
458cca8e01 Move setting pane to react (#543)
Co-authored-by: Steve Faulkner <471400+southpolesteve@users.noreply.github.com>
2021-03-31 15:22:52 -05:00
Sunil Kumar Yadav
69ac4e218d Migration/execute sproc params pane in react (#576)
Co-authored-by: Steve Faulkner <471400+southpolesteve@users.noreply.github.com>
2021-03-31 14:43:55 -05:00
Steve Faulkner
b1a904a98f Remove TelemetrtData Type Restriction (#595) 2021-03-30 16:35:45 -05:00
Jordi Bunster
813dbfee5b Defensively set feature flags from window.parent (#594)
This doesn't really fix the fact that portal feature flags are not
being set, but it does re-enable feature flags in hosted mode.
2021-03-30 14:01:30 -07:00
Jordi Bunster
a9ed187213 Bugfix: this was not really used at all (#596) 2021-03-30 13:59:04 -07:00
Srinath Narayanan
6cdac3c53b Added support for self serve telemetry + Localization fixes (#580)
* initial telemetry commit

* Added localization changes

* moved telemetrymessage types to selfservetypes

* fixed compile errors

* fixed failing test

* changed translation file format

* Addressed PR comments

* modified test
2021-03-30 10:11:43 -07:00
Steve Faulkner
63e13cdabe Remove Explorer.nonSystemDatabases (#538)
* Remove Explorer.nonSystemDatabases

* Fix tests
2021-03-30 09:31:21 -05:00
Steve Faulkner
c9eb61351a Remove unused inline-css package (#593) 2021-03-29 21:56:25 -05:00
Hardikkumar Nai
343e82c102 Fix lint query utils (#487)
* Fix Lint errors in QueryUtils

* Format

* Simplify diff

Co-authored-by: Your Name <you@example.com>
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
Co-authored-by: Steve Faulkner <471400+southpolesteve@users.noreply.github.com>
Co-authored-by: Jordi Bunster <jbunster@microsoft.com>
2021-03-29 21:26:41 -05:00
dependabot[bot]
fad3a08fdf Bump node-fetch from 2.6.0 to 2.6.1 in /utils/deployment-status (#587)
Bumps [node-fetch](https://github.com/bitinn/node-fetch) from 2.6.0 to 2.6.1.
- [Release notes](https://github.com/bitinn/node-fetch/releases)
- [Changelog](https://github.com/node-fetch/node-fetch/blob/master/docs/CHANGELOG.md)
- [Commits](https://github.com/bitinn/node-fetch/compare/v2.6.0...v2.6.1)

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2021-03-29 21:22:31 -05:00
vaidankarswapnil
72c2d8592b Fix lint for Database Account Utils (#583) 2021-03-29 17:13:35 -05:00
Jordi Bunster
6b73560122 Create dependabot.yml 2021-03-29 15:09:18 -07:00
Steve Faulkner
9108c01e62 Drop IE11 Support (#476) 2021-03-29 13:31:52 -05:00
Jordi Bunster
4c2f22c2b1 When switching between tabs, editors remain open (#586)
I misunderstood the purpose of a ko.foreach() loop in my changes
back in #534. This re-introduces the loop.
2021-03-29 12:38:41 -05:00
Jordi Bunster
f82b0b442e Update README.md 2021-03-27 11:18:59 -07:00
Armando Trejo Oliver
a66f042c10 Fix table api query projections (#584)
When building queries with projections, the resulting query does not include the "id" property as part of the projection. The "id" property is used by the results grid to display as the RowKey so the result is queries wih projections do not show the RowKey.

This change fixes this by including "id" as part of the projections.
2021-03-26 12:18:04 -07:00
Jordi Bunster
8cc04bab87 MongoDocumentsTab.html was not used here (#582) 2021-03-25 15:24:43 -07:00
victor-meng
ca7cd139ba Use window instead of window.parent in extractFeatures function (#577) 2021-03-23 17:21:41 -07:00
Jordi Bunster
f33ec09040 Remove Explorer.features (#563)
In addition this makes the URL-passed feature flags type safe
2021-03-22 19:04:06 +00:00
Jordi Bunster
b1aeab6b84 Knockout tab changes
This reduces the work involved in rendering knockout tabs, which will make moving them to React under a feature flag a bit easier.
2021-03-22 10:13:44 -07:00
Steve Faulkner
8bf976026f Pass masterkey in connection string mode (#572) 2021-03-19 18:37:13 -05:00
Steve Faulkner
c7ba5de90d Fix Test Explorer AAD Authority (#571) 2021-03-19 14:45:58 -05:00
Steve Faulkner
ddf59d6b24 Fix SplashScreen/Tabs Visible bug (#570) 2021-03-19 12:53:34 -05:00
Tanuj Mittal
316fe7e8bb Reset cell status after execution is canceled (#564) 2021-03-19 22:55:54 +05:30
Steve Faulkner
ee8d2070bf Remove Explorer.isRefreshing (#539) 2021-03-19 12:13:52 -05:00
Armando Trejo Oliver
e97a1643fb Make ready message backwards compatible (#569) 2021-03-19 08:38:57 -07:00
Srinath Narayanan
049e3c36d8 Dedicated gateway portal changes (#568)
* Portal changes for DedicatedGateway

Changes to support creation and deletion of DedicatedGateway resource.

Tested locally with various scenarios.

* Portal changes for DedicatedGateway. CR feedback

* Stylecop changes

* Removing TODO comments

* exposed baselineValues

* added getOnSaveNotification

* disable UI when onSave is taking place

* minro edits

* made polling optional

* added optional polling

* added default

* Added portal notifications

* merged more changes

* minor edits

* added label for description

* Added correlationids and polling of refresh

* Added correlationids and polling of refresh

* minor edit

* added label tooltip

* removed ClassInfo decorator

* Added dynamic decription

* added info and warninf types for description

* more changes to promise retry

* promise retry changes

* compile errors fixed

* New changes

* added operationstatus link

* merged sqlxEdits

* undid sqlx changes

* added completed notification

* passed retryInterval in notif options

* more changes

* added polling on landing on the page

* edits for error display

* added keys blade link

* added link generation

* added link to blade

* Modified info and description

* fixed format errors

* Second cut of the Portal

* OnChange for Number of instances

* added keys for texts

* fixed lint errors

* Added support for undefined dynamic description

* fixed failing test

* disable save/discard buttons

* fixed sqlx errors

* Dedicated Gateway changes to add the keys blade

* Change connectionStringText

* Change connectionStringText

* Text changes

* Added UI improvements

* Code review feedback

* undid package lock changes

* updated package.json

* undid package reverts

Co-authored-by: Balaji Sridharan <fnbalaji@microsoft.com>
Co-authored-by: fnbalaji <75445927+fnbalaji@users.noreply.github.com>
2021-03-19 00:54:13 -07:00
Srinath Narayanan
159c297e8d removed change to package.json (#567) 2021-03-19 00:05:15 -07:00
Srinath Narayanan
4e09e4c7fa Revert "Dedicated Gateway Portal Changes (#540)" (#566)
This reverts commit 909a9fa522.
2021-03-19 00:01:15 -07:00
Armando Trejo Oliver
19880203ec Fix ready message (format) (#565)
* Fix ready message sent to parent frame

* format
2021-03-18 21:40:31 -07:00
artrejo
f929a638d6 Fix ready message sent to parent frame 2021-03-18 20:41:43 -07:00
Steve Faulkner
3cccbdfe81 Fix Lint errors in URLUtility (#462) 2021-03-18 22:19:35 -05:00
victor-meng
65c859c835 Move add collection pane to React (#486)
* Move add collection pane to React

* Add feature flag

* fix unit tests

* FIx merge conflicts and address comments

* Resolve merge conflicts

* Address comments

* Fix e2e test failure

* Update test snapshots

* Update test snapshots
2021-03-18 20:06:13 -05:00
Steve Faulkner
c6090e2663 Update Puppeteer (#562) 2021-03-18 17:53:15 -05:00
Steve Faulkner
c43e24061c [Tables] Check for undefined before compare (#561) 2021-03-18 16:16:10 -05:00
fnbalaji
909a9fa522 Dedicated Gateway Portal Changes (#540)
* Portal changes for DedicatedGateway

Changes to support creation and deletion of DedicatedGateway resource.

Tested locally with various scenarios.

* Portal changes for DedicatedGateway. CR feedback

* Stylecop changes

* Removing TODO comments

* exposed baselineValues

* added getOnSaveNotification

* disable UI when onSave is taking place

* minro edits

* made polling optional

* added optional polling

* added default

* Added portal notifications

* merged more changes

* minor edits

* added label for description

* Added correlationids and polling of refresh

* Added correlationids and polling of refresh

* minor edit

* added label tooltip

* removed ClassInfo decorator

* Added dynamic decription

* added info and warninf types for description

* more changes to promise retry

* promise retry changes

* compile errors fixed

* New changes

* added operationstatus link

* merged sqlxEdits

* undid sqlx changes

* added completed notification

* passed retryInterval in notif options

* more changes

* added polling on landing on the page

* edits for error display

* added keys blade link

* added link generation

* added link to blade

* Modified info and description

* fixed format errors

* Second cut of the Portal

* OnChange for Number of instances

* added keys for texts

* fixed lint errors

* Added support for undefined dynamic description

* fixed failing test

* disable save/discard buttons

* fixed sqlx errors

* Dedicated Gateway changes to add the keys blade

* Change connectionStringText

* Change connectionStringText

* Text changes

* Added UI improvements

* Code review feedback

* undid package lock changes

Co-authored-by: Srinath Narayanan <srnara@microsoft.com>
2021-03-18 14:00:28 -07:00
Srinath Narayanan
be4e490a64 Added SelfServe UI updates (#559)
* Added SelfServe UI modifications

* fixed lint error

* addressed PR comments
2021-03-18 13:40:48 -07:00
Steve Faulkner
9db0975f7f Remove Explorer.isTryCosmos (#556) 2021-03-17 16:02:20 -05:00
Steve Faulkner
a2e3be9680 Remove Explorer.serverId (#555) 2021-03-17 15:24:21 -05:00
Srinath Narayanan
eab9b0ce9c mongo index policy editor bug fix (#550) 2021-03-17 11:52:16 -07:00
Steve Faulkner
d9d88c1517 Remove isAuthWithResourceToken from Explorer (#553)
* Remove isAuthWithResourceToken from Explorer

* Update test

* Remove ifs
2021-03-17 10:41:15 -05:00
Ken Dale
e10ab08d5c Small README.md update (#554) 2021-03-17 10:14:32 -05:00
Tanuj Mittal
3eda8029ba Change default Sort order for Gallery to MostRecent & fix gallery card height for empty tags (#545) 2021-03-17 01:40:38 +00:00
Steve Faulkner
6582d3be37 Fix Mongo AAD bug where collections are not load (#552) 2021-03-16 18:04:26 -05:00
Jordi Bunster
3530633fa2 Test coverage: include all source files (#551)
In addition this changes the thresholds to meet the existing level
of test coverage. This was motivated by work that imported a lot
of existing yet untested (and unexercised) code, which brought down
the total % without adding any more code.
2021-03-16 14:13:36 -07:00
Steve Faulkner
732d7ce8fa Fix upload worker error display (#547) 2021-03-15 22:47:49 -05:00
Steve Faulkner
254c551999 Test Explorer Improvements (#541) 2021-03-14 22:53:16 -05:00
Jordi Bunster
f86883de6c MostRecentActivity changes (#463)
This changes the public API a bit, so that recording activity (the most common use) is less involved.
2021-03-15 03:10:48 +00:00
Steve Faulkner
62550f8d6a Deprecate Explorer Properties (#535) 2021-03-10 23:02:55 -06:00
hardiknai-techm
184910ee6c Resolve Lint errors in NotebookConfigurationUtils.ts (#490) 2021-03-10 21:47:08 -06:00
Steve Faulkner
9253ab1876 Run Emulator test only on master (#536) 2021-03-10 18:52:32 -06:00
Steve Faulkner
920c95b614 Fix cleanup databases task 2021-03-10 16:03:50 -06:00
Srinath Narayanan
1d98c83be5 Created selfServe landing page (#444)
* Portal changes for DedicatedGateway

Changes to support creation and deletion of DedicatedGateway resource.

Tested locally with various scenarios.

* Portal changes for DedicatedGateway. CR feedback

* Stylecop changes

* created selfServe.html landing page

* Removing TODO comments

* exposed baselineValues

* added getOnSaveNotification

* disable UI when onSave is taking place

* minro edits

* made polling optional

* added optional polling

* added default

* Added portal notifications

* merged more changes

* minor edits

* added label for description

* Added correlationids and polling of refresh

* Added correlationids and polling of refresh

* minor edit

* added label tooltip

* removed ClassInfo decorator

* Added dynamic decription

* added info and warninf types for description

* more changes to promise retry

* promise retry changes

* added spinner on selfserve load

* compile errors fixed

* New changes

* added operationstatus link

* merged sqlxEdits

* undid sqlx changes

* added completed notification

* passed retryInterval in notif options

* more retry changes

* more changes

* added polling on landing on the page

* edits for error display

* added keys blade link

* added link generation

* added link to blade

* Modified info and description

* fixed format errors

* added selfserve contract to output files

* addressed PR comments

Co-authored-by: Balaji Sridharan <fnbalaji@microsoft.com>
Co-authored-by: fnbalaji <75445927+fnbalaji@users.noreply.github.com>
2021-03-10 13:55:05 -08:00
Sunil Kumar Yadav
b85a20cbea Fix Lint errors in StringUtility.ts (#479) 2021-03-09 19:33:29 -06:00
hardiknai-techm
d0f6923d24 Configure onsave auto format eslint in vscode (#478) 2021-03-09 19:31:38 -06:00
Srinath Narayanan
ecdc41ada9 Added more selfserve changes (#443)
* exposed baselineValues

* added getOnSaveNotification

* disable UI when onSave is taking place

* added optional polling

* Added portal notifications

* minor edits

* added label for description

* Added correlationids and polling of refresh

* added label tooltip

* removed ClassInfo decorator

* Added dynamic decription

* added info and warninf types for description

* promise retry changes

* compile errors fixed

* merged sqlxEdits

* undid sqlx changes

* added completed notification

* passed retryInterval in notif options

* added polling on landing on the page

* edits for error display

* added link generation

* addressed PR comments

* modified test

* fixed compilation error
2021-03-09 16:07:23 -08:00
Tanuj Mittal
c1b74266eb Gallery fixes (#514)
- Fix COC overlay height
- Make standalone gallery usable on mobile devices

Before:
![image](https://user-images.githubusercontent.com/693092/110415215-81cd0680-80b7-11eb-8000-bd0b8536607a.png)

After:
![image](https://user-images.githubusercontent.com/693092/110415236-898cab00-80b7-11eb-8266-94a5718113fe.png)
2021-03-09 18:42:54 +00:00
hardiknai-techm
ef6ecf0a5f Resolve Lint errors in NavBar component (#528) 2021-03-09 12:34:01 -06:00
Sunil Kumar Yadav
b241771e69 fixed eslint of IteratorUtility (#469) 2021-03-09 12:27:24 -06:00
victor-meng
9d63a346e4 Fix issues in the add collection pane (#501) 2021-03-09 10:18:40 -08:00
hardiknai-techm
2e7c7440d3 Resolve Lint errors in CommandBarUtil.test.tsx (#529) 2021-03-09 10:20:14 -06:00
Sunil Kumar Yadav
641dae30a1 fix-eslint-NTeractUtil.ts (#493) 2021-03-09 10:17:02 -06:00
Sunil Kumar Yadav
f192310697 Fixed lint issue and remove unused code (#491) 2021-03-08 22:54:00 -06:00
Sunil Kumar Yadav
588c1d3ec3 fixed eslint GraphUtil and removed files from eslintignore (#482) 2021-03-08 22:53:08 -06:00
hardiknai-techm
7eb2817acc Resolve Lint errors in MessageValidation.ts (#489) 2021-03-08 22:45:56 -06:00
Sunil Kumar Yadav
9c28b7f9c5 Fixed lint issue of AuthorizationUtils (#496) 2021-03-08 19:10:26 -06:00
Sunil Kumar Yadav
4807169b0c Eslint/fix lint date time utility (#471)
* fixed lint issue of DateTimeUtility

* remove commented code

* Do change request.
2021-03-08 17:20:45 -06:00
Sunil Kumar Yadav
d85b6285ac fixed lint issue of StringUtils file (#480)
* fixed lint issue of StringUtils file

* Fixed null lint issue
2021-03-08 17:20:11 -06:00
hardiknai-techm
9617b80b56 Fix Lint errors in ThemeUtility (#477)
* Fix Lint errors in ThemeUtility

* format ThemeUtility.ts file

Co-authored-by: hardiknai <hardiknai92@gmail.com>
Co-authored-by: zen3-hardik <hardikkumar.n@zen3tech.com>
2021-03-08 17:19:22 -06:00
hardiknai-techm
1af44fb207 Fix Lint errors in JunoUtil (#484) 2021-03-08 17:10:24 -06:00
hardiknai-techm
9d30dd5d0a Resolve Lint errors in AutoPilotUtils.ts (#488) 2021-03-08 17:09:46 -06:00
hardiknai-techm
4eb0dedddb Resolve Lint errors in quickstart.ts (#492) 2021-03-08 17:08:24 -06:00
Steve Faulkner
c844986c34 Move resourceToken test to portal runner sub (#499)
Co-authored-by: Steve Faulkner <stfaul@microsoft.com>
2021-03-08 16:35:20 -06:00
Steve Faulkner
4e702716bd More Flaky Test Improvements (#498) 2021-03-08 14:41:12 -06:00
Jordi Bunster
1d2995ef32 Fix eslint warnings (#456) 2021-03-08 10:29:41 -08:00
hardiknai-techm
ee919a68a5 Resolve Lint errors in definitions.ts (#494) 2021-03-08 11:32:45 -06:00
Steve Faulkner
2ec9df52aa Increase cleanup window to 60 minutes 2021-03-08 11:16:40 -06:00
Steve Faulkner
0ed9fe029d Fix Test DB cleanup conditional 2021-03-08 10:45:26 -06:00
Steve Faulkner
45af1d7cf9 Fix Test Database Cleanup Script (#497) 2021-03-08 10:14:31 -06:00
Srinath Narayanan
69975cd0e8 made public gallery the first tab (#483) 2021-03-05 09:03:48 -08:00
Steve Faulkner
c1141406ff End to End Test Improvements Round 2 (#475) 2021-03-04 22:49:52 -06:00
sunilyadav840
acb284eac7 Eslint/fix lint headers utility (#470) 2021-03-04 20:46:33 -06:00
Steve Faulkner
498c39c877 End to End Test Improvements (#474)
* End to End Test Improvements

* indenting

* Log completed

* Fix up some test

* Add delay

Co-authored-by: Steve Faulkner <stfaul@microsoft.com>
2021-03-04 18:12:31 -06:00
Steve Faulkner
87e016f03c Always publish nuget master build (#472) 2021-03-04 12:24:43 -06:00
Srinath Narayanan
3a1841ad3c Remove injected cell before download (#467)
* remove newcell on download

* addressed pr comments
2021-03-04 00:05:30 -08:00
Jordi Bunster
d314a20b81 Fix subscription leak (#465)
* Fix subscription leak

* Update src/Explorer/SplashScreen/SplashScreen.tsx

Co-authored-by: Laurent Nguyen <laurent.nguyen@microsoft.com>

* Array needs to exist in the first place

Co-authored-by: Laurent Nguyen <laurent.nguyen@microsoft.com>
2021-03-03 21:59:43 -08:00
Jordi Bunster
7188e8d8c2 Remove Explorer.mostRecentActivity (#455)
This also moves the UI concerns of MostRecentActivity over to SplashScreen

Co-authored-by: Steve Faulkner <stfaul@microsoft.com>
2021-03-03 01:24:08 -08:00
Srinath Narayanan
3cd2ec93f2 fixed notebook viewer bug (#461) 2021-03-02 14:19:10 -08:00
Srinath Narayanan
b8e9903287 Added spinner for notebook delete (#458)
* initial UI for delete published nb spinner

* added notebook delete spinner

* addressed PR comments
2021-03-02 13:59:10 -08:00
victor-meng
4127d0f522 Fix sample container is not populated with items (#459) 2021-03-02 12:41:50 -06:00
Srinath Narayanan
56b5a9861b Removed published, favourites tabs for hosted gallery (#457)
* added hosted explorer check

* added check for non null container
2021-03-01 05:24:11 -08:00
Steve Faulkner
10664162c7 Refactor Telemetry to include account name and experience (#452) 2021-02-28 15:56:09 -06:00
Srinath Narayanan
cf01ffa957 removed enableGalleryPublish, enableLinkInjection feature flags (#454)
* removed enableGalleryPublish, enableLinkInjection

* removed ENABLE_GALLERY_PUBLISH
2021-02-26 13:07:44 -08:00
victor-meng
3cc1945140 Fix serverless create issue (#453) 2021-02-25 19:29:29 -06:00
Garrett Ausfeldt
864d9393f2 Change schema endpoints (#447)
* fix resource bug (id is a method)

* change schema endpoints

* fix test

Co-authored-by: REDMOND\gaausfel <gaausfel@microsoft.com>
2021-02-25 11:36:01 -08:00
Steve Faulkner
8629bcbe2d Move "Open Full Screen" to React Panel (#449) 2021-02-24 19:04:28 -06:00
Steve Faulkner
6c90ef2e62 Remove Dialog Adapter (#446) 2021-02-24 18:41:28 -06:00
Steve Faulkner
2d2d8b6efe Remove Unused Tabs (#450) 2021-02-24 17:48:33 -06:00
victor-meng
7cbf7202b0 Fix start with samples in Gremlin API (#448) 2021-02-24 12:17:15 -06:00
Jordi Bunster
e8e5eb55cb Remove SplashScreenComponentAdapter (#440)
Merge SplashScreenComponentAdapter and SplashScreenComponent into one SplashScreen React component.
2021-02-23 11:15:57 -08:00
Steve Faulkner
f0c82a430b Remove AdHoc Access and Token Renewal Pane (#445) 2021-02-23 11:16:00 -06:00
Steve Faulkner
3777b6922e Revert "ci: add Azure Static Web Apps workflow file " This reverts commit aec951694a. # Please enter the commit message for your changes. Lines starting # with '#' will be ignored, and an empty message aborts the commit. # # On branch master # Your branch is up to date with 'origin/master'. # # Changes to be committed: # deleted: .github/workflows/azure-static-web-apps-victorious-sea-0ea0a4710.yml # 2021-02-22 20:21:40 -06:00
Azure Static Web Apps
aec951694a ci: add Azure Static Web Apps workflow file
on-behalf-of: @Azure opensource@microsoft.com
2021-02-22 19:58:22 -06:00
Steve Faulkner
07474b8271 Remove window.authType (#437) 2021-02-22 14:43:58 -06:00
Deborah Chen
e092e5140f Fixing issue with autoscale A/B test (#442)
Currently, the first time a user opens the New Container pane, the autoscale setting is not being read from the flight info. This is because the flight into is being set in resetData(), which is not called the 1st time a user opens the pane. 

This change adds logic to set the flight info on the open call.
2021-02-22 18:54:55 +00:00
Steve Faulkner
1f4074f3e8 Update Coding Guidelines (#441)
Co-authored-by: Christopher Anderson <anderson.chris.john@gmail.com>
2021-02-18 13:18:50 -06:00
Chris-MS-896
1ec0d9a0be End to end testcase for mongoDb index policy (#426)
* 'update for index policy'

* input

* 'refactor for ci/cd'

* 'refactor for ci/cd'

* no message

* 'refractor'

* 'format change'

* added changes

* "refactor"

* ‘test lint’

* "format"

* “push setting back”

* ‘refractor’

* Update test/utils/shared.ts

Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>

Co-authored-by: Srinath Narayanan <srnara@microsoft.com>
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-02-18 05:40:58 -08:00
Srinath Narayanan
eddc334cb5 mongo index editor for AAD login + hostedExplorer (#438) 2021-02-17 12:52:47 -08:00
victor-meng
22d8a7a1be Move database settings tab to react (#386)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-02-10 16:06:14 -06:00
victor-meng
4210e0752b Move delete collection confirmation pane to react (#417) 2021-02-10 13:44:00 -08:00
Steve Faulkner
b217d4be1b Delete Cassandra tables/keyspaces via ARM (#436) 2021-02-08 18:52:53 -06:00
victor-meng
81fd442fad Make getCollectionDataUsageSize call fail gracefully (#434) 2021-02-08 16:02:02 -08:00
Steve Faulkner
87f7dd2230 Rename Feedback -> Report Issue (#425)
Co-authored-by: victor-meng <56978073+victor-meng@users.noreply.github.com>
2021-02-08 14:23:55 -06:00
Srinath Narayanan
9926fd97a2 Test explorer changes (#420)
* Changes to publish pane

* fixed format errors

* fixed failing test

* added test explorer changes for mongo accounts

* added log for test

* fixed lit errors

* added secrets to ci.yml file

* fixed failing self serve test
2021-02-08 09:42:16 -08:00
Tanuj Mittal
2a7546e0de Skip SelfServe e2e test (#432) 2021-02-06 02:30:46 +05:30
Tanuj Mittal
4b442dd869 Use GET instead of PATCH for some Juno endpoints (#431) 2021-02-06 02:01:34 +05:30
Tanuj Mittal
f0b4737313 Update gallery colors (#430)
* Update gallery colors

* fix lint error

* Fix test
2021-02-06 01:19:36 +05:30
Srinath Narayanan
8dc5ed590a Added Spinner for public gallery (#427)
* Added more publish changes

* addressed PR comments

* fixed lint errors

Co-authored-by: Tanuj Mittal <tamitta@microsoft.com>
2021-02-05 11:32:26 -08:00
Tanuj Mittal
afaa844d28 Telemetry updates (#429) 2021-02-06 00:26:20 +05:30
Tanuj Mittal
3e5a876ef2 Fix setting isGalleryPublishEnabled when flight is enabled (#428) 2021-02-05 20:55:08 +05:30
Tanuj Mittal
51abf1560a Disable dark overlay for Dialog (#423) 2021-02-05 19:28:57 +05:30
Srinath Narayanan
1c0fed88c0 Changes to cards in notebook gallery (#422)
* added gallery changes

* addressed PR comments
2021-02-05 02:32:55 -08:00
Tanuj Mittal
93cfd52e36 Update Code of Conduct Overlay and other minor changes (#424)
* Use light theme for coc-overlay

* Updates

* Fix vertical height for COC overlay
2021-02-05 14:56:50 +05:30
Tanuj Mittal
3fd014ddad Disable caching for config.json file (#421)
* Disable caching for config.json file

* Disable cache when fetching config.json
2021-02-04 15:25:13 +05:30
Srinath Narayanan
3b6fda4fa5 Changes to notebook publish pane (#419)
* Changes to publish pane

* fixed format errors

* fixed failing test

Co-authored-by: Tanuj Mittal <tamitta@microsoft.com>
2021-02-03 10:46:51 -08:00
Tanuj Mittal
db7c45c9b8 Enable gallery publishing in MPAC (#416)
* Enable gallery publishing in MPAC

* Address feedback

* Use ENABLE_GALLERY_PUBLISH config in standalone gallery

* Fix test
2021-02-03 23:42:11 +05:30
Tanuj Mittal
4f6b75fe79 More gallery updates (#418)
* More gallery updates

* Add PublishContent icon

* Address feedback
2021-02-03 23:24:27 +05:30
Tanuj Mittal
5038a01079 Add telemetry for Notebooks Gallery and other updates (#413)
* Add telemetry for Notebooks Gallery

* More changes

* Address feedback and fix lint error

* Fix margins for My published work
2021-02-03 14:48:50 +05:30
Tanuj Mittal
e0063c76d9 Add support for gallerypublish flight (#412) 2021-02-03 02:05:19 +05:30
Tanuj Mittal
9278654479 Public gallery improvements (#409)
- [x] Don't show extension in name field for publish
- [x] Open "Your published work" tab after publishing
- [x] Continue showing dialog for Report Abuse status
- [x] For showing COC in Public Gallery tab show backdrop of thumbnails
- [x] Liked -> My Favorites & Your published work -> My published work
2021-01-29 17:04:38 +00:00
Tanuj Mittal
59113d7bbf Update Juno endpoints (#405) 2021-01-29 20:28:20 +05:30
Tim Sander
88d8200c14 Check that customer is using Mongo 3.6 before applying index everything policy (#410) 2021-01-28 15:26:47 -06:00
Srinath Narayanan
6aaddd9c60 Added localization for the Self Serve Model (#406)
* added localization for selfserve model

* added comment

* addressed PR comments

* fixed format errors

* Addressed PR comments
2021-01-28 11:17:02 -08:00
Jordi Bunster
f8ede0cc1e Remove Q from ViewModels (#390)
I got cold feet at the thought of merging #324 in one go, so I'm going to split it into smaller chunks and keep rebasing the large one until there's no more Q.
2021-01-28 18:13:26 +00:00
Laurent Nguyen
bddb288a89 Update package versions and package-lock.json (#404)
The file `package-lock.json` is not in sync with `package.json` anymore. This causes build issues when upgrading a package.
This change sync's `package-lock.json` and fixes the build issues.
2021-01-28 08:50:24 +00:00
Steve Faulkner
a14d20a88e Fix applyExplorerBindings call in Portal (#408) 2021-01-27 20:37:14 -06:00
Steve Faulkner
f1db1ed978 Region Select Button (#407) 2021-01-27 15:32:53 -06:00
Laurent Nguyen
86a483c3a4 Fix notebook cell selection bug (#402)
This fixes a bug that prevents getting focus to a text cell (effectively preventing editing) when the window height is small after double-clicking on a neighboring code cell.
The issue is that selecting a text cell is broken likely because there's a behavior change in MonacoEditor that keeps the focus on the code cell. The selection issue will probably be resolved when migrating the text cell to Monaco (which will acquire and keep focus the same way), but for now, this will disable the faulty code which doesn't appear to work anymore (presumably auto-scrolling to the cell).
2021-01-27 09:09:54 +00:00
Tanuj Mittal
263262a040 Update Juno endpoints to pass subscriptionId (#339)
Corresponding [server side change](https://msdata.visualstudio.com/CosmosDB/_git/CosmosDB-portal/pullrequest/464443?_a=overview) has been deployed to Prod so now we can go ahead with DE side changes.
2021-01-27 08:08:58 +00:00
victor-meng
bd4d8da065 Move notification console to react (#400) 2021-01-26 15:32:37 -08:00
Steve Faulkner
59ec18cd9b Add basic static code metrics (#396) 2021-01-26 13:13:13 -06:00
Srinath Narayanan
49bf8c60db Added more Self Serve functionalities (#401)
* added recursion and inition decorators

* working version

* added todo comment and removed console.log

* Added Recursive add

* removed type requirement

* proper resolution of promises

* added custom element and base class

* Made selfServe standalone page

* Added custom renderer as async type

* Added overall defaults

* added inital open from data explorer

* removed landingpage

* added feature for self serve type

* renamed sqlx->example and added invalid type

* Added comments for Example

* removed unnecessary changes

* Resolved PR comments

Added tests
Moved onSubmt and initialize inside base class
Moved testExplorer to separate folder
made fields of SelfServe Class non static

* fixed lint errors

* fixed compilation errors

* Removed reactbinding changes

* renamed dropdown -> choice

* Added SelfServeComponent

* Addressed PR comments

* added toggle, visibility, text display,commandbar

* added sqlx example

* added onRefrssh

* formatting changes

* rmoved radioswitch display

* updated smartui tests

* Added more tests

* onSubmit -> onSave

* Resolved PR comments
2021-01-26 09:44:14 -08:00
Steve Faulkner
b0b973b21a Refactor explorer config into useKnockoutExplorer hook (#397)
Co-authored-by: Steve Faulkner <stfaul@microsoft.com>
2021-01-25 13:56:15 -06:00
Chris-MS-896
3529e80f0d no message (#398) 2021-01-22 10:02:35 -06:00
Srinath Narayanan
a298fd8389 Added message to indicate compound indexes are not supported in Mongo Index editor (#395)
* mongo message

* Added test and bug fix in Main.tsx

* format changes

* added new formatting

* added null check
2021-01-21 10:56:05 -08:00
Steve Faulkner
1ecc467f60 Remove IE nuget (#394) 2021-01-20 12:46:12 -06:00
Steve Faulkner
b3cafe3468 Add telemetry to Spark+Synapse Pools (#392) 2021-01-20 11:08:29 -06:00
Steve Faulkner
4be53284b5 Prettier 2.0 (#393) 2021-01-20 09:15:01 -06:00
Srinath Narayanan
c1937ca464 Added the Self Serve Data Model (#367)
* added recursion and inition decorators

* working version

* added todo comment and removed console.log

* Added Recursive add

* removed type requirement

* proper resolution of promises

* added custom element and base class

* Made selfServe standalone page

* Added custom renderer as async type

* Added overall defaults

* added inital open from data explorer

* removed landingpage

* added feature for self serve type

* renamed sqlx->example and added invalid type

* Added comments for Example

* removed unnecessary changes

* Resolved PR comments

Added tests
Moved onSubmt and initialize inside base class
Moved testExplorer to separate folder
made fields of SelfServe Class non static

* fixed lint errors

* fixed compilation errors

* Removed reactbinding changes

* renamed dropdown -> choice

* Added SelfServeComponent

* Addressed PR comments

* merged master

* added selfservetype.none for emulator and hosted experience

* fixed formatting errors

* Removed "any" type

* undid package.json changes
2021-01-19 22:42:45 -08:00
Steve Faulkner
2b2de7c645 Migrated Hosted Explorer to React (#360)
Co-authored-by: Victor Meng <vimeng@microsoft.com>
Co-authored-by: Steve Faulkner <stfaul@microsoft.com>
2021-01-19 16:31:55 -06:00
Deborah Chen
8c40df0fa1 Adding in experimentation for autoscale test (#345)
* Adding autoscale flight info

* Add flight info to cassandra collection pane

* Add telemetry for autoscale toggle on/off in create resource blade and scale/settings

* Run formatting and add expected properties to test file

* removing empty line

* Updating to pass unit tests

Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-01-15 17:15:15 -06:00
Steve Faulkner
fcbc9474ea Remove Preview for Synapse Link (#389) 2021-01-15 09:51:14 -06:00
Steve Faulkner
81f861af39 Empty commit to refresh nuget after transient failures 2021-01-14 17:37:24 -06:00
victor-meng
9afa29cdb6 Properly construct the query to delete Cassandra row (#388) 2021-01-14 16:59:31 -06:00
Chris-MS-896
9a1e8b2d87 Add rest of three utils files to Matser (#370)
* 'minor change'
2021-01-13 17:49:06 -06:00
Tim Sander
babda4d9cb fix issue where Mongo indexing checkbox stops adding wildcard index (#384) 2021-01-12 18:38:16 -06:00
Steve Faulkner
9d20a13dd4 Warn on SubQuery (#378) 2021-01-12 13:53:15 -06:00
Chris-MS-896
3effbe6991 no message (#372) 2021-01-12 13:09:20 -06:00
Chris-MS-896
af53697ff4 Add file of Terminal to Master (#371)
* "minor changes"
2021-01-12 12:55:47 -06:00
Chris-MS-896
b1ad80480e Add two files of notebook component in Matser (#363)
* “minor changes”
2021-01-12 12:55:21 -06:00
Armando Trejo Oliver
9247a6c4a2 A11y fixes - Add a skip link and remove duplicate ids (#381)
* Add a skip link to allow people who navigate sequentially through content more direct access to the primary content of the Data Explorer

Co-authored-by: Chris Cao (Zen3 Infosolutions America Inc) <v-yiqcao@microsoft.com>

* Rename id of partition key field in  Add Collection Pane to ensure no  elements contain duplicate attributes.

Co-authored-by: Chris Cao (Zen3 Infosolutions America Inc) <v-yiqcao@microsoft.com>
2021-01-12 09:55:04 -08:00
Steve Faulkner
767d46480e Revert TablesEntitiyListViewModel changes (#382) 2021-01-11 16:16:40 -06:00
Chris-MS-896
2d98c5d269 add ArraysByKeyCache.ts (#366)
* 'add ArraysByKeyCache'
* "minor change"
2021-01-08 22:51:50 -06:00
Steve Faulkner
6627172a52 Add Architecture Diagram to README (#380) 2021-01-08 22:20:40 -06:00
Steve Faulkner
19fa5e17a5 Fix JSONEditor bug with undefined value (#379) 2021-01-08 22:20:06 -06:00
Chris-MS-896
a4a367a212 Add all arm request related files to Matser (#373)
* “minor changes”
* 'changes for unit test'
2021-01-08 21:56:29 -06:00
Chris-MS-896
983c9201bb Add two files of GraphExplorer component in Master (#365) 2021-01-08 21:14:53 -06:00
Chris-MS-896
76d7f00a90 Add two files of Table to master (#364) 2021-01-08 20:56:59 -06:00
Chris-MS-896
6490597736 add CollapsiblePanel/CollapsiblePanelComponent.ts and /ErrorDisplayComponent to Master (#357) 2021-01-08 20:29:15 -06:00
Chris-MS-896
229119e697 add file offerUtility to tsconfig (#356) 2021-01-08 20:14:12 -06:00
Steve Faulkner
ceefd7c615 Fix Conflict Resolution path setting (#377)
* Fix Conflict Resolution path setting

* Fix test
2021-01-08 12:36:44 -06:00
Laurent Nguyen
6e619175c6 Fix missing scrollbar in left pane when too many collections/notebooks (#375)
Constrain left pane container to height: 100% so that scrollbar show up when content wants to overflow.
The `main` classname seems too generic, but I left it alone (so I don't break anything), since this part will eventually be ported to React.
2021-01-08 14:00:26 +00:00
victor-meng
08e8bf4bcf Fix two settings tab issues (#374) 2021-01-07 15:38:13 -06:00
Chris-MS-896
89dc0f394b Add Spliter file to Master (#358) 2021-01-06 12:51:42 -06:00
Chris-MS-896
30e0001b7f no message (#359) 2021-01-05 16:45:13 -06:00
Steve Faulkner
4a8f408112 Add UX for Mongo indexing experiment (#368)
Co-authored-by: Tim Sander <tisande@microsoft.com>
2021-01-05 16:04:55 -06:00
Armando Trejo Oliver
e801364800 Remove stale .main class from tree.less (#362)
.main CSS class has a naming conflict with Moncao editor CSS classes and this is causing  A11y issues with Moncao editor.

This class should no longer be used since we moved to the new tree component in REACT, so I am removing it. From my testing, this is not affecting anything.

If we find any styling issue later, we should fix without adding back this class.
2021-01-05 10:53:55 -08:00
victor-meng
a55f2d0de9 Free tier improvements in DE (#348)
Co-authored-by: Steve Faulkner <southpolesteve@gmail.com>
2021-01-04 12:56:55 -08:00
Steve Faulkner
d40b1aa9b5 Remove Empty Query Logging (#361) 2021-01-04 13:58:01 -06:00
Steve Faulkner
cc63cdc1fd Remove dependency on canvas (#354) 2020-12-26 21:56:37 -06:00
1302 changed files with 236574 additions and 99766 deletions

16
.devcontainer/Dockerfile Normal file
View File

@@ -0,0 +1,16 @@
FROM mcr.microsoft.com/devcontainers/typescript-node:1-22-bookworm
# Install pre-reqs for gyp, and 'canvas' npm module
RUN apt-get update && \
apt-get install -y \
make \
gcc \
g++ \
python3-minimal \
libcairo2-dev \
libpango1.0-dev \
&& \
rm -rf /var/lib/apt/lists/*
# Install node-gyp to build native modules
RUN npm install -g node-gyp

View File

@@ -0,0 +1,32 @@
// For format details, see https://aka.ms/devcontainer.json. For config options, see the
// README at: https://github.com/devcontainers/templates/tree/main/src/typescript-node
{
"name": "Azure Cosmos DB Explorer",
// Or use a Dockerfile or Docker Compose file. More info: https://containers.dev/guide/dockerfile
"build": {
"dockerfile": "Dockerfile"
},
"onCreateCommand": ".devcontainer/oncreate",
"features": {
"ghcr.io/devcontainers/features/azure-cli:1": {
"version": "latest"
},
"ghcr.io/devcontainers/features/github-cli:1": {
"installDirectlyFromGitHubRelease": true,
"version": "latest"
},
"ghcr.io/devcontainers/features/sshd:1": {
"version": "latest"
}
}
// Features to add to the dev container. More info: https://containers.dev/features.
// "features": {},
// Use 'forwardPorts' to make a list of ports inside the container available locally.
// "forwardPorts": [],
// Use 'postCreateCommand' to run commands after the container is created.
// "postCreateCommand": "yarn install",
// Configure tool-specific properties.
// "customizations": {},
// Uncomment to connect as root instead. More info: https://aka.ms/dev-containers-non-root.
// "remoteUser": "root"
}

4
.devcontainer/oncreate Executable file
View File

@@ -0,0 +1,4 @@
#!/usr/bin/env bash
# Install packages once, to prime the node_modules directory.
npm ci

10
.editorconfig Normal file
View File

@@ -0,0 +1,10 @@
# NOTE: Prettier reads EditorConfig settings, so be careful adjusting settings here and assuming they'll only affect your editor ;).
# top-most EditorConfig file
root = true
[*.yml]
indent_size = 2
[*.{js,jsx,ts,tsx}]
indent_size = 2

View File

@@ -1,14 +1 @@
PORTAL_RUNNER_USERNAME=
PORTAL_RUNNER_PASSWORD=
PORTAL_RUNNER_SUBSCRIPTION=
PORTAL_RUNNER_RESOURCE_GROUP=
PORTAL_RUNNER_DATABASE_ACCOUNT=
PORTAL_RUNNER_DATABASE_ACCOUNT_KEY=
PORTAL_RUNNER_CONNECTION_STRING=
NOTEBOOKS_TEST_RUNNER_TENANT_ID=
NOTEBOOKS_TEST_RUNNER_CLIENT_ID=
NOTEBOOKS_TEST_RUNNER_CLIENT_SECRET=
CASSANDRA_CONNECTION_STRING=
MONGO_CONNECTION_STRING=
TABLES_CONNECTION_STRING=
DATA_EXPLORER_ENDPOINT=https://localhost:1234/hostedExplorer.html

View File

@@ -1,48 +1,30 @@
playwright.config.ts
**/node_modules/
src/**/__mocks__/**/*
dist/
Contracts/
src/Api/Apis.ts
src/AuthType.ts
src/Bindings/BindingHandlersRegisterer.ts
src/Bindings/ReactBindingHandler.ts
src/Common/ArrayHashMap.ts
src/Common/Constants.ts
src/Common/CosmosClient.test.ts
src/Common/CosmosClient.ts
src/Common/DataAccessUtilityBase.test.ts
src/Common/DataAccessUtilityBase.ts
src/Common/DeleteFeedback.ts
src/Common/DocumentClientUtilityBase.ts
src/Common/EditableUtility.ts
src/Common/HashMap.test.ts
src/Common/HashMap.ts
src/Common/HeadersUtility.test.ts
src/Common/HeadersUtility.ts
src/Common/IteratorUtilities.test.ts
src/Common/IteratorUtilities.ts
src/Common/Logger.test.ts
src/Common/MessageHandler.test.ts
src/Common/MessageHandler.ts
src/Common/MongoProxyClient.test.ts
src/Common/MongoUtility.ts
src/Common/NotificationsClientBase.ts
src/Common/ObjectCache.test.ts
src/Common/ObjectCache.ts
src/Common/QueriesClient.ts
src/Common/Splitter.ts
src/Common/ThemeUtility.ts
src/Common/UrlUtility.ts
src/Config.ts
src/Contracts/ActionContracts.ts
src/Contracts/DataModels.ts
src/Contracts/Diagnostics.ts
src/Contracts/ExplorerContracts.ts
src/Contracts/Versions.ts
src/Contracts/ViewModels.ts
src/Controls/Heatmap/Heatmap.test.ts
src/Controls/Heatmap/Heatmap.ts
src/Controls/Heatmap/HeatmapDatatypes.ts
src/Definitions/adal.d.ts
src/Definitions/datatables.d.ts
src/Definitions/gif.d.ts
src/Definitions/globals.d.ts
@@ -54,41 +36,16 @@ src/Definitions/jquery.d.ts
src/Definitions/plotly.js-cartesian-dist.d-min.ts
src/Definitions/png.d.ts
src/Definitions/svg.d.ts
src/Definitions/worker.d.ts
src/Explorer/ComponentRegisterer.test.ts
src/Explorer/ComponentRegisterer.ts
src/Explorer/ContextMenuButtonFactory.ts
src/Explorer/Controls/CollapsiblePanel/CollapsiblePanelComponent.ts
src/Explorer/Controls/CommandButton/CommandButton.test.ts
src/Explorer/Controls/CommandButton/CommandButton.ts
src/Explorer/Controls/DiffEditor/DiffEditorComponent.ts
src/Explorer/Controls/DynamicList/DynamicList.test.ts
src/Explorer/Controls/DynamicList/DynamicListComponent.ts
src/Explorer/Controls/Editor/EditorComponent.ts
src/Explorer/Controls/ErrorDisplayComponent/ErrorDisplayComponent.ts
src/Explorer/Controls/InputTypeahead/InputTypeahead.ts
src/Explorer/Controls/JsonEditor/JsonEditorComponent.ts
src/Explorer/Controls/Notebook/NotebookAppMessageHandler.ts
src/Explorer/Controls/ThroughputInput/ThroughputInput.test.ts
src/Explorer/Controls/ThroughputInput/ThroughputInputComponent.ts
src/Explorer/Controls/ThroughputInput/ThroughputInputComponentAutoPilotV3.ts
src/Explorer/Controls/Toolbar/IToolbarAction.ts
src/Explorer/Controls/Toolbar/IToolbarDisplayable.ts
src/Explorer/Controls/Toolbar/IToolbarDropDown.ts
src/Explorer/Controls/Toolbar/IToolbarItem.ts
src/Explorer/Controls/Toolbar/IToolbarSeperator.ts
src/Explorer/Controls/Toolbar/IToolbarToggle.ts
src/Explorer/Controls/Toolbar/KeyCodes.ts
src/Explorer/Controls/Toolbar/Toolbar.ts
src/Explorer/Controls/Toolbar/ToolbarAction.ts
src/Explorer/Controls/Toolbar/ToolbarDropDown.ts
src/Explorer/Controls/Toolbar/ToolbarToggle.ts
src/Explorer/Controls/Toolbar/Utilities.ts
src/Explorer/DataSamples/ContainerSampleGenerator.test.ts
src/Explorer/DataSamples/ContainerSampleGenerator.ts
src/Explorer/DataSamples/DataSamplesUtil.test.ts
src/Explorer/DataSamples/DataSamplesUtil.ts
src/Explorer/Explorer.ts
src/Explorer/Graph/GraphExplorerComponent/ArraysByKeyCache.test.ts
src/Explorer/Graph/GraphExplorerComponent/ArraysByKeyCache.ts
src/Explorer/Graph/GraphExplorerComponent/D3ForceGraph.test.ts
@@ -96,22 +53,12 @@ src/Explorer/Graph/GraphExplorerComponent/D3ForceGraph.ts
src/Explorer/Graph/GraphExplorerComponent/EdgeInfoCache.ts
src/Explorer/Graph/GraphExplorerComponent/GraphData.test.ts
src/Explorer/Graph/GraphExplorerComponent/GraphData.ts
src/Explorer/Graph/GraphExplorerComponent/GraphUtil.test.ts
src/Explorer/Graph/GraphExplorerComponent/GraphUtil.ts
src/Explorer/Graph/GraphExplorerComponent/GremlinClient.test.ts
src/Explorer/Graph/GraphExplorerComponent/GremlinClient.ts
src/Explorer/Graph/GraphExplorerComponent/GremlinSimpleClient.test.ts
src/Explorer/Graph/GraphExplorerComponent/GremlinSimpleClient.ts
src/Explorer/Graph/GraphStyleComponent/GraphStyle.test.ts
src/Explorer/Graph/GraphStyleComponent/GraphStyleComponent.ts
src/Explorer/Graph/NewVertexComponent/NewVertex.test.ts
src/Explorer/Graph/NewVertexComponent/NewVertexComponent.ts
src/Explorer/Menus/CommandBar/CommandBarComponentButtonFactory.test.ts
src/Explorer/Menus/CommandBar/CommandBarComponentButtonFactory.ts
src/Explorer/Menus/ContextMenu.ts
src/Explorer/MostRecentActivity/MostRecentActivity.ts
src/Explorer/Notebook/FileSystemUtil.ts
src/Explorer/Notebook/NTeractUtil.ts
src/Explorer/Notebook/NotebookClientV2.ts
src/Explorer/Notebook/NotebookComponent/NotebookContentProvider.ts
src/Explorer/Notebook/NotebookComponent/__mocks__/rx-jupyter.ts
@@ -126,270 +73,76 @@ src/Explorer/Notebook/NotebookContainerClient.ts
src/Explorer/Notebook/NotebookContentClient.ts
src/Explorer/Notebook/NotebookContentItem.ts
src/Explorer/Notebook/NotebookUtil.ts
src/Explorer/OpenActions.test.ts
src/Explorer/OpenActions.ts
src/Explorer/OpenActionsStubs.ts
src/Explorer/Panes/AddCollectionPane.test.ts
src/Explorer/Panes/AddCollectionPane.ts
src/Explorer/Panes/AddDatabasePane.test.ts
src/Explorer/Panes/AddDatabasePane.ts
src/Explorer/Panes/BrowseQueriesPane.ts
src/Explorer/Panes/CassandraAddCollectionPane.ts
src/Explorer/Panes/ContextualPaneBase.ts
src/Explorer/Panes/DeleteCollectionConfirmationPane.test.ts
src/Explorer/Panes/DeleteCollectionConfirmationPane.ts
src/Explorer/Panes/DeleteDatabaseConfirmationPane.test.ts
src/Explorer/Panes/DeleteDatabaseConfirmationPane.ts
src/Explorer/Panes/ExecuteSprocParamsPane.ts
src/Explorer/Panes/GraphStylingPane.ts
src/Explorer/Panes/LoadQueryPane.ts
src/Explorer/Panes/NewVertexPane.ts
src/Explorer/Panes/PaneComponents.ts
src/Explorer/Panes/RenewAdHocAccessPane.ts
src/Explorer/Panes/SaveQueryPane.ts
src/Explorer/Panes/SettingsPane.test.ts
src/Explorer/Panes/SettingsPane.ts
src/Explorer/Panes/SetupNotebooksPane.ts
src/Explorer/Panes/StringInputPane.ts
src/Explorer/Panes/SwitchDirectoryPane.ts
src/Explorer/Panes/Tables/AddTableEntityPane.ts
src/Explorer/Panes/Tables/EditTableEntityPane.ts
src/Explorer/Panes/Tables/EntityPropertyViewModel.ts
src/Explorer/Panes/Tables/QuerySelectPane.ts
src/Explorer/Panes/Tables/TableColumnOptionsPane.ts
src/Explorer/Panes/Tables/TableEntityPane.ts
src/Explorer/Panes/Tables/Validators/EntityPropertyNameValidator.ts
src/Explorer/Panes/Tables/Validators/EntityPropertyValidationCommon.ts
src/Explorer/Panes/Tables/Validators/EntityPropertyValueValidator.ts
src/Explorer/Panes/UploadFilePane.ts
src/Explorer/Panes/UploadItemsPane.ts
src/Explorer/SplashScreen/SplashScreenComponentAdapter.test.ts
src/Explorer/Tables/Constants.ts
src/Explorer/SplashScreen/SplashScreen.test.ts
src/Explorer/Tables/DataTable/CacheBase.ts
src/Explorer/Tables/DataTable/DataTableBindingManager.ts
src/Explorer/Tables/DataTable/DataTableBuilder.ts
src/Explorer/Tables/DataTable/DataTableContextMenu.ts
src/Explorer/Tables/DataTable/DataTableOperationManager.ts
src/Explorer/Tables/DataTable/DataTableOperations.ts
src/Explorer/Tables/DataTable/DataTableUtilities.ts
src/Explorer/Tables/DataTable/DataTableViewModel.ts
src/Explorer/Tables/DataTable/TableCommands.ts
src/Explorer/Tables/DataTable/TableEntityCache.ts
src/Explorer/Tables/DataTable/TableEntityListViewModel.ts
src/Explorer/Tables/Entities.ts
src/Explorer/Tables/QueryBuilder/ClauseGroup.ts
src/Explorer/Tables/QueryBuilder/ClauseGroupViewModel.ts
src/Explorer/Tables/QueryBuilder/CustomTimestampHelper.ts
src/Explorer/Tables/QueryBuilder/DateTimeUtilities.test.ts
src/Explorer/Tables/QueryBuilder/DateTimeUtilities.ts
src/Explorer/Tables/QueryBuilder/QueryBuilderViewModel.ts
src/Explorer/Tables/QueryBuilder/QueryClauseViewModel.ts
src/Explorer/Tables/QueryBuilder/QueryViewModel.ts
src/Explorer/Tables/TableDataClient.ts
src/Explorer/Tables/TableEntityProcessor.ts
src/Explorer/Tables/Utilities.ts
src/Explorer/Tabs/ConflictsTab.ts
src/Explorer/Tabs/DatabaseSettingsTab.ts
src/Explorer/Tabs/DocumentsTab.test.ts
src/Explorer/Tabs/DocumentsTab.ts
src/Explorer/Tabs/GraphTab.ts
src/Explorer/Tabs/MongoDocumentsTab.ts
src/Explorer/Tabs/MongoQueryTab.ts
src/Explorer/Tabs/MongoShellTab.ts
src/Explorer/Tabs/NotebookV2Tab.ts
src/Explorer/Tabs/QueryTab.test.ts
src/Explorer/Tabs/QueryTab.ts
src/Explorer/Tabs/QueryTablesTab.ts
src/Explorer/Tabs/ScriptTabBase.ts
src/Explorer/Tabs/SparkMasterTab.ts
src/Explorer/Tabs/StoredProcedureTab.ts
src/Explorer/Tabs/TabComponents.ts
src/Explorer/Tabs/TabsBase.ts
src/Explorer/Tabs/TriggerTab.ts
src/Explorer/Tabs/UserDefinedFunctionTab.ts
src/Explorer/Tree/AccessibleVerticalList.ts
src/Explorer/Tree/Collection.test.ts
src/Explorer/Tree/Collection.ts
src/Explorer/Tree/ConflictId.ts
src/Explorer/Tree/Database.ts
src/Explorer/Tree/DocumentId.ts
src/Explorer/Tree/ObjectId.ts
src/Explorer/Tree/ResourceTokenCollection.ts
src/Explorer/Tree/StoredProcedure.ts
src/Explorer/Tree/TreeComponents.ts
src/Explorer/Tree/Trigger.ts
src/Explorer/Tree/UserDefinedFunction.ts
src/Explorer/WaitsForTemplateViewModel.ts
src/GitHub/GitHubClient.test.ts
src/GitHub/GitHubClient.ts
src/GitHub/GitHubConnector.ts
src/GitHub/GitHubContentProvider.test.ts
src/GitHub/GitHubContentProvider.ts
src/GitHub/GitHubOAuthService.ts
src/HostedExplorer.ts
src/Index.ts
src/Juno/JunoClient.test.ts
src/Juno/JunoClient.ts
src/Main.ts
src/NotebookWorkspaceManager/NotebookWorkspaceManager.ts
src/NotebookWorkspaceManager/NotebookWorkspaceResourceProviderMockClients.ts
src/Platform/Emulator/DataAccessUtility.ts
src/Platform/Emulator/ExplorerFactory.ts
src/Platform/Emulator/Main.ts
src/Platform/Emulator/NotificationsClient.ts
src/Platform/Hosted/ArmResourceUtils.ts
src/Platform/Hosted/Authorization.ts
src/Platform/Hosted/DataAccessUtility.ts
src/Platform/Hosted/ExplorerFactory.ts
src/Platform/Hosted/Helpers/ConnectionStringParser.test.ts
src/Platform/Hosted/Helpers/ConnectionStringParser.ts
src/Platform/Hosted/HostedUtils.test.ts
src/Platform/Hosted/HostedUtils.ts
src/Platform/Hosted/Main.ts
src/Platform/Hosted/Maint.test.ts
src/Platform/Hosted/NotificationsClient.ts
src/Platform/Portal/DataAccessUtility.ts
src/Platform/Portal/ExplorerFactory.ts
src/Platform/Portal/Main.ts
src/Platform/Portal/NotificationsClient.ts
src/PlatformType.ts
src/ReactDevTools.ts
src/ResourceProvider/IResourceProviderClient.test.ts
src/ResourceProvider/IResourceProviderClient.ts
src/ResourceProvider/ResourceProviderClient.ts
src/ResourceProvider/ResourceProviderClientFactory.ts
src/RouteHandlers/RouteHandler.ts
src/RouteHandlers/TabRouteHandler.test.ts
src/RouteHandlers/TabRouteHandler.ts
src/Shared/Constants.ts
src/Shared/DefaultExperienceUtility.test.ts
src/Shared/DefaultExperienceUtility.ts
src/Shared/ExplorerSettings.ts
src/Shared/PriceEstimateCalculator.ts
src/Shared/StorageUtility.test.ts
src/Shared/StorageUtility.ts
src/Shared/StringUtility.test.ts
src/Shared/StringUtility.ts
src/Shared/appInsights.ts
src/SparkClusterManager/ArcadiaResourceManager.ts
src/SparkClusterManager/SparkClusterManager.ts
src/Terminal/JupyterLabAppFactory.ts
src/Terminal/NotebookAppContracts.d.ts
src/Terminal/index.ts
src/TokenProviders/PortalTokenProvider.ts
src/TokenProviders/TokenProviderFactory.ts
src/Utils/AuthorizationUtils.test.ts
src/Utils/AuthorizationUtils.ts
src/Utils/AutoPilotUtils.test.ts
src/Utils/AutoPilotUtils.ts
src/Utils/DatabaseAccountUtils.test.ts
src/Utils/DatabaseAccountUtils.ts
src/Utils/JunoUtils.ts
src/Utils/MessageValidation.ts
src/Utils/NotebookConfigurationUtils.ts
src/Utils/PricingUtils.test.ts
src/Utils/QueryUtils.test.ts
src/Utils/QueryUtils.ts
src/Utils/StringUtils.test.ts
src/Utils/StringUtils.ts
src/applyExplorerBindings.ts
src/global.d.ts
src/quickstart.ts
src/setupTests.ts
src/workers/upload/definitions.ts
src/workers/upload/index.ts
src/Explorer/Controls/AccessibleElement/AccessibleElement.tsx
src/Explorer/Controls/Accordion/AccordionComponent.tsx
src/Explorer/Controls/AccountSwitch/AccountSwitchComponent.test.tsx
src/Explorer/Controls/AccountSwitch/AccountSwitchComponent.tsx
src/Explorer/Controls/AccountSwitch/AccountSwitchComponentAdapter.tsx
src/Explorer/Controls/Arcadia/ArcadiaMenuPicker.tsx
src/Explorer/Controls/CollapsiblePanel/CollapsiblePanel.tsx
src/Explorer/Controls/CommandButton/CommandButtonComponent.tsx
src/Explorer/Controls/DialogReactComponent/DialogComponent.tsx
src/Explorer/Controls/DialogReactComponent/DialogComponentAdapter.tsx
src/Explorer/Controls/Directory/DefaultDirectoryDropdownComponent.test.tsx
src/Explorer/Controls/Directory/DefaultDirectoryDropdownComponent.tsx
src/Explorer/Controls/Directory/DirectoryComponentAdapter.tsx
src/Explorer/Controls/Directory/DirectoryListComponent.test.tsx
src/Explorer/Controls/Directory/DirectoryListComponent.tsx
src/Explorer/Controls/Editor/EditorReact.tsx
src/Explorer/Controls/InputTypeahead/InputTypeaheadComponent.tsx
src/Explorer/Controls/Notebook/NotebookTerminalComponent.test.tsx
src/Explorer/Controls/Notebook/NotebookTerminalComponent.tsx
src/Explorer/Controls/NotebookViewer/NotebookMetadataComponent.tsx
src/NotebookViewer/NotebookViewer.tsx
src/Explorer/Controls/NotebookViewer/NotebookViewerComponent.tsx
src/Explorer/Controls/QueriesGridReactComponent/QueriesGridComponent.tsx
src/Explorer/Controls/QueriesGridReactComponent/QueriesGridComponentAdapter.tsx
src/Explorer/Controls/ResizeSensorReactComponent/ResizeSensorComponent.tsx
src/Explorer/Controls/Spark/ClusterSettingsComponent.tsx
src/Explorer/Controls/Spark/ClusterSettingsComponentAdapter.tsx
src/Explorer/Controls/Tabs/TabComponent.tsx
src/Explorer/Controls/TreeComponent/TreeComponent.test.tsx
src/Explorer/Controls/TreeComponent/TreeComponent.tsx
src/Explorer/Graph/GraphExplorerComponent/EditorNeighborsComponent.tsx
src/Explorer/Graph/GraphExplorerComponent/EditorNodePropertiesComponent.test.tsx
src/Explorer/Graph/GraphExplorerComponent/EditorNodePropertiesComponent.tsx
src/Explorer/Controls/TreeComponent/LegacyTreeComponent.tsx
src/Explorer/Graph/GraphExplorerComponent/GraphExplorer.test.tsx
src/Explorer/Graph/GraphExplorerComponent/GraphExplorer.tsx
src/Explorer/Graph/GraphExplorerComponent/GraphExplorerAdapter.tsx
src/Explorer/Graph/GraphExplorerComponent/GraphVizComponent.tsx
src/Explorer/Graph/GraphExplorerComponent/LeftPaneComponent.tsx
src/Explorer/Graph/GraphExplorerComponent/MiddlePaneComponent.tsx
src/Explorer/Graph/GraphExplorerComponent/NodePropertiesComponent.test.tsx
src/Explorer/Graph/GraphExplorerComponent/NodePropertiesComponent.tsx
src/Explorer/Graph/GraphExplorerComponent/QueryContainerComponent.tsx
src/Explorer/Graph/GraphExplorerComponent/ReadOnlyNeighborsComponent.tsx
src/Explorer/Graph/GraphExplorerComponent/ReadOnlyNodePropertiesComponent.test.tsx
src/Explorer/Graph/GraphExplorerComponent/ReadOnlyNodePropertiesComponent.tsx
src/Explorer/Menus/CommandBar/CommandBarComponentAdapter.tsx
src/Explorer/Menus/CommandBar/CommandBarUtil.test.tsx
src/Explorer/Menus/CommandBar/CommandBarUtil.tsx
src/Explorer/Menus/CommandBar/MemoryTrackerComponent.tsx
src/Explorer/Menus/NavBar/ControlBarComponent.tsx
src/Explorer/Menus/NavBar/ControlBarComponentAdapter.tsx
src/Explorer/Menus/NavBar/MeControlComponent.test.tsx
src/Explorer/Menus/NavBar/MeControlComponent.tsx
src/Explorer/Menus/NavBar/MeControlComponentAdapter.tsx
src/Explorer/Menus/NotificationConsole/NotificationConsoleComponent.test.tsx
src/Explorer/Menus/NotificationConsole/NotificationConsoleComponent.tsx
src/Explorer/Menus/NotificationConsole/NotificationConsoleComponentAdapter.tsx
src/Explorer/Notebook/NotebookComponent/NotebookComponent.tsx
src/Explorer/Notebook/NotebookComponent/NotebookComponentAdapter.tsx
src/Explorer/Notebook/NotebookComponent/NotebookComponentBootstrapper.tsx
src/Explorer/Notebook/NotebookComponent/VirtualCommandBarComponent.tsx
src/Explorer/Notebook/NotebookComponent/contents/file/index.tsx
src/Explorer/Notebook/NotebookComponent/contents/file/text-file.tsx
src/Explorer/Notebook/NotebookComponent/contents/index.tsx
src/Explorer/Notebook/NotebookRenderer/AzureTheme.tsx
src/Explorer/Notebook/NotebookRenderer/NotebookReadOnlyRenderer.tsx
src/Explorer/Notebook/NotebookRenderer/NotebookRenderer.tsx
src/Explorer/Notebook/NotebookRenderer/Prompt.tsx
src/Explorer/Notebook/NotebookRenderer/PromptContent.tsx
src/Explorer/Notebook/NotebookRenderer/StatusBar.test.tsx
src/Explorer/Notebook/NotebookRenderer/StatusBar.tsx
src/Explorer/Notebook/NotebookRenderer/Toolbar.tsx
src/Explorer/Notebook/NotebookRenderer/decorators/CellCreator.tsx
src/Explorer/Notebook/NotebookRenderer/decorators/CellLabeler.tsx
src/Explorer/Notebook/NotebookRenderer/decorators/HoverableCell.tsx
src/Explorer/Notebook/NotebookRenderer/decorators/draggable/index.tsx
src/Explorer/Notebook/NotebookRenderer/decorators/hijack-scroll/index.tsx
src/Explorer/Notebook/NotebookRenderer/decorators/kbd-shortcuts/index.tsx
src/Explorer/Notebook/temp/inputs/connected-editors/codemirror.tsx
src/Explorer/Notebook/temp/inputs/editor.tsx
src/Explorer/Notebook/temp/markdown-cell.tsx
src/Explorer/Notebook/temp/source.tsx
src/Explorer/Notebook/temp/syntax-highlighter/index.tsx
src/Explorer/SplashScreen/SplashScreenComponent.tsx
src/Explorer/SplashScreen/SplashScreenComponentApdapter.tsx
src/Explorer/Tabs/GalleryTab.tsx
src/Explorer/Tabs/NotebookViewerTab.tsx
src/Explorer/Tabs/TerminalTab.tsx
src/Explorer/Tree/ResourceTreeAdapter.tsx
src/Explorer/Tree/ResourceTreeAdapterForResourceToken.tsx
src/GalleryViewer/Cards/GalleryCardComponent.tsx
src/GalleryViewer/GalleryViewer.tsx
src/GalleryViewer/GalleryViewerComponent.tsx
__mocks__/monaco-editor.ts
src/Explorer/Tree/ResourceTreeAdapterForResourceToken.test.tsx
src/Explorer/Tree/ResourceTree.tsx
src/Utils/EndpointUtils.ts
src/Utils/PriorityBasedExecutionUtils.ts

View File

@@ -1,54 +1,61 @@
module.exports = {
env: {
browser: true,
es6: true
es6: true,
},
plugins: ["@typescript-eslint", "no-null", "prefer-arrow"],
plugins: ["@typescript-eslint", "no-null", "prefer-arrow", "react-hooks"],
extends: ["eslint:recommended", "plugin:@typescript-eslint/recommended"],
globals: {
Atomics: "readonly",
SharedArrayBuffer: "readonly"
SharedArrayBuffer: "readonly",
},
parser: "@typescript-eslint/parser",
parserOptions: {
project: ["./tsconfig.json", "./tsconfig.test.json"],
ecmaFeatures: {
jsx: true
jsx: true,
},
ecmaVersion: 2018,
sourceType: "module"
sourceType: "module",
},
overrides: [
{
files: ["**/*.tsx"],
env: {
jest: true
},
extends: ["plugin:react/recommended"],
plugins: ["react"]
plugins: ["react"],
},
{
files: ["**/*.{test,spec}.{ts,tsx}"],
env: {
jest: true
jest: true,
},
extends: ["plugin:jest/recommended"],
plugins: ["jest"]
}
plugins: ["jest"],
},
],
rules: {
"no-console": ["error", { allow: ["error", "warn", "dir"] }],
curly: "error",
"@typescript-eslint/switch-exhaustiveness-check": "error",
"@typescript-eslint/no-unused-vars": "error",
"@typescript-eslint/no-extraneous-class": "error",
"no-null/no-null": "error",
"@typescript-eslint/no-explicit-any": "error",
"prefer-arrow/prefer-arrow-functions": ["error", { allowStandaloneDeclarations: true }],
eqeqeq: "error",
"react/display-name": "off",
"react-hooks/rules-of-hooks": "warn", // TODO: error
"react-hooks/exhaustive-deps": "warn", // TODO: error
"no-restricted-syntax": [
"error",
{
selector: "CallExpression[callee.object.name='JSON'][callee.property.name='stringify'] Identifier[name=/$err/]",
message: "Do not use JSON.stringify(error). It will print '{}'"
}
]
}
message: "Do not use JSON.stringify(error). It will print '{}'",
},
],
},
settings: {
react: {
version: "detect",
},
},
};

1
.github/PULL_REQUEST_TEMPLATE.md vendored Normal file
View File

@@ -0,0 +1 @@
[Preview this branch](https://dataexplorer-preview.azurewebsites.net/pull/EDIT_THIS_NUMBER_IN_THE_PR_DESCRIPTION?feature.someFeatureFlagYouMightNeed=true)

9
.github/dependabot.yml vendored Normal file
View File

@@ -0,0 +1,9 @@
# Please see the documentation for all configuration options:
# https://help.github.com/github/administering-a-repository/configuration-options-for-dependency-updates
version: 2
updates:
- package-ecosystem: "npm"
directory: "/"
schedule:
interval: "daily"

View File

@@ -8,16 +8,33 @@ on:
pull_request:
branches:
- master
permissions:
id-token: write
contents: read
jobs:
codemetrics:
runs-on: ubuntu-latest
name: "Log Code Metrics"
if: github.ref == 'refs/heads/master'
steps:
- uses: actions/checkout@v4
- name: Use Node.js 18.x
uses: actions/setup-node@v4
with:
node-version: 18.x
- run: npm ci
- run: node utils/codeMetrics.js
env:
CODE_METRICS_APP_ID: ${{ secrets.CODE_METRICS_APP_ID }}
compile:
runs-on: ubuntu-latest
name: "Compile TypeScript"
steps:
- uses: actions/checkout@v2
- name: Use Node.js 12.x
uses: actions/setup-node@v1
- uses: actions/checkout@v4
- name: Use Node.js 18.x
uses: actions/setup-node@v4
with:
node-version: 12.x
node-version: 18.x
- run: npm ci
- run: npm run compile
- run: npm run compile:strict
@@ -25,216 +42,182 @@ jobs:
runs-on: ubuntu-latest
name: "Check Format"
steps:
- uses: actions/checkout@v2
- name: Use Node.js 12.x
uses: actions/setup-node@v1
- uses: actions/checkout@v4
- name: Use Node.js 18.x
uses: actions/setup-node@v4
with:
node-version: 12.x
node-version: 18.x
- run: npm ci
- run: npm run format:check
lint:
runs-on: ubuntu-latest
name: "Lint"
steps:
- uses: actions/checkout@v2
- name: Use Node.js 12.x
uses: actions/setup-node@v1
- uses: actions/checkout@v4
- name: Use Node.js 18.x
uses: actions/setup-node@v4
with:
node-version: 12.x
node-version: 18.x
- run: npm ci
- run: npm run lint
unittest:
runs-on: ubuntu-latest
name: "Unit Tests"
steps:
- uses: actions/checkout@v2
- name: Use Node.js 12.x
uses: actions/setup-node@v1
- uses: actions/checkout@v4
- name: Use Node.js 18.x
uses: actions/setup-node@v4
with:
node-version: 12.x
node-version: 18.x
- run: npm ci
- run: npm run test
build:
runs-on: ubuntu-latest
needs: [lint, format, compile, unittest]
name: "Build"
steps:
- uses: actions/checkout@v2
- name: Use Node.js 12.x
uses: actions/setup-node@v1
- uses: actions/checkout@v4
- name: Use Node.js 18.x
uses: actions/setup-node@v4
with:
node-version: 12.x
node-version: 18.x
- run: npm ci
- run: npm run build:contracts
- name: Restore Build Cache
uses: actions/cache@v2
uses: actions/cache@v4
with:
path: .cache
key: ${{ runner.os }}-build-cache
- run: npm run pack:prod
env:
NODE_OPTIONS: "--max-old-space-size=4096"
- run: cp -r ./Contracts ./dist/contracts
- run: cp -r ./configs ./dist/configs
- uses: actions/upload-artifact@v2
- uses: actions/upload-artifact@v4
with:
name: dist
path: dist/
endtoendemulator:
name: "End To End Emulator Tests"
needs: [lint, format, compile, unittest]
runs-on: windows-latest
steps:
- uses: actions/checkout@v2
- name: Use Node.js 12.x
uses: actions/setup-node@v1
- name: "Az CLI login"
uses: azure/login@v1
with:
node-version: 12.x
- uses: southpolesteve/cosmos-emulator-github-action@v1
- name: End to End Tests
run: |
npm ci
npm start &
npm run wait-for-server
npx jest -c ./jest.config.e2e.js --detectOpenHandles sql
shell: bash
env:
DATA_EXPLORER_ENDPOINT: "https://localhost:1234/explorer.html?platform=Emulator"
PLATFORM: "Emulator"
NODE_TLS_REJECT_UNAUTHORIZED: 0
- uses: actions/upload-artifact@v2
if: failure()
with:
name: screenshots
path: failed-*
accessibility:
name: "Accessibility | Hosted"
needs: [lint, format, compile, unittest]
runs-on: ubuntu-latest
steps:
- uses: actions/checkout@v2
- name: Use Node.js 12.x
uses: actions/setup-node@v1
with:
node-version: 12.x
- name: Accessibility Check
run: |
# Ubuntu gets mad when webpack runs too many files watchers
cat /proc/sys/fs/inotify/max_user_watches
sudo sysctl fs.inotify.max_user_watches=524288
sudo sysctl -p
npm ci
npm start &
npx wait-on -i 5000 https-get://0.0.0.0:1234/
node utils/accesibilityCheck.js
shell: bash
env:
NODE_TLS_REJECT_UNAUTHORIZED: 0
endtoendhosted:
name: "End to End Hosted Tests"
needs: [lint, format, compile, unittest]
runs-on: ubuntu-latest
steps:
- uses: actions/checkout@v2
- name: Use Node.js 12.x
uses: actions/setup-node@v1
with:
node-version: 12.x
- name: End to End Hosted Tests
run: |
npm ci
npm start &
npm run wait-for-server
npm run test:e2e
shell: bash
env:
NODE_TLS_REJECT_UNAUTHORIZED: 0
PORTAL_RUNNER_SUBSCRIPTION: ${{ secrets.PORTAL_RUNNER_SUBSCRIPTION }}
PORTAL_RUNNER_RESOURCE_GROUP: ${{ secrets.PORTAL_RUNNER_RESOURCE_GROUP }}
PORTAL_RUNNER_DATABASE_ACCOUNT: ${{ secrets.PORTAL_RUNNER_DATABASE_ACCOUNT }}
PORTAL_RUNNER_DATABASE_ACCOUNT_KEY: ${{ secrets.PORTAL_RUNNER_DATABASE_ACCOUNT_KEY }}
NOTEBOOKS_TEST_RUNNER_TENANT_ID: ${{ secrets.NOTEBOOKS_TEST_RUNNER_TENANT_ID }}
NOTEBOOKS_TEST_RUNNER_CLIENT_ID: ${{ secrets.NOTEBOOKS_TEST_RUNNER_CLIENT_ID }}
NOTEBOOKS_TEST_RUNNER_CLIENT_SECRET: ${{ secrets.NOTEBOOKS_TEST_RUNNER_CLIENT_SECRET }}
PORTAL_RUNNER_CONNECTION_STRING: ${{ secrets.CONNECTION_STRING_SQL }}
MONGO_CONNECTION_STRING: ${{ secrets.CONNECTION_STRING_MONGO }}
CASSANDRA_CONNECTION_STRING: ${{ secrets.CONNECTION_STRING_CASSANDRA }}
TABLES_CONNECTION_STRING: ${{ secrets.CONNECTION_STRING_TABLE }}
DATA_EXPLORER_ENDPOINT: "https://localhost:1234/hostedExplorer.html"
- uses: actions/upload-artifact@v2
if: failure()
with:
name: screenshots
path: failed-*
client-id: ${{ secrets.AZURE_CLIENT_ID }}
tenant-id: ${{ secrets.AZURE_TENANT_ID }}
subscription-id: ${{ secrets.PREVIEW_SUBSCRIPTION_ID }}
- name: Upload build to preview blob storage
run: az storage blob upload-batch -d '$web' -s 'dist' --account-name ${{ secrets.PREVIEW_STORAGE_ACCOUNT_NAME }} --destination-path "${{github.event.pull_request.head.sha || github.sha}}" --auth-mode login --overwrite true
- name: Upload preview config to blob storage
run: az storage blob upload -c '$web' -f ./preview/config.json --account-name ${{ secrets.PREVIEW_STORAGE_ACCOUNT_NAME }} --name "${{github.event.pull_request.head.sha || github.sha}}/config.json" --auth-mode login --overwrite true
nuget:
name: Publish Nuget
if: github.ref == 'refs/heads/master' || contains(github.ref, 'hotfix/') || contains(github.ref, 'release/')
needs: [lint, format, compile, build, unittest, endtoendemulator, endtoendhosted, accessibility]
needs: [build]
runs-on: ubuntu-latest
env:
NUGET_SOURCE: ${{ secrets.NUGET_SOURCE }}
AZURE_DEVOPS_PAT: ${{ secrets.AZURE_DEVOPS_PAT }}
steps:
- uses: nuget/setup-nuget@v1
with:
nuget-api-key: ${{ secrets.NUGET_API_KEY }}
- name: Download Dist Folder
uses: actions/download-artifact@v2
uses: actions/download-artifact@v4
with:
name: dist
- run: cp ./configs/prod.json config.json
- run: nuget sources add -Name "ADO" -Source "$NUGET_SOURCE" -UserName "GitHub" -Password "$AZURE_DEVOPS_PAT"
- run: nuget pack -Version "2.0.0-github-${GITHUB_SHA}"
- run: nuget push -Source "$NUGET_SOURCE" -ApiKey Az *.nupkg
- uses: actions/upload-artifact@v2
name: packages
- run: dotnet nuget add source "$NUGET_SOURCE" --name "ADO" --username "jawelton@microsoft.com" --password "$AZURE_DEVOPS_PAT" --store-password-in-clear-text
- run: dotnet pack DataExplorer.proj /p:PackageVersion="2.0.0-github-${GITHUB_SHA}"
- run: dotnet nuget push "bin/Release/*.nupkg" --skip-duplicate --api-key Az --source="$NUGET_SOURCE"
- run: dotnet nuget remove source "ADO"
- uses: actions/upload-artifact@v4
name: Upload package to Artifacts
with:
path: "*.nupkg"
name: prod-package
path: "bin/Release/*.nupkg"
nugetmpac:
name: Publish Nuget MPAC
if: github.ref == 'refs/heads/master' || contains(github.ref, 'hotfix/') || contains(github.ref, 'release/')
needs: [lint, format, compile, build, unittest, endtoendemulator, endtoendhosted, accessibility]
needs: [build]
runs-on: ubuntu-latest
env:
NUGET_SOURCE: ${{ secrets.NUGET_SOURCE }}
AZURE_DEVOPS_PAT: ${{ secrets.AZURE_DEVOPS_PAT }}
steps:
- uses: nuget/setup-nuget@v1
with:
nuget-api-key: ${{ secrets.NUGET_API_KEY }}
- name: Download Dist Folder
uses: actions/download-artifact@v2
uses: actions/download-artifact@v4
with:
name: dist
- run: cp ./configs/mpac.json config.json
- run: sed -i 's/Azure.Cosmos.DB.Data.Explorer/Azure.Cosmos.DB.Data.Explorer.MPAC/g' DataExplorer.nuspec
- run: nuget sources add -Name "ADO" -Source "$NUGET_SOURCE" -UserName "GitHub" -Password "$AZURE_DEVOPS_PAT"
- run: nuget pack -Version "2.0.0-github-${GITHUB_SHA}"
- run: nuget push -Source "$NUGET_SOURCE" -ApiKey Az *.nupkg
- uses: actions/upload-artifact@v2
name: packages
- run: dotnet nuget add source "$NUGET_SOURCE" --name "ADO" --username "jawelton@microsoft.com" --password "$AZURE_DEVOPS_PAT" --store-password-in-clear-text
- run: dotnet pack DataExplorer.proj /p:PackageVersion="2.0.0-github-${GITHUB_SHA}"
- run: dotnet nuget push "bin/Release/*.nupkg" --skip-duplicate --api-key Az --source="$NUGET_SOURCE"
- run: dotnet nuget remove source "ADO"
- uses: actions/upload-artifact@v4
name: Upload package to Artifacts
with:
path: "*.nupkg"
nugetie:
name: Publish Nuget IE
if: github.ref == 'refs/heads/master' || contains(github.ref, 'hotfix/') || contains(github.ref, 'release/')
needs: [lint, format, compile, build, unittest, endtoendemulator, endtoendhosted, accessibility]
name: mpac-package
path: "bin/Release/*.nupkg"
playwright-tests:
name: "Run Playwright Tests (Shard ${{ matrix.shardIndex }} of ${{ matrix.shardTotal }})"
runs-on: ubuntu-latest
env:
NUGET_SOURCE: ${{ secrets.NUGET_SOURCE }}
AZURE_DEVOPS_PAT: ${{ secrets.AZURE_DEVOPS_PAT }}
NODE_TLS_REJECT_UNAUTHORIZED: 0
AZURE_SUBSCRIPTION_ID: ${{ secrets.AZURE_SUBSCRIPTION_ID }}
strategy:
fail-fast: false
matrix:
shardIndex: [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16]
shardTotal: [16]
steps:
- uses: nuget/setup-nuget@v1
- uses: actions/checkout@v4
- name: Use Node.js 18.x
uses: actions/setup-node@v4
with:
nuget-api-key: ${{ secrets.NUGET_API_KEY }}
- name: Download Dist Folder
uses: actions/download-artifact@v2
node-version: 18.x
- run: npm ci
- run: npx playwright install --with-deps
- name: "Az CLI login"
uses: Azure/login@v2
with:
name: dist
- run: cp ./configs/prod.json config.json
- run: sed -i 's/Azure.Cosmos.DB.Data.Explorer/Azure.Cosmos.DB.Data.Explorer.IE/g' DataExplorer.nuspec
- run: nuget sources add -Name "ADO" -Source "$NUGET_SOURCE" -UserName "GitHub" -Password "$AZURE_DEVOPS_PAT"
- run: nuget pack -Version "2.0.0-github-${GITHUB_SHA}"
- run: nuget push -Source "$NUGET_SOURCE" -ApiKey Az *.nupkg
- uses: actions/upload-artifact@v2
name: packages
client-id: ${{ secrets.AZURE_CLIENT_ID }}
tenant-id: ${{ secrets.AZURE_TENANT_ID }}
subscription-id: ${{ secrets.AZURE_SUBSCRIPTION_ID }}
- name: Run test shard ${{ matrix['shardIndex'] }} of ${{ matrix['shardTotal']}}
run: npx playwright test --shard=${{ matrix.shardIndex }}/${{ matrix.shardTotal }} --workers=3
- name: Upload blob report to GitHub Actions Artifacts
if: ${{ !cancelled() }}
uses: actions/upload-artifact@v4
with:
path: "*.nupkg"
name: blob-report-${{ matrix.shardIndex }}
path: blob-report
retention-days: 1
merge-playwright-reports:
name: "Merge Playwright Reports"
# Merge reports after playwright-tests, even if some shards have failed
if: ${{ !cancelled() }}
needs: [playwright-tests]
runs-on: ubuntu-latest
steps:
- uses: actions/checkout@v4
- uses: actions/setup-node@v4
with:
node-version: 18
- name: Install dependencies
run: npm ci
- name: Download blob reports from GitHub Actions Artifacts
uses: actions/download-artifact@v4
with:
path: all-blob-reports
pattern: blob-report-*
merge-multiple: true
- name: Merge into HTML Report
run: npx playwright merge-reports --reporter html ./all-blob-reports
- name: Upload HTML report
uses: actions/upload-artifact@v4
with:
name: html-report--attempt-${{ github.run_attempt }}
path: playwright-report
retention-days: 14

39
.github/workflows/cleanup.yml vendored Normal file
View File

@@ -0,0 +1,39 @@
# This is a basic workflow to help you get started with Actions
name: Cleanup End to End Account Resources
on:
# Allows you to run this workflow manually from the Actions tab
workflow_dispatch:
schedule:
# Once every hour
- cron: "0 15 * * *"
permissions:
id-token: write
contents: read
# A workflow run is made up of one or more jobs that can run sequentially or in parallel
jobs:
# This workflow contains a single job called "build"
cleanupaccounts:
name: "Cleanup Test Database Accounts"
runs-on: ubuntu-latest
env:
AZURE_SUBSCRIPTION_ID: ${{ secrets.AZURE_SUBSCRIPTION_ID }}
steps:
- uses: actions/checkout@v2
- name: "Az CLI login"
uses: azure/login@v1
with:
client-id: ${{ secrets.AZURE_CLIENT_ID }}
tenant-id: ${{ secrets.AZURE_TENANT_ID }}
subscription-id: ${{ secrets.AZURE_SUBSCRIPTION_ID }}
- name: Use Node.js 18.x
uses: actions/setup-node@v1
with:
node-version: 18.x
- run: npm ci
- run: node utils/cleanupDBs.js

8
.gitignore vendored
View File

@@ -14,4 +14,10 @@ Contracts/*
.DS_Store
.cache/
.env
failure.png
failure.png
screenshots/*
GettingStarted-ignore*.ipynb
/test-results/
/playwright-report/
/blob-report/
/playwright/.cache/

5
.npmrc
View File

@@ -1 +1,4 @@
save-exact=true
save-exact=true
# Ignore peer dependency conflicts
force=true # TODO: Remove this when we update to React 17 or higher!

6
.vscode/launch.json vendored
View File

@@ -12,7 +12,8 @@
"--inspect-brk",
"${workspaceRoot}/node_modules/jest/bin/jest.js",
"--runInBand",
"--coverage", "false"
"--coverage",
"false"
],
"console": "integratedTerminal",
"internalConsoleOptions": "neverOpen",
@@ -26,7 +27,8 @@
"--inspect-brk",
"${workspaceRoot}/node_modules/jest/bin/jest.js",
"${fileBasenameNoExtension}",
"--coverage", "false",
"--coverage",
"false",
// "--watch",
// // --no-cache only used to make --watch work. Otherwise jest ignores the breakpoints.
// // https://github.com/facebook/jest/issues/6683

45
.vscode/settings.json vendored
View File

@@ -1,21 +1,28 @@
// Place your settings in this file to overwrite default and user settings.
{
"files.exclude": {
".vs": true,
".vscode/**": true,
"*.trx": true,
"**/.DS_Store": true,
"**/.git": true,
"**/.hg": true,
"**/.svn": true,
"built/**": true,
"coverage/**": true,
"libs/**": true,
"node_modules/**": true,
"package-lock.json": true,
"quickstart/**": true,
"test/out/**": true,
"workers/libs/**": true
},
"typescript.tsdk": "node_modules/typescript/lib"
}
"files.exclude": {
".vs": true,
".vscode/**": true,
"*.trx": true,
"**/.DS_Store": true,
"**/.git": true,
"**/.hg": true,
"**/.svn": true,
"built/**": true,
"coverage/**": true,
"libs/**": true,
"node_modules/**": true,
"package-lock.json": true,
"quickstart/**": true,
"test/out/**": true,
"workers/libs/**": true
},
"typescript.tsdk": "node_modules/typescript/lib",
"editor.formatOnSave": true,
"editor.codeActionsOnSave": {
"source.fixAll.eslint": "explicit",
"source.organizeImports": "explicit"
},
"typescript.preferences.importModuleSpecifier": "non-relative",
"editor.defaultFormatter": "esbenp.prettier-vscode"
}

190
CODING_GUIDELINES.md Normal file
View File

@@ -0,0 +1,190 @@
# Coding Guidelines and Recommendations
Cosmos Explorer has been under constant development for over 5 years. As a result, there are many different patterns and practices in the codebase. This document serves as a guide to how we write code and helps avoid propagating practices which are no longer preferred. Each requirement in this document is labeled and color-coded to show the relative importance. In order from highest to lowest importance:
✅ DO this. If you feel you need an exception, engage with the project owners _prior_ to implementation.
⛔️ DO NOT do this. If you feel you need an exception, engage with the project owners _prior_ to implementation.
☑️ YOU SHOULD strongly consider this but it is not a requirement. If not following this advice, please comment code with why and proactively begin a discussion as part of the PR process.
⚠️ YOU SHOULD NOT strongly consider not doing this. If not following this advice, please comment code with why and proactively begin a discussion as part of the PR process.
💭 YOU MAY consider this advice if appropriate to your situation. Other team members may comment on this as part of PR review, but there is no need to be proactive.
## Development Environment
☑️ YOU SHOULD
- Use VSCode and install the following extensions. This setup will catch most linting/formatting/type errors as you develop:
- [Prettier](https://marketplace.visualstudio.com/items?itemName=esbenp.prettier-vscode)
- [ESLint](https://marketplace.visualstudio.com/items?itemName=dbaeumer.vscode-eslint)
💭 YOU MAY
- Use the [GitHub CLI](https://cli.github.com/). It has helpful workflows for submitting PRs as well as for checking out other team member's PRs.
- Use Windows, Linux (including WSL), or OSX. We have team members developing on all three environments.
✅ DO
- Maintain cross-platform compatibility when modifying any engineering or build systems
## Code Formatting
✅ DO
- Use [Prettier](https://prettier.io/) to format your code
- This will occur automatically if using the recommended editor setup
- `npm run format` will also format code
## Linting
✅ DO
- Use [ESLint](https://eslint.org/) to check for code errors.
- This will occur automatically if using the recommended editor setup
- `npm run lint` will also check for linting errors
💭 YOU MAY
- Consider adding new lint rules.
- If you find yourself performing "nits" as part of PR review, consider adding a lint rule that will automatically catch the error in the future
⚠️ YOU SHOULD NOT
- Disable lint rules
- Lint rules exist as guidance and to catch common mistakes
- You will find places we disable specific lint rules however it should be exceptional.
- If a rule does need to be disabled, prefer disabling a specific line instead of the entire file.
⛔️ DO NOT
- Add [TSLint](https://palantir.github.io/tslint/) rules
- TSLint has been deprecated and is on track to be removed
- Always prefer ESLint rules
## UI Components
☑️ YOU SHOULD
- Write new components using [React](https://reactjs.org/). We are actively migrating Cosmos Explorer off of [Knockout](https://knockoutjs.com/).
- Use [Fluent](https://developer.microsoft.com/en-us/fluentui#/) components.
- Fluent components are designed to be highly accessible and composable
- Using Fluent allows us to build upon the work of the Fluent team and leads to a lower total cost of ownership for UI code
### React
☑️ YOU SHOULD
- Use pure functional components when no state is required
💭 YOU MAY
- Use functional (hooks) or class components
- The project contains examples of both
- Neither is strongly preferred at this time
⛔️ DO NOT
- Use inheritance for sharing component behavior.
- React documentation covers this topic in detail https://reactjs.org/docs/composition-vs-inheritance.html
- Suffix your file or component name with "Component"
- Even though the code has examples of it, we are ending the practice.
## Libraries
⚠️ YOU SHOULD NOT
- Add new libraries to package.json.
- Adding libraries may bring in code that explodes the bundled size or attempts to run NodeJS code in the browser
- Consult with project owners for help with library selection if one is needed
⛔️ DO NOT
- Use underscore.js
- Much of this library is now native to JS and will be automatically transpiled
- Use jQuery
- Much of this library is not native to the DOM.
- We are planning to remove it
## Testing
⛔️ DO NOT
- Decrease test coverage
- Unit/Functional test coverage is checked as part of the CI process
### Unit Tests
✅ DO
- Write unit tests for non-UI and utility code.
- Write your tests using [Jest](https://jestjs.io/)
☑️ YOU SHOULD
- Abstract non-UI and utility code so it can run either the NodeJS or Browser environment
### Functional(Component) Tests
✅ DO
- Write tests for UI components
- Write your tests using [Jest](https://jestjs.io/)
- Use either Enzyme or React Testing Library to perform component tests.
### Mocking
✅ DO
- Use Jest's built-in mocking helpers
☑️ YOU SHOULD
- Write code that does not require mocking
- Build components that do not require mocking extremely large or difficult to mock objects (like Explorer.ts). Pass _only_ what you need.
⛔️ DO NOT
- Use sinon.js for mocking
- Sinon has been deprecated and planned for removal
### End to End Tests
✅ DO
- Use [Playwright](https://github.com/microsoft/playwright) and [Jest](https://jestjs.io/)
- Write or modify an existing E2E test that covers the primary use case of any major feature.
- Use caution. Do not try to cover every case. End to End tests can be slow and brittle.
☑️ YOU SHOULD
- Write tests that use accessible attributes to perform actions. Role, Title, Label, etc
- More information https://testing-library.com/docs/queries/about#priority
⚠️ YOU SHOULD NOT
- Add test specfic `data-*` attributes to dom elements
- This is a common current practice, but one we would like to avoid in the future
- End to end tests need to use semantic HTML and accesible attributes to be truely end to end
- No user or screen reader actually navigates an app using `data-*` attributes
- Add arbitrary time delays to wait for page to render or element to be ready.
- All the time delays add up and slow down testing.
- Prefer using the framework's "wait for..." functionality.
### Migrating Knockout to React
✅ DO
- Consult other team members before beginning migration work. There is a significant amount of flux in patterns we are using and it is important we do not propagate incorrect patterns.
- Start by converting HTML to JSX: https://magic.reactjs.net/htmltojsx.htm. Add functionality as a second step.
☑️ YOU SHOULD
- Write React components that require no dependency on Knockout or observables to trigger rendering.
## Browser Support
✅ DO
- Support all [browsers supported by the Azure Portal](https://docs.microsoft.com/en-us/azure/azure-portal/azure-portal-supported-browsers-devices)

View File

@@ -1,6 +1,6 @@
# Contribution guidelines to Data Explorer
This project welcomes contributions and suggestions. Most contributions require you to agree to a
This project welcomes contributions and suggestions. Most contributions require you to agree to a
Contributor License Agreement (CLA) declaring that you have the right to, and actually do, grant us
the rights to use your contribution. For details, visit https://cla.microsoft.com.
@@ -13,6 +13,7 @@ For more information see the [Code of Conduct FAQ](https://opensource.microsoft.
contact [opencode@microsoft.com](mailto:opencode@microsoft.com) with any additional questions or comments.
## Microsoft Open Source Code of Conduct
This project has adopted the [Microsoft Open Source Code of Conduct](https://opensource.microsoft.com/codeofconduct/).
Resources:
@@ -20,33 +21,3 @@ Resources:
- [Microsoft Open Source Code of Conduct](https://opensource.microsoft.com/codeofconduct/)
- [Microsoft Code of Conduct FAQ](https://opensource.microsoft.com/codeofconduct/faq/)
- Contact [opencode@microsoft.com](mailto:opencode@microsoft.com) with questions or concerns
## Browser support
Please make sure to support all modern browsers as well as Internet Explorer 11.
For IE support, polyfill is preferred over new usage of lodash or underscore. We already polyfill almost everything by importing babel-polyfill at the top of entry points.
## Coding guidelines, conventions and recommendations
### Typescript
* Follow this [typescript style guide](https://github.com/excelmicro/typescript) which is based on [airbnb's style guide](https://github.com/airbnb/javascript).
* Conventions speficic to this project:
- Use double-quotes for string
- Don't use `null`, use `undefined`
- Pascal case for private static readonly fields
- Camel case for classnames in markup
* Don't use class unless necessary
* Code related to notebooks should be dynamically imported so that it is loaded from a separate bundle only if the account is notebook-enabled. There are already top-level notebook components which are dynamically imported and their dependencies can be statically imported from these files.
* Prefer using [Fluent UI controls](https://developer.microsoft.com/en-us/fluentui#/controls/web) over creating your own, in order to maintain consistency and support a11y.
### React
* Prefer using React class components over function components and hooks unless you have a simple component and require no nested functions:
* Nested functions may be harder to test independently
* Switching from function component to class component later mayb be painful
## Testing
Any PR should not decrease testing coverage.
## Recommended Tools and VS Code extensions
* [Bookmarks](https://github.com/alefragnani/vscode-bookmarks)
* [Bracket pair colorizer](https://github.com/CoenraadS/Bracket-Pair-Colorizer-2)
* [GitHub Pull Requests and Issues](https://github.com/Microsoft/vscode-pull-request-github)

9
DataExplorer.proj Normal file
View File

@@ -0,0 +1,9 @@
<Project Sdk="Microsoft.NET.Sdk">
<PropertyGroup>
<TargetFramework>net8.0</TargetFramework>
<NoBuild>true</NoBuild>
<IncludeBuildOutput>false</IncludeBuildOutput>
<NuspecFile>DataExplorer.nuspec</NuspecFile>
<NuspecProperties>version=$(PackageVersion)</NuspecProperties>
</PropertyGroup>
</Project>

View File

@@ -18,8 +18,7 @@ Run `npm start` to start the development server and automatically rebuild on cha
### Hosted Development (https://cosmos.azure.com)
- Visit: `https://localhost:1234/hostedExplorer.html`
- Local sign in via AAD will NOT work. Connection string only in dev mode. Use the Portal if you need AAD auth.
- The default webpack dev server configuration will proxy requests to the production portal backend: `https://main.documentdb.ext.azure.com`. This will allow you to use production connection strings on your local machine.
- The default webpack dev server configuration will proxy requests to the production portal backend: `https://cdb-ms-mpac-pbe.cosmos.azure.com`. This will allow you to use production connection strings on your local machine.
### Emulator Development
@@ -69,6 +68,10 @@ Jest and Puppeteer are used for end to end browser based tests and are contained
We generally adhere to the release strategy [documented by the Azure SDK Guidelines](https://azure.github.io/azure-sdk/policies_repobranching.html#release-branches). Most releases should happen from the master branch. If master contains commits that cannot be released, you may create a release from a `release/` or `hotfix/` branch. See linked documentation for more details.
### Architecture
[![](https://mermaid.ink/img/eyJjb2RlIjoiZ3JhcGggTFJcbiAgaG9zdGVkKGh0dHBzOi8vY29zbW9zLmF6dXJlLmNvbSlcbiAgcG9ydGFsKFBvcnRhbClcbiAgZW11bGF0b3IoRW11bGF0b3IpXG4gIGFhZFtBQURdXG4gIHJlc291cmNlVG9rZW5bUmVzb3VyY2UgVG9rZW5dXG4gIGNvbm5lY3Rpb25TdHJpbmdbQ29ubmVjdGlvbiBTdHJpbmddXG4gIHBvcnRhbFRva2VuW0VuY3J5cHRlZCBQb3J0YWwgVG9rZW5dXG4gIG1hc3RlcktleVtNYXN0ZXIgS2V5XVxuICBhcm1bQVJNIFJlc291cmNlIFByb3ZpZGVyXVxuICBkYXRhcGxhbmVbRGF0YSBQbGFuZV1cbiAgcHJveHlbUG9ydGFsIEFQSSBQcm94eV1cbiAgc3FsW1NRTF1cbiAgbW9uZ29bTW9uZ29dXG4gIHRhYmxlc1tUYWJsZXNdXG4gIGNhc3NhbmRyYVtDYXNzYW5kcmFdXG4gIGdyYWZbR3JhcGhdXG5cblxuICBlbXVsYXRvciAtLT4gbWFzdGVyS2V5IC0tLS0-IGRhdGFwbGFuZVxuICBwb3J0YWwgLS0-IGFhZFxuICBob3N0ZWQgLS0-IHBvcnRhbFRva2VuICYgcmVzb3VyY2VUb2tlbiAmIGNvbm5lY3Rpb25TdHJpbmcgJiBhYWRcbiAgYWFkIC0tLT4gYXJtXG4gIGFhZCAtLS0-IGRhdGFwbGFuZVxuICBhYWQgLS0tPiBwcm94eVxuICByZXNvdXJjZVRva2VuIC0tLT4gc3FsIC0tPiBkYXRhcGxhbmVcbiAgcG9ydGFsVG9rZW4gLS0tPiBwcm94eVxuICBwcm94eSAtLT4gZGF0YXBsYW5lXG4gIGNvbm5lY3Rpb25TdHJpbmcgLS0-IHNxbCAmIG1vbmdvICYgY2Fzc2FuZHJhICYgZ3JhZiAmIHRhYmxlc1xuICBzcWwgLS0-IGRhdGFwbGFuZVxuICB0YWJsZXMgLS0-IGRhdGFwbGFuZVxuICBtb25nbyAtLT4gcHJveHlcbiAgY2Fzc2FuZHJhIC0tPiBwcm94eVxuICBncmFmIC0tPiBwcm94eVxuXG5cdFx0IiwibWVybWFpZCI6eyJ0aGVtZSI6ImRlZmF1bHQifSwidXBkYXRlRWRpdG9yIjpmYWxzZX0)](https://mermaid-js.github.io/mermaid-live-editor/#/edit/eyJjb2RlIjoiZ3JhcGggTFJcbiAgaG9zdGVkKGh0dHBzOi8vY29zbW9zLmF6dXJlLmNvbSlcbiAgcG9ydGFsKFBvcnRhbClcbiAgZW11bGF0b3IoRW11bGF0b3IpXG4gIGFhZFtBQURdXG4gIHJlc291cmNlVG9rZW5bUmVzb3VyY2UgVG9rZW5dXG4gIGNvbm5lY3Rpb25TdHJpbmdbQ29ubmVjdGlvbiBTdHJpbmddXG4gIHBvcnRhbFRva2VuW0VuY3J5cHRlZCBQb3J0YWwgVG9rZW5dXG4gIG1hc3RlcktleVtNYXN0ZXIgS2V5XVxuICBhcm1bQVJNIFJlc291cmNlIFByb3ZpZGVyXVxuICBkYXRhcGxhbmVbRGF0YSBQbGFuZV1cbiAgcHJveHlbUG9ydGFsIEFQSSBQcm94eV1cbiAgc3FsW1NRTF1cbiAgbW9uZ29bTW9uZ29dXG4gIHRhYmxlc1tUYWJsZXNdXG4gIGNhc3NhbmRyYVtDYXNzYW5kcmFdXG4gIGdyYWZbR3JhcGhdXG5cblxuICBlbXVsYXRvciAtLT4gbWFzdGVyS2V5IC0tLS0-IGRhdGFwbGFuZVxuICBwb3J0YWwgLS0-IGFhZFxuICBob3N0ZWQgLS0-IHBvcnRhbFRva2VuICYgcmVzb3VyY2VUb2tlbiAmIGNvbm5lY3Rpb25TdHJpbmcgJiBhYWRcbiAgYWFkIC0tLT4gYXJtXG4gIGFhZCAtLS0-IGRhdGFwbGFuZVxuICBhYWQgLS0tPiBwcm94eVxuICByZXNvdXJjZVRva2VuIC0tLT4gc3FsIC0tPiBkYXRhcGxhbmVcbiAgcG9ydGFsVG9rZW4gLS0tPiBwcm94eVxuICBwcm94eSAtLT4gZGF0YXBsYW5lXG4gIGNvbm5lY3Rpb25TdHJpbmcgLS0-IHNxbCAmIG1vbmdvICYgY2Fzc2FuZHJhICYgZ3JhZiAmIHRhYmxlc1xuICBzcWwgLS0-IGRhdGFwbGFuZVxuICB0YWJsZXMgLS0-IGRhdGFwbGFuZVxuICBtb25nbyAtLT4gcHJveHlcbiAgY2Fzc2FuZHJhIC0tPiBwcm94eVxuICBncmFmIC0tPiBwcm94eVxuXG5cdFx0IiwibWVybWFpZCI6eyJ0aGVtZSI6ImRlZmF1bHQifSwidXBkYXRlRWRpdG9yIjpmYWxzZX0)
# Contributing
Please read the [contribution guidelines](./CONTRIBUTING.md).

41
SECURITY.md Normal file
View File

@@ -0,0 +1,41 @@
<!-- BEGIN MICROSOFT SECURITY.MD V0.0.7 BLOCK -->
## Security
Microsoft takes the security of our software products and services seriously, which includes all source code repositories managed through our GitHub organizations, which include [Microsoft](https://github.com/Microsoft), [Azure](https://github.com/Azure), [DotNet](https://github.com/dotnet), [AspNet](https://github.com/aspnet), [Xamarin](https://github.com/xamarin), and [our GitHub organizations](https://opensource.microsoft.com/).
If you believe you have found a security vulnerability in any Microsoft-owned repository that meets [Microsoft's definition of a security vulnerability](https://aka.ms/opensource/security/definition), please report it to us as described below.
## Reporting Security Issues
**Please do not report security vulnerabilities through public GitHub issues.**
Instead, please report them to the Microsoft Security Response Center (MSRC) at [https://msrc.microsoft.com/create-report](https://aka.ms/opensource/security/create-report).
If you prefer to submit without logging in, send email to [secure@microsoft.com](mailto:secure@microsoft.com). If possible, encrypt your message with our PGP key; please download it from the [Microsoft Security Response Center PGP Key page](https://aka.ms/opensource/security/pgpkey).
You should receive a response within 24 hours. If for some reason you do not, please follow up via email to ensure we received your original message. Additional information can be found at [microsoft.com/msrc](https://aka.ms/opensource/security/msrc).
Please include the requested information listed below (as much as you can provide) to help us better understand the nature and scope of the possible issue:
* Type of issue (e.g. buffer overflow, SQL injection, cross-site scripting, etc.)
* Full paths of source file(s) related to the manifestation of the issue
* The location of the affected source code (tag/branch/commit or direct URL)
* Any special configuration required to reproduce the issue
* Step-by-step instructions to reproduce the issue
* Proof-of-concept or exploit code (if possible)
* Impact of the issue, including how an attacker might exploit the issue
This information will help us triage your report more quickly.
If you are reporting for a bug bounty, more complete reports can contribute to a higher bounty award. Please visit our [Microsoft Bug Bounty Program](https://aka.ms/opensource/security/bounty) page for more details about our active programs.
## Preferred Languages
We prefer all communications to be in English.
## Policy
Microsoft follows the principle of [Coordinated Vulnerability Disclosure](https://aka.ms/opensource/security/cvd).
<!-- END MICROSOFT SECURITY.MD BLOCK -->

View File

@@ -1,3 +1,4 @@
module.exports = {
presets: [["@babel/preset-env", { targets: { node: "current" } }], "@babel/preset-react", "@babel/preset-typescript"]
presets: [["@babel/preset-env", { targets: { node: "current" } }], "@babel/preset-react", "@babel/preset-typescript"],
plugins: [["@babel/plugin-proposal-decorators", { legacy: true }]],
};

View File

@@ -1,3 +1,5 @@
{
"JUNO_ENDPOINT": "https://tools-staging.cosmos.azure.com"
"JUNO_ENDPOINT": "https://tools.cosmos.azure.com",
"isTerminalEnabled": true,
"isPhoenixEnabled": true
}

View File

@@ -1,3 +1,5 @@
{
"JUNO_ENDPOINT": "https://tools.cosmos.azure.com"
"JUNO_ENDPOINT": "https://tools.cosmos.azure.com",
"isTerminalEnabled" : false,
"isPhoenixEnabled" : false
}

2660
docs/assets/css/main.css Normal file

File diff suppressed because it is too large Load Diff

Binary file not shown.

After

Width:  |  Height:  |  Size: 9.4 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 28 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 480 B

Binary file not shown.

After

Width:  |  Height:  |  Size: 855 B

248
docs/assets/js/main.js Normal file

File diff suppressed because one or more lines are too long

1
docs/assets/js/search.js Normal file

File diff suppressed because one or more lines are too long

View File

@@ -0,0 +1,306 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>SelfServeBaseClass | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
</li>
<li>
<a href="selfserve_selfservetypes.selfservebaseclass.html">SelfServeBaseClass</a>
</li>
</ul>
<h1>Class SelfServeBaseClass</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel tsd-comment">
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>All SelfServe feature classes need to derive from the SelfServeBaseClass</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-hierarchy">
<h3>Hierarchy</h3>
<ul class="tsd-hierarchy">
<li>
<span class="target">SelfServeBaseClass</span>
</li>
</ul>
</section>
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Constructors</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-constructor tsd-parent-kind-class"><a href="selfserve_selfservetypes.selfservebaseclass.html#constructor" class="tsd-kind-icon">constructor</a></li>
</ul>
</section>
<section class="tsd-index-section ">
<h3>Properties</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-property tsd-parent-kind-class"><a href="selfserve_selfservetypes.selfservebaseclass.html#initialize" class="tsd-kind-icon">initialize</a></li>
<li class="tsd-kind-property tsd-parent-kind-class"><a href="selfserve_selfservetypes.selfservebaseclass.html#onrefresh" class="tsd-kind-icon">on<wbr>Refresh</a></li>
<li class="tsd-kind-property tsd-parent-kind-class"><a href="selfserve_selfservetypes.selfservebaseclass.html#onsave" class="tsd-kind-icon">on<wbr>Save</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Constructors</h2>
<section class="tsd-panel tsd-member tsd-kind-constructor tsd-parent-kind-class">
<a name="constructor" class="tsd-anchor"></a>
<h3>constructor</h3>
<ul class="tsd-signatures tsd-kind-constructor tsd-parent-kind-class">
<li class="tsd-signature tsd-kind-icon">new <wbr>Self<wbr>Serve<wbr>Base<wbr>Class<span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><a href="selfserve_selfservetypes.selfservebaseclass.html" class="tsd-signature-type" data-tsd-kind="Class">SelfServeBaseClass</a></li>
</ul>
<ul class="tsd-descriptions">
<li class="tsd-description">
<aside class="tsd-sources">
</aside>
<h4 class="tsd-returns-title">Returns <a href="selfserve_selfservetypes.selfservebaseclass.html" class="tsd-signature-type" data-tsd-kind="Class">SelfServeBaseClass</a></h4>
</li>
</ul>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Properties</h2>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-class">
<a name="initialize" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagAbstract">Abstract</span> initialize</h3>
<div class="tsd-signature tsd-kind-icon">initialize<span class="tsd-signature-symbol">:</span> <a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-signature-type" data-tsd-kind="Type alias">initializeCallback</a></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Sets default values for the properties of the Self Serve Class. Typically, you can make rest calls here
to fetch the initial values for the properties. This is also called after the onSave callback, to reinitialize the defaults.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-class">
<a name="onrefresh" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagAbstract">Abstract</span> on<wbr>Refresh</h3>
<div class="tsd-signature tsd-kind-icon">on<wbr>Refresh<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="../interfaces/selfserve_selfservetypes.refreshresult.html" class="tsd-signature-type" data-tsd-kind="Interface">RefreshResult</a><span class="tsd-signature-symbol">&gt;</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Callback that is triggered when the refresh button is clicked. Here, you should perform the your rest API
call to check if the update action is completed.</p>
</div>
</div>
<div class="tsd-type-declaration">
<h4>Type declaration</h4>
<ul class="tsd-parameters">
<li class="tsd-parameter-signature">
<ul class="tsd-signatures tsd-kind-type-literal tsd-parent-kind-class">
<li class="tsd-signature tsd-kind-icon"><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="../interfaces/selfserve_selfservetypes.refreshresult.html" class="tsd-signature-type" data-tsd-kind="Interface">RefreshResult</a><span class="tsd-signature-symbol">&gt;</span></li>
</ul>
<ul class="tsd-descriptions">
<li class="tsd-description">
<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="../interfaces/selfserve_selfservetypes.refreshresult.html" class="tsd-signature-type" data-tsd-kind="Interface">RefreshResult</a><span class="tsd-signature-symbol">&gt;</span></h4>
</li>
</ul>
</li>
</ul>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-class">
<a name="onsave" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagAbstract">Abstract</span> on<wbr>Save</h3>
<div class="tsd-signature tsd-kind-icon">on<wbr>Save<span class="tsd-signature-symbol">:</span> <a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-signature-type" data-tsd-kind="Type alias">onSaveCallback</a></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Callback that is triggerred when the submit button is clicked. You should perform your rest API
calls here using the data from the different inputs passed as a Map to this callback function.</p>
</div>
</div>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class="current tsd-kind-module">
<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
</li>
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
</li>
</ul>
<ul class="current">
<li class="current tsd-kind-class tsd-parent-kind-module">
<a href="selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
<ul>
<li class=" tsd-kind-constructor tsd-parent-kind-class">
<a href="selfserve_selfservetypes.selfservebaseclass.html#constructor" class="tsd-kind-icon">constructor</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-class">
<a href="selfserve_selfservetypes.selfservebaseclass.html#initialize" class="tsd-kind-icon">initialize</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-class">
<a href="selfserve_selfservetypes.selfservebaseclass.html#onrefresh" class="tsd-kind-icon">on<wbr>Refresh</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-class">
<a href="selfserve_selfservetypes.selfservebaseclass.html#onsave" class="tsd-kind-icon">on<wbr>Save</a>
</li>
</ul>
</li>
</ul>
<ul class="after-current">
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
<li class="tsd-kind-constructor tsd-parent-kind-class"><span class="tsd-kind-icon">Constructor</span></li>
<li class="tsd-kind-property tsd-parent-kind-class"><span class="tsd-kind-icon">Property</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,245 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>DescriptionType | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
</li>
<li>
<a href="selfserve_selfservetypes.descriptiontype.html">DescriptionType</a>
</li>
</ul>
<h1>Enumeration DescriptionType</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Enumeration members</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfservetypes.descriptiontype.html#infomessagebar" class="tsd-kind-icon">Info<wbr>Message<wbr>Bar</a></li>
<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfservetypes.descriptiontype.html#text" class="tsd-kind-icon">Text</a></li>
<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfservetypes.descriptiontype.html#warningmessagebar" class="tsd-kind-icon">Warning<wbr>Message<wbr>Bar</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Enumeration members</h2>
<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
<a name="infomessagebar" class="tsd-anchor"></a>
<h3>Info<wbr>Message<wbr>Bar</h3>
<div class="tsd-signature tsd-kind-icon">Info<wbr>Message<wbr>Bar<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = 1</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Show the description as a Info Message bar.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
<a name="text" class="tsd-anchor"></a>
<h3>Text</h3>
<div class="tsd-signature tsd-kind-icon">Text<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = 0</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Show the description as a text</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
<a name="warningmessagebar" class="tsd-anchor"></a>
<h3>Warning<wbr>Message<wbr>Bar</h3>
<div class="tsd-signature tsd-kind-icon">Warning<wbr>Message<wbr>Bar<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = 2</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Show the description as a Warning Message bar.</p>
</div>
</div>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class="current tsd-kind-module">
<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
</ul>
<ul class="current">
<li class="current tsd-kind-enum tsd-parent-kind-module">
<a href="selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
<ul>
<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
<a href="selfserve_selfservetypes.descriptiontype.html#infomessagebar" class="tsd-kind-icon">Info<wbr>Message<wbr>Bar</a>
</li>
<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
<a href="selfserve_selfservetypes.descriptiontype.html#text" class="tsd-kind-icon">Text</a>
</li>
<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
<a href="selfserve_selfservetypes.descriptiontype.html#warningmessagebar" class="tsd-kind-icon">Warning<wbr>Message<wbr>Bar</a>
</li>
</ul>
</li>
</ul>
<ul class="after-current">
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
</li>
<li class=" tsd-kind-class tsd-parent-kind-module">
<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,229 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>NumberUiType | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
</li>
<li>
<a href="selfserve_selfservetypes.numberuitype.html">NumberUiType</a>
</li>
</ul>
<h1>Enumeration NumberUiType</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Enumeration members</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfservetypes.numberuitype.html#slider" class="tsd-kind-icon">Slider</a></li>
<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfservetypes.numberuitype.html#spinner" class="tsd-kind-icon">Spinner</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Enumeration members</h2>
<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
<a name="slider" class="tsd-anchor"></a>
<h3>Slider</h3>
<div class="tsd-signature tsd-kind-icon">Slider<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = &quot;Slider&quot;</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>The numeric input UI element corresponding to the property is a Slider</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
<a name="spinner" class="tsd-anchor"></a>
<h3>Spinner</h3>
<div class="tsd-signature tsd-kind-icon">Spinner<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = &quot;Spinner&quot;</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>The numeric input UI element corresponding to the property is a Spinner</p>
</div>
</div>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class="current tsd-kind-module">
<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
</li>
</ul>
<ul class="current">
<li class="current tsd-kind-enum tsd-parent-kind-module">
<a href="selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
<ul>
<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
<a href="selfserve_selfservetypes.numberuitype.html#slider" class="tsd-kind-icon">Slider</a>
</li>
<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
<a href="selfserve_selfservetypes.numberuitype.html#spinner" class="tsd-kind-icon">Spinner</a>
</li>
</ul>
</li>
</ul>
<ul class="after-current">
<li class=" tsd-kind-class tsd-parent-kind-module">
<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,301 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>BladeType | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="../modules/selfserve_selfserveutils.html">SelfServe/SelfServeUtils</a>
</li>
<li>
<a href="selfserve_selfserveutils.bladetype.html">BladeType</a>
</li>
</ul>
<h1>Enumeration BladeType</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel tsd-comment">
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Portal Blade types</p>
</div>
</div>
</section>
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Enumeration members</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a
href="selfserve_selfserveutils.bladetype.html#cassandrakeys"
class="tsd-kind-icon">Cassandra<wbr>Keys</a></li>
<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a
href="selfserve_selfserveutils.bladetype.html#gremlinkeys"
class="tsd-kind-icon">Gremlin<wbr>Keys</a></li>
<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a
href="selfserve_selfserveutils.bladetype.html#metrics"
class="tsd-kind-icon">Metrics</a></li>
<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a
href="selfserve_selfserveutils.bladetype.html#mongokeys"
class="tsd-kind-icon">Mongo<wbr>Keys</a></li>
<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a
href="selfserve_selfserveutils.bladetype.html#sqlkeys"
class="tsd-kind-icon">Sql<wbr>Keys</a></li>
<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a
href="selfserve_selfserveutils.bladetype.html#tablekeys"
class="tsd-kind-icon">Table<wbr>Keys</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Enumeration members</h2>
<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
<a name="cassandrakeys" class="tsd-anchor"></a>
<h3>Cassandra<wbr>Keys</h3>
<div class="tsd-signature tsd-kind-icon">Cassandra<wbr>Keys<span
class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> =
&quot;cassandraDbKeys&quot;</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Keys blade of a Azure Cosmos DB for Apache Cassandra account.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
<a name="gremlinkeys" class="tsd-anchor"></a>
<h3>Gremlin<wbr>Keys</h3>
<div class="tsd-signature tsd-kind-icon">Gremlin<wbr>Keys<span
class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> =
&quot;keys&quot;</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Keys blade of a Azure Cosmos DB for Apache Gremlin account.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
<a name="metrics" class="tsd-anchor"></a>
<h3>Metrics</h3>
<div class="tsd-signature tsd-kind-icon">Metrics<span class="tsd-signature-symbol">:</span>
<span class="tsd-signature-symbol"> = &quot;metrics&quot;</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Metrics blade of an Azure Cosmos DB account.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
<a name="mongokeys" class="tsd-anchor"></a>
<h3>Mongo<wbr>Keys</h3>
<div class="tsd-signature tsd-kind-icon">Mongo<wbr>Keys<span
class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> =
&quot;mongoDbKeys&quot;</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Keys blade of a Azure Cosmos DB for MongoDB account.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
<a name="sqlkeys" class="tsd-anchor"></a>
<h3>Sql<wbr>Keys</h3>
<div class="tsd-signature tsd-kind-icon">Sql<wbr>Keys<span class="tsd-signature-symbol">:</span>
<span class="tsd-signature-symbol"> = &quot;keys&quot;</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Keys blade of a Azure Cosmos DB for NoSQL account.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
<a name="tablekeys" class="tsd-anchor"></a>
<h3>Table<wbr>Keys</h3>
<div class="tsd-signature tsd-kind-icon">Table<wbr>Keys<span
class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> =
&quot;tableKeys&quot;</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Keys blade of a Azure Cosmos DB for Table account.</p>
</div>
</div>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr>
<wbr>What is currently supported?</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a
href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class=" tsd-kind-module">
<a
href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class="current tsd-kind-module">
<a
href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
</ul>
<ul class="current">
<li class="current tsd-kind-enum tsd-parent-kind-module">
<a href="selfserve_selfserveutils.bladetype.html" class="tsd-kind-icon">Blade<wbr>Type</a>
<ul>
<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
<a href="selfserve_selfserveutils.bladetype.html#cassandrakeys"
class="tsd-kind-icon">Cassandra<wbr>Keys</a>
</li>
<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
<a href="selfserve_selfserveutils.bladetype.html#gremlinkeys"
class="tsd-kind-icon">Gremlin<wbr>Keys</a>
</li>
<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
<a href="selfserve_selfserveutils.bladetype.html#metrics"
class="tsd-kind-icon">Metrics</a>
</li>
<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
<a href="selfserve_selfserveutils.bladetype.html#mongokeys"
class="tsd-kind-icon">Mongo<wbr>Keys</a>
</li>
<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
<a href="selfserve_selfserveutils.bladetype.html#sqlkeys"
class="tsd-kind-icon">Sql<wbr>Keys</a>
</li>
<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
<a href="selfserve_selfserveutils.bladetype.html#tablekeys"
class="tsd-kind-icon">Table<wbr>Keys</a>
</li>
</ul>
</li>
</ul>
<ul class="after-current">
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="selfserve_selfserveutils.selfservetype.html"
class="tsd-kind-icon">Self<wbr>Serve<wbr>Type</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_selfserveutils.html#generatebladelink"
class="tsd-kind-icon">generate<wbr>Blade<wbr>Link</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,201 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>SelfServeType | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="../modules/selfserve_selfserveutils.html">SelfServe/SelfServeUtils</a>
</li>
<li>
<a href="selfserve_selfserveutils.selfservetype.html">SelfServeType</a>
</li>
</ul>
<h1>Enumeration SelfServeType</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel tsd-comment">
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>The type used to identify the Self Serve Class</p>
</div>
</div>
</section>
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Enumeration members</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfserveutils.selfservetype.html#example" class="tsd-kind-icon">example</a></li>
<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfserveutils.selfservetype.html#invalid" class="tsd-kind-icon">invalid</a></li>
<li class="tsd-kind-enum-member tsd-parent-kind-enum"><a href="selfserve_selfserveutils.selfservetype.html#sqlx" class="tsd-kind-icon">sqlx</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Enumeration members</h2>
<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
<a name="example" class="tsd-anchor"></a>
<h3>example</h3>
<div class="tsd-signature tsd-kind-icon">example<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = &quot;example&quot;</span></div>
<aside class="tsd-sources">
</aside>
</section>
<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
<a name="invalid" class="tsd-anchor"></a>
<h3>invalid</h3>
<div class="tsd-signature tsd-kind-icon">invalid<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = &quot;invalid&quot;</span></div>
<aside class="tsd-sources">
</aside>
</section>
<section class="tsd-panel tsd-member tsd-kind-enum-member tsd-parent-kind-enum">
<a name="sqlx" class="tsd-anchor"></a>
<h3>sqlx</h3>
<div class="tsd-signature tsd-kind-icon">sqlx<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol"> = &quot;sqlx&quot;</span></div>
<aside class="tsd-sources">
</aside>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class="current tsd-kind-module">
<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="selfserve_selfserveutils.bladetype.html" class="tsd-kind-icon">Blade<wbr>Type</a>
</li>
</ul>
<ul class="current">
<li class="current tsd-kind-enum tsd-parent-kind-module">
<a href="selfserve_selfserveutils.selfservetype.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Type</a>
<ul>
<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
<a href="selfserve_selfserveutils.selfservetype.html#example" class="tsd-kind-icon">example</a>
</li>
<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
<a href="selfserve_selfserveutils.selfservetype.html#invalid" class="tsd-kind-icon">invalid</a>
</li>
<li class=" tsd-kind-enum-member tsd-parent-kind-enum">
<a href="selfserve_selfserveutils.selfservetype.html#sqlx" class="tsd-kind-icon">sqlx</a>
</li>
</ul>
</li>
</ul>
<ul class="after-current">
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_selfserveutils.html#generatebladelink" class="tsd-kind-icon">generate<wbr>Blade<wbr>Link</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

209
docs/index.html Normal file
View File

@@ -0,0 +1,209 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="assets/css/main.css">
<script async src="assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="assets/js/search.json" data-base=".">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<h1>cosmos-explorer</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<div class="tsd-panel tsd-typography">
<a href="#cosmos-db-explorer" id="cosmos-db-explorer" style="color: inherit; text-decoration: none;">
<h1>Cosmos DB Explorer</h1>
</a>
<p>UI for Azure Cosmos DB. Powers the <a href="https://portal.azure.com/">Azure Portal</a>, <a href="https://cosmos.azure.com/">https://cosmos.azure.com/</a>, and the <a href="https://docs.microsoft.com/en-us/azure/cosmos-db/local-emulator">Cosmos DB Emulator</a></p>
<p><img src="https://sdkctlstore.blob.core.windows.net/exe/dataexplorer.gif" alt=""></p>
<a href="#getting-started" id="getting-started" style="color: inherit; text-decoration: none;">
<h2>Getting Started</h2>
</a>
<ul>
<li><code>npm install</code></li>
<li><code>npm run build</code></li>
</ul>
<a href="#developing" id="developing" style="color: inherit; text-decoration: none;">
<h2>Developing</h2>
</a>
<a href="#watch-mode" id="watch-mode" style="color: inherit; text-decoration: none;">
<h3>Watch mode</h3>
</a>
<p>Run <code>npm start</code> to start the development server and automatically rebuild on changes</p>
<a href="#hosted-development-httpscosmosazurecom" id="hosted-development-httpscosmosazurecom" style="color: inherit; text-decoration: none;">
<h3>Hosted Development (<a href="https://cosmos.azure.com">https://cosmos.azure.com</a>)</h3>
</a>
<ul>
<li>Visit: <code>https://localhost:1234/hostedExplorer.html</code></li>
<li>The default webpack dev server configuration will proxy requests to the production portal backend: <code>https://cdb-ms-mpac-pbe.cosmos.azure.com</code>. This will allow you to use production connection strings on your local machine.</li>
</ul>
<a href="#emulator-development" id="emulator-development" style="color: inherit; text-decoration: none;">
<h3>Emulator Development</h3>
</a>
<ul>
<li>Start the Cosmos Emulator</li>
<li>Visit: <a href="https://localhost:1234/index.html">https://localhost:1234/index.html</a></li>
</ul>
<a href="#setting-up-a-remote-emulator" id="setting-up-a-remote-emulator" style="color: inherit; text-decoration: none;">
<h4>Setting up a Remote Emulator</h4>
</a>
<p>The Cosmos emulator currently only runs in Windows environments. You can still develop on a non-Windows machine by setting up an emulator on a windows box and exposing its ports publicly:</p>
<ol>
<li><p>Expose these ports publicly: 8081, 8900, 8979, 10250, 10251, 10252, 10253, 10254, 10255, 10256</p>
</li>
<li><p>Download and install the emulator: <a href="https://docs.microsoft.com/en-us/azure/cosmos-db/local-emulator">https://docs.microsoft.com/en-us/azure/cosmos-db/local-emulator</a></p>
</li>
<li><p>Start the emulator from PowerShell:</p>
</li>
</ol>
<pre><code><span style="color: #000000">&gt; </span><span style="color: #001080">cd</span><span style="color: #000000"> C:/</span>
<span style="color: #000000">&gt; .\</span><span style="color: #001080">CosmosDB</span><span style="color: #000000">.</span><span style="color: #001080">Emulator</span><span style="color: #000000">.</span><span style="color: #001080">exe</span><span style="color: #000000"> -</span><span style="color: #001080">AllowNetworkAccess</span><span style="color: #000000"> -</span><span style="color: #001080">Key</span><span style="color: #000000">=</span><span style="color: #A31515">&quot;&lt;EMULATOR MASTER KEY&gt;&quot;</span>
</code></pre>
<a href="#portal-development" id="portal-development" style="color: inherit; text-decoration: none;">
<h3>Portal Development</h3>
</a>
<ul>
<li>Visit: <a href="https://ms.portal.azure.com/?dataExplorerSource=https%3A%2F%2Flocalhost%3A1234%2Fexplorer.html">https://ms.portal.azure.com/?dataExplorerSource=https%3A%2F%2Flocalhost%3A1234%2Fexplorer.html</a></li>
<li>You may have to manually visit <a href="https://localhost:1234/explorer.html">https://localhost:1234/explorer.html</a> first and click through any SSL certificate warnings</li>
</ul>
<a href="#testing" id="testing" style="color: inherit; text-decoration: none;">
<h3>Testing</h3>
</a>
<a href="#unit-tests" id="unit-tests" style="color: inherit; text-decoration: none;">
<h4>Unit Tests</h4>
</a>
<p>Unit tests are located adjacent to the code under test and run with <a href="https://jestjs.io/">Jest</a>:</p>
<p><code>npm run test</code></p>
<a href="#end-to-end-ci-tests" id="end-to-end-ci-tests" style="color: inherit; text-decoration: none;">
<h4>End to End CI Tests</h4>
</a>
<p>Jest and Puppeteer are used for end to end browser based tests and are contained in <code>test/</code>. To run these tests locally:</p>
<ol>
<li>Copy .env.example to .env</li>
<li>Update the values in .env including your local data explorer endpoint (ask a teammate/codeowner for help with .env values)</li>
<li>Make sure all packages are installed <code>npm install</code></li>
<li>Run the server <code>npm run start</code> and wait for it to start</li>
<li>Run <code>npm run test:e2e</code></li>
</ol>
<a href="#releasing" id="releasing" style="color: inherit; text-decoration: none;">
<h3>Releasing</h3>
</a>
<p>We generally adhere to the release strategy <a href="https://azure.github.io/azure-sdk/policies_repobranching.html#release-branches">documented by the Azure SDK Guidelines</a>. Most releases should happen from the master branch. If master contains commits that cannot be released, you may create a release from a <code>release/</code> or <code>hotfix/</code> branch. See linked documentation for more details.</p>
<a href="#architecture" id="architecture" style="color: inherit; text-decoration: none;">
<h3>Architecture</h3>
</a>
<p><a href="https://mermaid-js.github.io/mermaid-live-editor/#/edit/eyJjb2RlIjoiZ3JhcGggTFJcbiAgaG9zdGVkKGh0dHBzOi8vY29zbW9zLmF6dXJlLmNvbSlcbiAgcG9ydGFsKFBvcnRhbClcbiAgZW11bGF0b3IoRW11bGF0b3IpXG4gIGFhZFtBQURdXG4gIHJlc291cmNlVG9rZW5bUmVzb3VyY2UgVG9rZW5dXG4gIGNvbm5lY3Rpb25TdHJpbmdbQ29ubmVjdGlvbiBTdHJpbmddXG4gIHBvcnRhbFRva2VuW0VuY3J5cHRlZCBQb3J0YWwgVG9rZW5dXG4gIG1hc3RlcktleVtNYXN0ZXIgS2V5XVxuICBhcm1bQVJNIFJlc291cmNlIFByb3ZpZGVyXVxuICBkYXRhcGxhbmVbRGF0YSBQbGFuZV1cbiAgcHJveHlbUG9ydGFsIEFQSSBQcm94eV1cbiAgc3FsW1NRTF1cbiAgbW9uZ29bTW9uZ29dXG4gIHRhYmxlc1tUYWJsZXNdXG4gIGNhc3NhbmRyYVtDYXNzYW5kcmFdXG4gIGdyYWZbR3JhcGhdXG5cblxuICBlbXVsYXRvciAtLT4gbWFzdGVyS2V5IC0tLS0-IGRhdGFwbGFuZVxuICBwb3J0YWwgLS0-IGFhZFxuICBob3N0ZWQgLS0-IHBvcnRhbFRva2VuICYgcmVzb3VyY2VUb2tlbiAmIGNvbm5lY3Rpb25TdHJpbmcgJiBhYWRcbiAgYWFkIC0tLT4gYXJtXG4gIGFhZCAtLS0-IGRhdGFwbGFuZVxuICBhYWQgLS0tPiBwcm94eVxuICByZXNvdXJjZVRva2VuIC0tLT4gc3FsIC0tPiBkYXRhcGxhbmVcbiAgcG9ydGFsVG9rZW4gLS0tPiBwcm94eVxuICBwcm94eSAtLT4gZGF0YXBsYW5lXG4gIGNvbm5lY3Rpb25TdHJpbmcgLS0-IHNxbCAmIG1vbmdvICYgY2Fzc2FuZHJhICYgZ3JhZiAmIHRhYmxlc1xuICBzcWwgLS0-IGRhdGFwbGFuZVxuICB0YWJsZXMgLS0-IGRhdGFwbGFuZVxuICBtb25nbyAtLT4gcHJveHlcbiAgY2Fzc2FuZHJhIC0tPiBwcm94eVxuICBncmFmIC0tPiBwcm94eVxuXG5cdFx0IiwibWVybWFpZCI6eyJ0aGVtZSI6ImRlZmF1bHQifSwidXBkYXRlRWRpdG9yIjpmYWxzZX0"><img src="https://mermaid.ink/img/eyJjb2RlIjoiZ3JhcGggTFJcbiAgaG9zdGVkKGh0dHBzOi8vY29zbW9zLmF6dXJlLmNvbSlcbiAgcG9ydGFsKFBvcnRhbClcbiAgZW11bGF0b3IoRW11bGF0b3IpXG4gIGFhZFtBQURdXG4gIHJlc291cmNlVG9rZW5bUmVzb3VyY2UgVG9rZW5dXG4gIGNvbm5lY3Rpb25TdHJpbmdbQ29ubmVjdGlvbiBTdHJpbmddXG4gIHBvcnRhbFRva2VuW0VuY3J5cHRlZCBQb3J0YWwgVG9rZW5dXG4gIG1hc3RlcktleVtNYXN0ZXIgS2V5XVxuICBhcm1bQVJNIFJlc291cmNlIFByb3ZpZGVyXVxuICBkYXRhcGxhbmVbRGF0YSBQbGFuZV1cbiAgcHJveHlbUG9ydGFsIEFQSSBQcm94eV1cbiAgc3FsW1NRTF1cbiAgbW9uZ29bTW9uZ29dXG4gIHRhYmxlc1tUYWJsZXNdXG4gIGNhc3NhbmRyYVtDYXNzYW5kcmFdXG4gIGdyYWZbR3JhcGhdXG5cblxuICBlbXVsYXRvciAtLT4gbWFzdGVyS2V5IC0tLS0-IGRhdGFwbGFuZVxuICBwb3J0YWwgLS0-IGFhZFxuICBob3N0ZWQgLS0-IHBvcnRhbFRva2VuICYgcmVzb3VyY2VUb2tlbiAmIGNvbm5lY3Rpb25TdHJpbmcgJiBhYWRcbiAgYWFkIC0tLT4gYXJtXG4gIGFhZCAtLS0-IGRhdGFwbGFuZVxuICBhYWQgLS0tPiBwcm94eVxuICByZXNvdXJjZVRva2VuIC0tLT4gc3FsIC0tPiBkYXRhcGxhbmVcbiAgcG9ydGFsVG9rZW4gLS0tPiBwcm94eVxuICBwcm94eSAtLT4gZGF0YXBsYW5lXG4gIGNvbm5lY3Rpb25TdHJpbmcgLS0-IHNxbCAmIG1vbmdvICYgY2Fzc2FuZHJhICYgZ3JhZiAmIHRhYmxlc1xuICBzcWwgLS0-IGRhdGFwbGFuZVxuICB0YWJsZXMgLS0-IGRhdGFwbGFuZVxuICBtb25nbyAtLT4gcHJveHlcbiAgY2Fzc2FuZHJhIC0tPiBwcm94eVxuICBncmFmIC0tPiBwcm94eVxuXG5cdFx0IiwibWVybWFpZCI6eyJ0aGVtZSI6ImRlZmF1bHQifSwidXBkYXRlRWRpdG9yIjpmYWxzZX0" alt=""></a></p>
<a href="#contributing" id="contributing" style="color: inherit; text-decoration: none;">
<h1>Contributing</h1>
</a>
<p>Please read the <a href="./CONTRIBUTING.md">contribution guidelines</a>.</p>
</div>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="modules/selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class=" tsd-kind-module">
<a href="modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class=" tsd-kind-module">
<a href="modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,255 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>BooleanInputOptions | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="../modules/selfserve_decorators.html">SelfServe/Decorators</a>
</li>
<li>
<a href="selfserve_decorators.booleaninputoptions.html">BooleanInputOptions</a>
</li>
</ul>
<h1>Interface BooleanInputOptions</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel tsd-comment">
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Toggle is rendered.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-hierarchy">
<h3>Hierarchy</h3>
<ul class="tsd-hierarchy">
<li>
<span class="tsd-signature-type">InputOptionsBase</span>
<ul class="tsd-hierarchy">
<li>
<span class="target">BooleanInputOptions</span>
</li>
</ul>
</li>
</ul>
</section>
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Properties</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.booleaninputoptions.html#falselabeltkey" class="tsd-kind-icon">false<wbr>LabelTKey</a></li>
<li class="tsd-kind-property tsd-parent-kind-interface tsd-is-inherited"><a href="selfserve_decorators.booleaninputoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.booleaninputoptions.html#truelabeltkey" class="tsd-kind-icon">true<wbr>LabelTKey</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Properties</h2>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="falselabeltkey" class="tsd-anchor"></a>
<h3>false<wbr>LabelTKey</h3>
<div class="tsd-signature tsd-kind-icon">false<wbr>LabelTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the false label of the toggle, from the strings JSON file.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface tsd-is-inherited">
<a name="labeltkey" class="tsd-anchor"></a>
<h3>labelTKey</h3>
<div class="tsd-signature tsd-kind-icon">labelTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
<aside class="tsd-sources">
<p>Inherited from InputOptionsBase.labelTKey</p>
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the label of the UI element, from the strings JSON file.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="truelabeltkey" class="tsd-anchor"></a>
<h3>true<wbr>LabelTKey</h3>
<div class="tsd-signature tsd-kind-icon">true<wbr>LabelTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the true label of the toggle, from the strings JSON file.</p>
</div>
</div>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class="current tsd-kind-module">
<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
</ul>
<ul class="current">
<li class="current tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.booleaninputoptions.html" class="tsd-kind-icon">Boolean<wbr>Input<wbr>Options</a>
<ul>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_decorators.booleaninputoptions.html#falselabeltkey" class="tsd-kind-icon">false<wbr>LabelTKey</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-interface tsd-is-inherited">
<a href="selfserve_decorators.booleaninputoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_decorators.booleaninputoptions.html#truelabeltkey" class="tsd-kind-icon">true<wbr>LabelTKey</a>
</li>
</ul>
</li>
</ul>
<ul class="after-current">
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.choiceinputoptions.html" class="tsd-kind-icon">Choice<wbr>Input<wbr>Options</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.descriptiondisplayoptions.html" class="tsd-kind-icon">Description<wbr>Display<wbr>Options</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.numberinputoptions.html" class="tsd-kind-icon">Number<wbr>Input<wbr>Options</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.stringinputoptions.html" class="tsd-kind-icon">String<wbr>Input<wbr>Options</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#inputoptions" class="tsd-kind-icon">Input<wbr>Options</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#isdisplayable" class="tsd-kind-icon">Is<wbr>Displayable</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#onchange" class="tsd-kind-icon">On<wbr>Change</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#propertyinfo" class="tsd-kind-icon">Property<wbr>Info</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#refreshoptions" class="tsd-kind-icon">Refresh<wbr>Options</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#values" class="tsd-kind-icon">Values</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,255 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>ChoiceInputOptions | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="../modules/selfserve_decorators.html">SelfServe/Decorators</a>
</li>
<li>
<a href="selfserve_decorators.choiceinputoptions.html">ChoiceInputOptions</a>
</li>
</ul>
<h1>Interface ChoiceInputOptions</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel tsd-comment">
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Dropdown is rendered.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-hierarchy">
<h3>Hierarchy</h3>
<ul class="tsd-hierarchy">
<li>
<span class="tsd-signature-type">InputOptionsBase</span>
<ul class="tsd-hierarchy">
<li>
<span class="target">ChoiceInputOptions</span>
</li>
</ul>
</li>
</ul>
</section>
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Properties</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.choiceinputoptions.html#choices" class="tsd-kind-icon">choices</a></li>
<li class="tsd-kind-property tsd-parent-kind-interface tsd-is-inherited"><a href="selfserve_decorators.choiceinputoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.choiceinputoptions.html#placeholdertkey" class="tsd-kind-icon">placeholderTKey</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Properties</h2>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="choices" class="tsd-anchor"></a>
<h3>choices</h3>
<div class="tsd-signature tsd-kind-icon">choices<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-signature-type" data-tsd-kind="Type alias">ChoiceItem</a><span class="tsd-signature-symbol">[]</span><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> | </span><a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-signature-type" data-tsd-kind="Type alias">ChoiceItem</a><span class="tsd-signature-symbol">[]</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Choices to be shown in the dropdown</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface tsd-is-inherited">
<a name="labeltkey" class="tsd-anchor"></a>
<h3>labelTKey</h3>
<div class="tsd-signature tsd-kind-icon">labelTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
<aside class="tsd-sources">
<p>Inherited from InputOptionsBase.labelTKey</p>
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the label of the UI element, from the strings JSON file.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="placeholdertkey" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagOptional">Optional</span> placeholderTKey</h3>
<div class="tsd-signature tsd-kind-icon">placeholderTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the placeholder text of the dropdown, from the strings JSON file.</p>
</div>
</div>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class="current tsd-kind-module">
<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.booleaninputoptions.html" class="tsd-kind-icon">Boolean<wbr>Input<wbr>Options</a>
</li>
</ul>
<ul class="current">
<li class="current tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.choiceinputoptions.html" class="tsd-kind-icon">Choice<wbr>Input<wbr>Options</a>
<ul>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_decorators.choiceinputoptions.html#choices" class="tsd-kind-icon">choices</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-interface tsd-is-inherited">
<a href="selfserve_decorators.choiceinputoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_decorators.choiceinputoptions.html#placeholdertkey" class="tsd-kind-icon">placeholderTKey</a>
</li>
</ul>
</li>
</ul>
<ul class="after-current">
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.descriptiondisplayoptions.html" class="tsd-kind-icon">Description<wbr>Display<wbr>Options</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.numberinputoptions.html" class="tsd-kind-icon">Number<wbr>Input<wbr>Options</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.stringinputoptions.html" class="tsd-kind-icon">String<wbr>Input<wbr>Options</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#inputoptions" class="tsd-kind-icon">Input<wbr>Options</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#isdisplayable" class="tsd-kind-icon">Is<wbr>Displayable</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#onchange" class="tsd-kind-icon">On<wbr>Change</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#propertyinfo" class="tsd-kind-icon">Property<wbr>Info</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#refreshoptions" class="tsd-kind-icon">Refresh<wbr>Options</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#values" class="tsd-kind-icon">Values</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,249 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>DescriptionDisplayOptions | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="../modules/selfserve_decorators.html">SelfServe/Decorators</a>
</li>
<li>
<a href="selfserve_decorators.descriptiondisplayoptions.html">DescriptionDisplayOptions</a>
</li>
</ul>
<h1>Interface DescriptionDisplayOptions</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel tsd-comment">
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Text is rendered.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-hierarchy">
<h3>Hierarchy</h3>
<ul class="tsd-hierarchy">
<li>
<span class="target">DescriptionDisplayOptions</span>
</li>
</ul>
</section>
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Properties</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.descriptiondisplayoptions.html#description" class="tsd-kind-icon">description</a></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.descriptiondisplayoptions.html#isdynamicdescription" class="tsd-kind-icon">is<wbr>Dynamic<wbr>Description</a></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.descriptiondisplayoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Properties</h2>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="description" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagOptional">Optional</span> description</h3>
<div class="tsd-signature tsd-kind-icon">description<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="selfserve_selfservetypes.description.html" class="tsd-signature-type" data-tsd-kind="Interface">Description</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> | </span><a href="selfserve_selfservetypes.description.html" class="tsd-signature-type" data-tsd-kind="Interface">Description</a></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Static description to be shown as text.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="isdynamicdescription" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagOptional">Optional</span> is<wbr>Dynamic<wbr>Description</h3>
<div class="tsd-signature tsd-kind-icon">is<wbr>Dynamic<wbr>Description<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">boolean</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>If true, Indicates that the Description will be populated dynamically and that it may not be present in some scenarios.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="labeltkey" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagOptional">Optional</span> labelTKey</h3>
<div class="tsd-signature tsd-kind-icon">labelTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Optional heading for the text displayed by this description element.</p>
</div>
</div>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class="current tsd-kind-module">
<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.booleaninputoptions.html" class="tsd-kind-icon">Boolean<wbr>Input<wbr>Options</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.choiceinputoptions.html" class="tsd-kind-icon">Choice<wbr>Input<wbr>Options</a>
</li>
</ul>
<ul class="current">
<li class="current tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.descriptiondisplayoptions.html" class="tsd-kind-icon">Description<wbr>Display<wbr>Options</a>
<ul>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_decorators.descriptiondisplayoptions.html#description" class="tsd-kind-icon">description</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_decorators.descriptiondisplayoptions.html#isdynamicdescription" class="tsd-kind-icon">is<wbr>Dynamic<wbr>Description</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_decorators.descriptiondisplayoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a>
</li>
</ul>
</li>
</ul>
<ul class="after-current">
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.numberinputoptions.html" class="tsd-kind-icon">Number<wbr>Input<wbr>Options</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.stringinputoptions.html" class="tsd-kind-icon">String<wbr>Input<wbr>Options</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#inputoptions" class="tsd-kind-icon">Input<wbr>Options</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#isdisplayable" class="tsd-kind-icon">Is<wbr>Displayable</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#onchange" class="tsd-kind-icon">On<wbr>Change</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#propertyinfo" class="tsd-kind-icon">Property<wbr>Info</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#refreshoptions" class="tsd-kind-icon">Refresh<wbr>Options</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#values" class="tsd-kind-icon">Values</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,287 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>NumberInputOptions | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="../modules/selfserve_decorators.html">SelfServe/Decorators</a>
</li>
<li>
<a href="selfserve_decorators.numberinputoptions.html">NumberInputOptions</a>
</li>
</ul>
<h1>Interface NumberInputOptions</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel tsd-comment">
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Numeric input UI element is rendered. The current options are to render it as a slider or a spinner.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-hierarchy">
<h3>Hierarchy</h3>
<ul class="tsd-hierarchy">
<li>
<span class="tsd-signature-type">InputOptionsBase</span>
<ul class="tsd-hierarchy">
<li>
<span class="target">NumberInputOptions</span>
</li>
</ul>
</li>
</ul>
</section>
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Properties</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-property tsd-parent-kind-interface tsd-is-inherited"><a href="selfserve_decorators.numberinputoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.numberinputoptions.html#max" class="tsd-kind-icon">max</a></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.numberinputoptions.html#min" class="tsd-kind-icon">min</a></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.numberinputoptions.html#step" class="tsd-kind-icon">step</a></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.numberinputoptions.html#uitype" class="tsd-kind-icon">ui<wbr>Type</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Properties</h2>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface tsd-is-inherited">
<a name="labeltkey" class="tsd-anchor"></a>
<h3>labelTKey</h3>
<div class="tsd-signature tsd-kind-icon">labelTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
<aside class="tsd-sources">
<p>Inherited from InputOptionsBase.labelTKey</p>
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the label of the UI element, from the strings JSON file.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="max" class="tsd-anchor"></a>
<h3>max</h3>
<div class="tsd-signature tsd-kind-icon">max<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">number</span><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">number</span><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Max value of the numeric input UI element</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="min" class="tsd-anchor"></a>
<h3>min</h3>
<div class="tsd-signature tsd-kind-icon">min<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">number</span><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">number</span><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Min value of the numeric input UI element</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="step" class="tsd-anchor"></a>
<h3>step</h3>
<div class="tsd-signature tsd-kind-icon">step<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">number</span><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">number</span><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Value by which the numeric input is incremented or decremented in the UI.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="uitype" class="tsd-anchor"></a>
<h3>ui<wbr>Type</h3>
<div class="tsd-signature tsd-kind-icon">ui<wbr>Type<span class="tsd-signature-symbol">:</span> <a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-signature-type" data-tsd-kind="Enumeration">NumberUiType</a></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>The type of the numeric input UI element</p>
</div>
</div>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class="current tsd-kind-module">
<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.booleaninputoptions.html" class="tsd-kind-icon">Boolean<wbr>Input<wbr>Options</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.choiceinputoptions.html" class="tsd-kind-icon">Choice<wbr>Input<wbr>Options</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.descriptiondisplayoptions.html" class="tsd-kind-icon">Description<wbr>Display<wbr>Options</a>
</li>
</ul>
<ul class="current">
<li class="current tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.numberinputoptions.html" class="tsd-kind-icon">Number<wbr>Input<wbr>Options</a>
<ul>
<li class=" tsd-kind-property tsd-parent-kind-interface tsd-is-inherited">
<a href="selfserve_decorators.numberinputoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_decorators.numberinputoptions.html#max" class="tsd-kind-icon">max</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_decorators.numberinputoptions.html#min" class="tsd-kind-icon">min</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_decorators.numberinputoptions.html#step" class="tsd-kind-icon">step</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_decorators.numberinputoptions.html#uitype" class="tsd-kind-icon">ui<wbr>Type</a>
</li>
</ul>
</li>
</ul>
<ul class="after-current">
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.stringinputoptions.html" class="tsd-kind-icon">String<wbr>Input<wbr>Options</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#inputoptions" class="tsd-kind-icon">Input<wbr>Options</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#isdisplayable" class="tsd-kind-icon">Is<wbr>Displayable</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#onchange" class="tsd-kind-icon">On<wbr>Change</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#propertyinfo" class="tsd-kind-icon">Property<wbr>Info</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#refreshoptions" class="tsd-kind-icon">Refresh<wbr>Options</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#values" class="tsd-kind-icon">Values</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,239 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>StringInputOptions | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="../modules/selfserve_decorators.html">SelfServe/Decorators</a>
</li>
<li>
<a href="selfserve_decorators.stringinputoptions.html">StringInputOptions</a>
</li>
</ul>
<h1>Interface StringInputOptions</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel tsd-comment">
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Text box is rendered.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-hierarchy">
<h3>Hierarchy</h3>
<ul class="tsd-hierarchy">
<li>
<span class="tsd-signature-type">InputOptionsBase</span>
<ul class="tsd-hierarchy">
<li>
<span class="target">StringInputOptions</span>
</li>
</ul>
</li>
</ul>
</section>
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Properties</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-property tsd-parent-kind-interface tsd-is-inherited"><a href="selfserve_decorators.stringinputoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_decorators.stringinputoptions.html#placeholdertkey" class="tsd-kind-icon">placeholderTKey</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Properties</h2>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface tsd-is-inherited">
<a name="labeltkey" class="tsd-anchor"></a>
<h3>labelTKey</h3>
<div class="tsd-signature tsd-kind-icon">labelTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
<aside class="tsd-sources">
<p>Inherited from InputOptionsBase.labelTKey</p>
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the label of the UI element, from the strings JSON file.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="placeholdertkey" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagOptional">Optional</span> placeholderTKey</h3>
<div class="tsd-signature tsd-kind-icon">placeholderTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the place holder text of the text box, from the strings JSON file.</p>
</div>
</div>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class="current tsd-kind-module">
<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.booleaninputoptions.html" class="tsd-kind-icon">Boolean<wbr>Input<wbr>Options</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.choiceinputoptions.html" class="tsd-kind-icon">Choice<wbr>Input<wbr>Options</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.descriptiondisplayoptions.html" class="tsd-kind-icon">Description<wbr>Display<wbr>Options</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.numberinputoptions.html" class="tsd-kind-icon">Number<wbr>Input<wbr>Options</a>
</li>
</ul>
<ul class="current">
<li class="current tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_decorators.stringinputoptions.html" class="tsd-kind-icon">String<wbr>Input<wbr>Options</a>
<ul>
<li class=" tsd-kind-property tsd-parent-kind-interface tsd-is-inherited">
<a href="selfserve_decorators.stringinputoptions.html#labeltkey" class="tsd-kind-icon">labelTKey</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_decorators.stringinputoptions.html#placeholdertkey" class="tsd-kind-icon">placeholderTKey</a>
</li>
</ul>
</li>
</ul>
<ul class="after-current">
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#inputoptions" class="tsd-kind-icon">Input<wbr>Options</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#isdisplayable" class="tsd-kind-icon">Is<wbr>Displayable</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#onchange" class="tsd-kind-icon">On<wbr>Change</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#propertyinfo" class="tsd-kind-icon">Property<wbr>Info</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#refreshoptions" class="tsd-kind-icon">Refresh<wbr>Options</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="../modules/selfserve_decorators.html#values" class="tsd-kind-icon">Values</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,277 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>Description | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
</li>
<li>
<a href="selfserve_selfservetypes.description.html">Description</a>
</li>
</ul>
<h1>Interface Description</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel tsd-comment">
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Data to be shown as a description.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-hierarchy">
<h3>Hierarchy</h3>
<ul class="tsd-hierarchy">
<li>
<span class="target">Description</span>
</li>
</ul>
</section>
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Properties</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.description.html#link" class="tsd-kind-icon">link</a></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.description.html#texttkey-1" class="tsd-kind-icon">textTKey</a></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.description.html#type" class="tsd-kind-icon">type</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Properties</h2>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="link" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagOptional">Optional</span> link</h3>
<div class="tsd-signature tsd-kind-icon">link<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">{ </span>href<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">; </span>textTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> }</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Optional link to be shown as part of the description, after the text.</p>
</div>
</div>
<div class="tsd-type-declaration">
<h4>Type declaration</h4>
<ul class="tsd-parameters">
<li class="tsd-parameter">
<h5>href<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>The URL of the link</p>
</div>
</div>
</li>
<li class="tsd-parameter">
<h5>textTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the text of the link, from the strings JSON file.</p>
</div>
</div>
</li>
</ul>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="texttkey-1" class="tsd-anchor"></a>
<h3>textTKey</h3>
<div class="tsd-signature tsd-kind-icon">textTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the text to be shown as part of the description, from the strings JSON file.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="type" class="tsd-anchor"></a>
<h3>type</h3>
<div class="tsd-signature tsd-kind-icon">type<span class="tsd-signature-symbol">:</span> <a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-signature-type" data-tsd-kind="Enumeration">DescriptionType</a></div>
<aside class="tsd-sources">
</aside>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class="current tsd-kind-module">
<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
</li>
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
</li>
<li class=" tsd-kind-class tsd-parent-kind-module">
<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
</li>
</ul>
<ul class="current">
<li class="current tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
<ul>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_selfservetypes.description.html#link" class="tsd-kind-icon">link</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_selfservetypes.description.html#texttkey-1" class="tsd-kind-icon">textTKey</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_selfservetypes.description.html#type" class="tsd-kind-icon">type</a>
</li>
</ul>
</li>
</ul>
<ul class="after-current">
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,266 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>Info | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
</li>
<li>
<a href="selfserve_selfservetypes.info.html">Info</a>
</li>
</ul>
<h1>Interface Info</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel tsd-comment">
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Data to be shown within the info bubble of the property.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-hierarchy">
<h3>Hierarchy</h3>
<ul class="tsd-hierarchy">
<li>
<span class="target">Info</span>
</li>
</ul>
</section>
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Properties</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.info.html#link" class="tsd-kind-icon">link</a></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.info.html#messagetkey" class="tsd-kind-icon">messageTKey</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Properties</h2>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="link" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagOptional">Optional</span> link</h3>
<div class="tsd-signature tsd-kind-icon">link<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">{ </span>href<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">; </span>textTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> }</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Optional link to be shown within the info bubble, after the text.</p>
</div>
</div>
<div class="tsd-type-declaration">
<h4>Type declaration</h4>
<ul class="tsd-parameters">
<li class="tsd-parameter">
<h5>href<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>The URL of the link</p>
</div>
</div>
</li>
<li class="tsd-parameter">
<h5>textTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the text of the link, from the strings JSON file.</p>
</div>
</div>
</li>
</ul>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="messagetkey" class="tsd-anchor"></a>
<h3>messageTKey</h3>
<div class="tsd-signature tsd-kind-icon">messageTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the text to be shown within the info bubble, from the strings JSON file.</p>
</div>
</div>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class="current tsd-kind-module">
<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
</li>
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
</li>
<li class=" tsd-kind-class tsd-parent-kind-module">
<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
</li>
</ul>
<ul class="current">
<li class="current tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
<ul>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_selfservetypes.info.html#link" class="tsd-kind-icon">link</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_selfservetypes.info.html#messagetkey" class="tsd-kind-icon">messageTKey</a>
</li>
</ul>
</li>
</ul>
<ul class="after-current">
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,321 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>OnSaveResult | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
</li>
<li>
<a href="selfserve_selfservetypes.onsaveresult.html">OnSaveResult</a>
</li>
</ul>
<h1>Interface OnSaveResult</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel tsd-hierarchy">
<h3>Hierarchy</h3>
<ul class="tsd-hierarchy">
<li>
<span class="target">OnSaveResult</span>
</li>
</ul>
</section>
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Properties</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.onsaveresult.html#operationstatusurl" class="tsd-kind-icon">operation<wbr>Status<wbr>Url</a></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.onsaveresult.html#portalnotification" class="tsd-kind-icon">portal<wbr>Notification</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Properties</h2>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="operationstatusurl" class="tsd-anchor"></a>
<h3>operation<wbr>Status<wbr>Url</h3>
<div class="tsd-signature tsd-kind-icon">operation<wbr>Status<wbr>Url<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>The polling url returned by the RP call.</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="portalnotification" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagOptional">Optional</span> portal<wbr>Notification</h3>
<div class="tsd-signature tsd-kind-icon">portal<wbr>Notification<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">{ </span>failure<span class="tsd-signature-symbol">: </span><span class="tsd-signature-symbol">{ </span>messageTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">; </span>titleTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> }</span><span class="tsd-signature-symbol">; </span>initialize<span class="tsd-signature-symbol">: </span><span class="tsd-signature-symbol">{ </span>messageTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">; </span>titleTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> }</span><span class="tsd-signature-symbol">; </span>success<span class="tsd-signature-symbol">: </span><span class="tsd-signature-symbol">{ </span>messageTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">; </span>titleTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> }</span><span class="tsd-signature-symbol"> }</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Notifications that need to be shown on the portal for different stages of a scenario (initialized, success/failure).</p>
</div>
</div>
<div class="tsd-type-declaration">
<h4>Type declaration</h4>
<ul class="tsd-parameters">
<li class="tsd-parameter">
<h5>failure<span class="tsd-signature-symbol">: </span><span class="tsd-signature-symbol">{ </span>messageTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">; </span>titleTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> }</span></h5>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Notification that need to be shown when the save operation failed.</p>
</div>
</div>
<ul class="tsd-parameters">
<li class="tsd-parameter">
<h5>messageTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the notification message, from the strings JSON file.</p>
</div>
</div>
</li>
<li class="tsd-parameter">
<h5>titleTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the notification title, from the strings JSON file.</p>
</div>
</div>
</li>
</ul>
</li>
<li class="tsd-parameter">
<h5>initialize<span class="tsd-signature-symbol">: </span><span class="tsd-signature-symbol">{ </span>messageTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">; </span>titleTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> }</span></h5>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Notification that need to be shown when the save operation has been triggered.</p>
</div>
</div>
<ul class="tsd-parameters">
<li class="tsd-parameter">
<h5>messageTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the notification message, from the strings JSON file.</p>
</div>
</div>
</li>
<li class="tsd-parameter">
<h5>titleTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the notification title, from the strings JSON file.</p>
</div>
</div>
</li>
</ul>
</li>
<li class="tsd-parameter">
<h5>success<span class="tsd-signature-symbol">: </span><span class="tsd-signature-symbol">{ </span>messageTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">; </span>titleTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> }</span></h5>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Notification that need to be shown when the save operation has successfully completed.</p>
</div>
</div>
<ul class="tsd-parameters">
<li class="tsd-parameter">
<h5>messageTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the notification message, from the strings JSON file.</p>
</div>
</div>
</li>
<li class="tsd-parameter">
<h5>titleTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the notification title, from the strings JSON file.</p>
</div>
</div>
</li>
</ul>
</li>
</ul>
</div>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class="current tsd-kind-module">
<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
</li>
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
</li>
<li class=" tsd-kind-class tsd-parent-kind-module">
<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
</li>
</ul>
<ul class="current">
<li class="current tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
<ul>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_selfservetypes.onsaveresult.html#operationstatusurl" class="tsd-kind-icon">operation<wbr>Status<wbr>Url</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_selfservetypes.onsaveresult.html#portalnotification" class="tsd-kind-icon">portal<wbr>Notification</a>
</li>
</ul>
</li>
</ul>
<ul class="after-current">
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,222 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>RefreshParams | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
</li>
<li>
<a href="selfserve_selfservetypes.refreshparams.html">RefreshParams</a>
</li>
</ul>
<h1>Interface RefreshParams</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel tsd-hierarchy">
<h3>Hierarchy</h3>
<ul class="tsd-hierarchy">
<li>
<span class="target">RefreshParams</span>
</li>
</ul>
</section>
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Properties</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.refreshparams.html#retryintervalinms" class="tsd-kind-icon">retry<wbr>Interval<wbr>InMs</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Properties</h2>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="retryintervalinms" class="tsd-anchor"></a>
<h3>retry<wbr>Interval<wbr>InMs</h3>
<div class="tsd-signature tsd-kind-icon">retry<wbr>Interval<wbr>InMs<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">number</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>The time interval between refresh attempts when an update in ongoing</p>
</div>
</div>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class="current tsd-kind-module">
<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
</li>
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
</li>
<li class=" tsd-kind-class tsd-parent-kind-module">
<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
</li>
</ul>
<ul class="current">
<li class="current tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
<ul>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_selfservetypes.refreshparams.html#retryintervalinms" class="tsd-kind-icon">retry<wbr>Interval<wbr>InMs</a>
</li>
</ul>
</li>
</ul>
<ul class="after-current">
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,239 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>RefreshResult | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
</li>
<li>
<a href="selfserve_selfservetypes.refreshresult.html">RefreshResult</a>
</li>
</ul>
<h1>Interface RefreshResult</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel tsd-hierarchy">
<h3>Hierarchy</h3>
<ul class="tsd-hierarchy">
<li>
<span class="target">RefreshResult</span>
</li>
</ul>
</section>
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Properties</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.refreshresult.html#isupdateinprogress" class="tsd-kind-icon">is<wbr>Update<wbr>InProgress</a></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.refreshresult.html#updateinprogressmessagetkey" class="tsd-kind-icon">update<wbr>InProgress<wbr>MessageTKey</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Properties</h2>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="isupdateinprogress" class="tsd-anchor"></a>
<h3>is<wbr>Update<wbr>InProgress</h3>
<div class="tsd-signature tsd-kind-icon">is<wbr>Update<wbr>InProgress<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">boolean</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Indicate if the update is still ongoing</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="updateinprogressmessagetkey" class="tsd-anchor"></a>
<h3>update<wbr>InProgress<wbr>MessageTKey</h3>
<div class="tsd-signature tsd-kind-icon">update<wbr>InProgress<wbr>MessageTKey<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the message that will be shown on the UI if the update is still ongoing, from the strings JSON file.
Will be shown only if <a href="selfserve_selfservetypes.refreshresult.html#isupdateinprogress"><code>isUpdateInProgress</code></a> is true.</p>
</div>
</div>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class="current tsd-kind-module">
<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
</li>
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
</li>
<li class=" tsd-kind-class tsd-parent-kind-module">
<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
</li>
</ul>
<ul class="current">
<li class="current tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
<ul>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_selfservetypes.refreshresult.html#isupdateinprogress" class="tsd-kind-icon">is<wbr>Update<wbr>InProgress</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_selfservetypes.refreshresult.html#updateinprogressmessagetkey" class="tsd-kind-icon">update<wbr>InProgress<wbr>MessageTKey</a>
</li>
</ul>
</li>
</ul>
<ul class="after-current">
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,227 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>SelfServeTelemetryMessage | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
</li>
<li>
<a href="selfserve_selfservetypes.selfservetelemetrymessage.html">SelfServeTelemetryMessage</a>
</li>
</ul>
<h1>Interface SelfServeTelemetryMessage</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel tsd-hierarchy">
<h3>Hierarchy</h3>
<ul class="tsd-hierarchy">
<li>
<span class="tsd-signature-type">TelemetryData</span>
<ul class="tsd-hierarchy">
<li>
<span class="target">SelfServeTelemetryMessage</span>
</li>
</ul>
</li>
</ul>
</section>
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Properties</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.selfservetelemetrymessage.html#selfserveclassname" class="tsd-kind-icon">self<wbr>Serve<wbr>Class<wbr>Name</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Properties</h2>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="selfserveclassname" class="tsd-anchor"></a>
<h3>self<wbr>Serve<wbr>Class<wbr>Name</h3>
<div class="tsd-signature tsd-kind-icon">self<wbr>Serve<wbr>Class<wbr>Name<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">string</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>The className used to identify a SelfServe telemetry record</p>
</div>
</div>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class="current tsd-kind-module">
<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
</li>
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
</li>
<li class=" tsd-kind-class tsd-parent-kind-module">
<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
</li>
</ul>
<ul class="current">
<li class="current tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
<ul>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_selfservetypes.selfservetelemetrymessage.html#selfserveclassname" class="tsd-kind-icon">self<wbr>Serve<wbr>Class<wbr>Name</a>
</li>
</ul>
</li>
</ul>
<ul class="after-current">
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,254 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>SmartUiInput | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="../modules/selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
</li>
<li>
<a href="selfserve_selfservetypes.smartuiinput.html">SmartUiInput</a>
</li>
</ul>
<h1>Interface SmartUiInput</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel tsd-hierarchy">
<h3>Hierarchy</h3>
<ul class="tsd-hierarchy">
<li>
<span class="target">SmartUiInput</span>
</li>
</ul>
</section>
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Properties</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.smartuiinput.html#disabled" class="tsd-kind-icon">disabled</a></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.smartuiinput.html#hidden" class="tsd-kind-icon">hidden</a></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><a href="selfserve_selfservetypes.smartuiinput.html#value" class="tsd-kind-icon">value</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Properties</h2>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="disabled" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagOptional">Optional</span> disabled</h3>
<div class="tsd-signature tsd-kind-icon">disabled<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">boolean</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Indicates whether the UI element corresponding to the property is disabled</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="hidden" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagOptional">Optional</span> hidden</h3>
<div class="tsd-signature tsd-kind-icon">hidden<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">boolean</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Indicates whether the UI element corresponding to the property is hidden</p>
</div>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-property tsd-parent-kind-interface">
<a name="value" class="tsd-anchor"></a>
<h3>value</h3>
<div class="tsd-signature tsd-kind-icon">value<span class="tsd-signature-symbol">:</span> <a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-signature-type" data-tsd-kind="Type alias">InputType</a></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>The value to be set for the UI element corresponding to the property</p>
</div>
</div>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class="current tsd-kind-module">
<a href="../modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="../modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
</li>
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
</li>
<li class=" tsd-kind-class tsd-parent-kind-module">
<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
</li>
</ul>
<ul class="current">
<li class="current tsd-kind-interface tsd-parent-kind-module">
<a href="selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
<ul>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_selfservetypes.smartuiinput.html#disabled" class="tsd-kind-icon">disabled</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_selfservetypes.smartuiinput.html#hidden" class="tsd-kind-icon">hidden</a>
</li>
<li class=" tsd-kind-property tsd-parent-kind-interface">
<a href="selfserve_selfservetypes.smartuiinput.html#value" class="tsd-kind-icon">value</a>
</li>
</ul>
</li>
</ul>
<ul class="after-current">
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="../modules/selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
<li class="tsd-kind-property tsd-parent-kind-interface"><span class="tsd-kind-icon">Property</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

138
docs/modules.html Normal file
View File

@@ -0,0 +1,138 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="assets/css/main.css">
<script async src="assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="assets/js/search.json" data-base=".">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<h1>cosmos-explorer</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Modules</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-module"><a href="modules/selfserve.html" class="tsd-kind-icon">Self<wbr>Serve</a></li>
<li class="tsd-kind-module"><a href="modules/selfserve___what_is_currently_supported_.html" class="tsd-kind-icon">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a></li>
<li class="tsd-kind-module"><a href="modules/selfserve_decorators.html" class="tsd-kind-icon">Self<wbr>Serve/<wbr>Decorators</a></li>
<li class="tsd-kind-module"><a href="modules/selfserve_selfservetelemetryprocessor.html" class="tsd-kind-icon">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a></li>
<li class="tsd-kind-module"><a href="modules/selfserve_selfservetypes.html" class="tsd-kind-icon">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a></li>
<li class="tsd-kind-module"><a href="modules/selfserve_selfserveutils.html" class="tsd-kind-icon">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a></li>
</ul>
</section>
</div>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class="current ">
<a href="modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="modules/selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="modules/selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class=" tsd-kind-module">
<a href="modules/selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="modules/selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class=" tsd-kind-module">
<a href="modules/selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="modules/selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="assets/js/main.js"></script>
</body>
</html>

498
docs/modules/selfserve.html Normal file
View File

@@ -0,0 +1,498 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>SelfServe | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="selfserve.html">SelfServe</a>
</li>
</ul>
<h1>Module SelfServe</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel tsd-comment">
<div class="tsd-comment tsd-typography">
<div class="lead">
<a href="#self-serve-model" id="self-serve-model" style="color: inherit; text-decoration: none;">
<h1>Self Serve Model</h1>
</a>
<p>The Self Serve Model allows you to write classes that auto generate UI components for your feature. The idea is to allow developers from other feature teams, who may not be familiar with writing UI, to develop and own UX components. This is accomplished by just writing simpler TypeScript classes for their features. </p>
<p>What this means for the feature team </p>
<ul>
<li>Can concentrate just on the logic behind showing, hiding and disabling UI components </li>
<li>Need not worry about specifics of the UI language or UX requirements (Accessibility, Localization, Themes, etc.)</li>
<li>Can own the REST API calls made as part of the feature, which can change in the future</li>
<li>Quicker turn around time for development and bug fixes since they have deeper knowledge of the feature</li>
</ul>
<p>What this means for the UI team</p>
<ul>
<li>No need to ramp up on the intricacies of every feature which requires UI changes</li>
<li>Own only the framework and not every feature, giving more bandwidth to prioritize inhouse features as well</li>
</ul>
<a href="#getting-started" id="getting-started" style="color: inherit; text-decoration: none;">
<h2>Getting Started</h2>
</a>
<p>Clone the cosmos-explorer repo and run</p>
<ul>
<li><code>npm install</code></li>
<li><code>npm run build</code></li>
</ul>
<p><a href="../index.html">Click here</a> for more info on setting up the cosmos-explorer repo.</p>
<a href="#code-changes" id="code-changes" style="color: inherit; text-decoration: none;">
<h2>Code Changes</h2>
</a>
<p>Code changes need to be made only in the following files</p>
<ul>
<li>A JSON file - for strings to be displayed</li>
<li>A Types File - for defining the data models</li>
<li>A RP file - for defining the REST calls</li>
<li>A Class file - for defining the UI</li>
<li><a href="https://github.com/Azure/cosmos-explorer/blob/master/src/SelfServe/SelfServeUtils.tsx">SelfServeUtils.tsx</a> and <a href="https://github.com/Azure/cosmos-explorer/blob/master/src/SelfServe/SelfServe.tsx">SelfServe.tsx</a> - for defning the entrypoint for the UI</li>
</ul>
<a href="#1-json-file-for-ui-strings" id="1-json-file-for-ui-strings" style="color: inherit; text-decoration: none;">
<h3>1. JSON file for UI strings</h3>
</a>
<a href="#naming-convention" id="naming-convention" style="color: inherit; text-decoration: none;">
<h4>Naming Convention</h4>
</a>
<p><code>Localization/en/&lt;FEATURE_NAME&gt;.json</code><br>Please place your files only under &quot;Localization/en&quot; folder. If not, the UI strings will not be picked up by the framework.</p>
<a href="#example" id="example" style="color: inherit; text-decoration: none;">
<h4>Example</h4>
</a>
<p><a href="https://github.com/Azure/cosmos-explorer/blob/master/src/Localization/en/SelfServeExample.json">SelfServeExample.json</a></p>
<a href="#description" id="description" style="color: inherit; text-decoration: none;">
<h4>Description</h4>
</a>
<p>This is a JSON file where the values are the strings that needs to be displayed in the UI. These strings are referenced using their corresponding unique keys.</p>
<p>For example, If your class file defines properties as follows</p>
<pre><code class="language-ts"><span style="color: #000000"> @</span><span style="color: #795E26">Values</span><span style="color: #000000">({</span>
<span style="color: #000000"> </span><span style="color: #001080">labelTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;stringPropertylabel&quot;</span>
<span style="color: #000000"> })</span>
<span style="color: #000000"> stringProperty: </span><span style="color: #001080">string</span><span style="color: #000000">;</span>
<span style="color: #000000"> @</span><span style="color: #795E26">Values</span><span style="color: #000000">({</span>
<span style="color: #000000"> </span><span style="color: #001080">labelTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;booleanPropertyLabel&quot;</span><span style="color: #000000">,</span>
<span style="color: #000000"> </span><span style="color: #001080">trueLabelTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;trueLabel&quot;</span><span style="color: #000000">,</span>
<span style="color: #000000"> </span><span style="color: #001080">falseLabelTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;falseLabel&quot;</span><span style="color: #000000">,</span>
<span style="color: #000000"> })</span>
<span style="color: #000000"> booleanProperty: </span><span style="color: #001080">boolean</span><span style="color: #000000">;</span>
</code></pre>
<p>Then the content of <code>Localization/en/FeatureName.json</code> should be </p>
<pre><code class="language-json"><span style="color: #000000">{</span>
<span style="color: #000000"> </span><span style="color: #CD3131">stringPropertyLabel</span><span style="color: #000000">: </span><span style="color: #A31515">&quot;string property&quot;</span><span style="color: #000000">,</span>
<span style="color: #000000"> </span><span style="color: #CD3131">booleanPropertyLabel</span><span style="color: #000000">: </span><span style="color: #A31515">&quot;boolean property&quot;</span><span style="color: #000000">,</span>
<span style="color: #000000"> </span><span style="color: #CD3131">trueLabel</span><span style="color: #000000">: </span><span style="color: #A31515">&quot;Enable&quot;</span><span style="color: #000000">,</span>
<span style="color: #000000"> </span><span style="color: #CD3131">falseLabel</span><span style="color: #000000">: </span><span style="color: #A31515">&quot;Disable&quot;</span>
<span style="color: #000000">}</span>
</code></pre>
<p>You can learn more on how to define the class file <a href="./selfserve.html#4-class-file">here</a>.</p>
<a href="#2-types-file" id="2-types-file" style="color: inherit; text-decoration: none;">
<h3>2. Types file</h3>
</a>
<a href="#naming-convention-1" id="naming-convention-1" style="color: inherit; text-decoration: none;">
<h4>Naming Convention</h4>
</a>
<p><code>&lt;FEATURE_NAME&gt;.types.ts</code></p>
<a href="#example-1" id="example-1" style="color: inherit; text-decoration: none;">
<h4>Example</h4>
</a>
<p><a href="https://github.com/Azure/cosmos-explorer/blob/master/src/SelfServe/Example/SelfServeExample.types.ts">SelfServeExample.types.ts</a></p>
<a href="#description-1" id="description-1" style="color: inherit; text-decoration: none;">
<h4>Description</h4>
</a>
<p>This file contains the definitions of all the data models to be used in your Class file and RP file.</p>
<p>For example, if your RP call takes/returns the <code>stringProperty</code> and <code>booleanProperty</code> of your SelfServe class, then you can define an interface in your <code>FeatureName.types.ts</code> file like this.</p>
<pre><code class="language-ts"><span style="color: #AF00DB">export</span><span style="color: #000000"> </span><span style="color: #001080">RpDataModel</span><span style="color: #000000"> {</span>
<span style="color: #000000"> </span><span style="color: #001080">stringProperty</span><span style="color: #000000">: </span><span style="color: #001080">string</span><span style="color: #000000">,</span>
<span style="color: #000000"> </span><span style="color: #001080">booleanProperty</span><span style="color: #000000">: </span><span style="color: #001080">boolean</span>
<span style="color: #000000">}</span>
</code></pre>
<a href="#3-rp-file" id="3-rp-file" style="color: inherit; text-decoration: none;">
<h3>3. RP file</h3>
</a>
<a href="#naming-convention-2" id="naming-convention-2" style="color: inherit; text-decoration: none;">
<h4>Naming Convention</h4>
</a>
<p><code>&lt;FEATURE_NAME&gt;.rp.ts</code></p>
<a href="#example-2" id="example-2" style="color: inherit; text-decoration: none;">
<h4>Example</h4>
</a>
<p><a href="https://github.com/Azure/cosmos-explorer/blob/master/src/SelfServe/Example/SelfServeExample.rp.ts">SelfServeExample.rp.ts</a></p>
<a href="#description-2" id="description-2" style="color: inherit; text-decoration: none;">
<h4>Description</h4>
</a>
<p>The RP file will host the REST calls needed for the initialize, save and refresh functions. This decouples the view and the model of the feature.</p>
<p>To make the ARM call, we need some information about the Azure Cosmos DB databaseAccount - the subscription id, resource group name and database account name. These are readily available through the <code>userContext</code> object, exposed through</p>
<ul>
<li><code>userContext.subscriptionId</code></li>
<li><code>userContext.resourceGroup</code></li>
<li><code>userContext.databaseAccount.name</code></li>
</ul>
<p>You can use the <code>armRequestWithoutPolling</code> function to make the ARM api call.</p>
<p>Your <code>FeatureName.rp.ts</code> file can look like the following.</p>
<pre><code class="language-ts"><span style="color: #AF00DB">import</span><span style="color: #000000"> { </span><span style="color: #001080">userContext</span><span style="color: #000000"> } </span><span style="color: #AF00DB">from</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;../../UserContext&quot;</span><span style="color: #000000">;</span>
<span style="color: #AF00DB">import</span><span style="color: #000000"> { </span><span style="color: #001080">armRequestWithoutPolling</span><span style="color: #000000"> } </span><span style="color: #AF00DB">from</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;../../Utils/arm/request&quot;</span><span style="color: #000000">;</span>
<span style="color: #AF00DB">import</span><span style="color: #000000"> { </span><span style="color: #001080">configContext</span><span style="color: #000000"> } </span><span style="color: #AF00DB">from</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;../../ConfigContext&quot;</span><span style="color: #000000">;</span>
<span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">apiVersion</span><span style="color: #000000"> = </span><span style="color: #A31515">&quot;2020-06-01-preview&quot;</span><span style="color: #000000">;</span>
<span style="color: #AF00DB">export</span><span style="color: #000000"> </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #795E26">saveData</span><span style="color: #000000"> = </span><span style="color: #0000FF">async</span><span style="color: #000000"> (</span><span style="color: #001080">properties</span><span style="color: #000000">: </span><span style="color: #267F99">RpDataModel</span><span style="color: #000000">): </span><span style="color: #267F99">Promise</span><span style="color: #000000">&lt;</span><span style="color: #267F99">string</span><span style="color: #000000">&gt; </span><span style="color: #0000FF">=&gt;</span><span style="color: #000000"> {</span>
<span style="color: #000000"> </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">path</span><span style="color: #000000"> = </span><span style="color: #A31515">`/subscriptions/</span><span style="color: #0000FF">${</span><span style="color: #001080">userContext</span><span style="color: #000000FF">.</span><span style="color: #001080">subscriptionId</span><span style="color: #0000FF">}</span><span style="color: #A31515">/resourceGroups/</span><span style="color: #0000FF">${</span><span style="color: #001080">userContext</span><span style="color: #000000FF">.</span><span style="color: #001080">resourceGroup</span><span style="color: #0000FF">}</span><span style="color: #A31515">/providers/Microsoft.DocumentDB/databaseAccounts/</span><span style="color: #0000FF">${</span><span style="color: #001080">userContext</span><span style="color: #000000FF">.</span><span style="color: #001080">databaseAccount</span><span style="color: #000000FF">.</span><span style="color: #001080">name</span><span style="color: #0000FF">}</span><span style="color: #A31515">/&lt;REST_OF_THE_PATH&gt;`</span>
<span style="color: #000000"> </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">body</span><span style="color: #000000"> = {</span>
<span style="color: #000000"> </span><span style="color: #001080">data :</span><span style="color: #000000"> </span><span style="color: #001080">properties</span>
<span style="color: #000000"> }</span>
<span style="color: #000000"> </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">armRequestResult</span><span style="color: #000000"> = </span><span style="color: #AF00DB">await</span><span style="color: #000000"> </span><span style="color: #795E26">armRequestWithoutPolling</span><span style="color: #000000">({</span>
<span style="color: #000000"> </span><span style="color: #001080">host:</span><span style="color: #000000"> </span><span style="color: #001080">configContext</span><span style="color: #000000">.</span><span style="color: #0070C1">ARM_ENDPOINT</span><span style="color: #000000">,</span>
<span style="color: #000000"> </span><span style="color: #001080">path</span><span style="color: #000000">,</span>
<span style="color: #000000"> </span><span style="color: #001080">method:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;PUT&quot;</span><span style="color: #000000">,</span>
<span style="color: #000000"> </span><span style="color: #001080">apiVersion</span><span style="color: #000000">,</span>
<span style="color: #000000"> </span><span style="color: #001080">body</span><span style="color: #000000">,</span>
<span style="color: #000000"> });</span>
<span style="color: #000000"> </span><span style="color: #AF00DB">return</span><span style="color: #000000"> </span><span style="color: #001080">armRequestResult</span><span style="color: #000000">.</span><span style="color: #001080">operationStatusUrl</span><span style="color: #000000">;</span>
<span style="color: #000000">};</span>
</code></pre>
<a href="#4-class-file" id="4-class-file" style="color: inherit; text-decoration: none;">
<h3>4. Class file</h3>
</a>
<a href="#naming-convention-3" id="naming-convention-3" style="color: inherit; text-decoration: none;">
<h4>Naming Convention</h4>
</a>
<p><code>&lt;FEATURE_NAME&gt;.tsx</code></p>
<a href="#example-3" id="example-3" style="color: inherit; text-decoration: none;">
<h4>Example</h4>
</a>
<p><a href="https://github.com/Azure/cosmos-explorer/blob/master/src/SelfServe/Example/SelfServeExample.tsx">SelfServeExample.tsx</a></p>
<a href="#description-3" id="description-3" style="color: inherit; text-decoration: none;">
<h4>Description</h4>
</a>
<p>This file will contain the actual code that is translated into the UI component by the Self Serve framework.</p>
<ul>
<li><p>Each Self Serve class</p>
<ul>
<li>Needs to extends the <a href="../classes/selfserve_selfservetypes.selfservebaseclass.html">SelfServeBase</a> class.</li>
<li>Needs to have the <a href="./selfserve_decorators.html#isdisplayable">@IsDisplayable()</a> decorator to tell the compiler that UI needs to be generated from this class.</li>
<li>Needs to define an <a href="../classes/selfserve_selfservetypes.selfservebaseclass.html#initialize">initialize()</a> function, to set default values for the inputs.</li>
<li>Needs to define an <a href="../classes/selfserve_selfservetypes.selfservebaseclass.html#onsave">onSave()</a> function, a callback for when the save button is clicked.</li>
<li>Needs to define an <a href="../classes/selfserve_selfservetypes.selfservebaseclass.html#onrefresh">onRefresh()</a> function, a callback for when the refresh button is clicked.</li>
<li>Can have an optional <a href="./selfserve_decorators.html#refreshoptions">@RefreshOptions()</a> decorator that determines how often the auto refresh of the UI component should take place.</li>
</ul>
</li>
<li><p>For every UI element needed, add a property to the Self Serve class. Each of these properties</p>
<ul>
<li>Needs to have a <a href="./selfserve_decorators.html#values">@Values()</a> decorator.</li>
<li>Can have an optional <a href="./selfserve_decorators.html#propertyinfo">@PropertyInfo()</a> decorator that describes it&#39;s info bubble.</li>
<li>Can have an optional <a href="./selfserve_decorators.html#onchange">@OnChange()</a> decorator that dictates the effects of the change of the UI element tied to this property.</li>
</ul>
</li>
</ul>
<p>Your <code>FeatureName.tsx</code> file will look like the following.</p>
<pre><code class="language-ts"><span style="color: #000000">@</span><span style="color: #795E26">IsDisplayable</span><span style="color: #000000">()</span>
<span style="color: #000000">@</span><span style="color: #795E26">RefreshOptions</span><span style="color: #000000">({ </span><span style="color: #001080">retryIntervalInMs:</span><span style="color: #000000"> </span><span style="color: #098658">2000</span><span style="color: #000000"> })</span>
<span style="color: #AF00DB">export</span><span style="color: #000000"> </span><span style="color: #AF00DB">default</span><span style="color: #000000"> </span><span style="color: #0000FF">class</span><span style="color: #000000"> </span><span style="color: #267F99">FeatureName</span><span style="color: #000000"> </span><span style="color: #0000FF">extends</span><span style="color: #000000"> </span><span style="color: #267F99">SelfServeBaseClass</span><span style="color: #000000"> {</span>
<span style="color: #000000"> </span><span style="color: #0000FF">public</span><span style="color: #000000"> </span><span style="color: #795E26">initialize</span><span style="color: #000000"> = </span><span style="color: #0000FF">async</span><span style="color: #000000"> (): </span><span style="color: #267F99">Promise</span><span style="color: #000000">&lt;</span><span style="color: #267F99">Map</span><span style="color: #000000">&lt;</span><span style="color: #267F99">string</span><span style="color: #000000">, </span><span style="color: #267F99">SmartUiInput</span><span style="color: #000000">&gt;&gt; </span><span style="color: #0000FF">=&gt;</span><span style="color: #000000"> {</span>
<span style="color: #000000"> </span><span style="color: #008000">// initialize RP call and processing logic</span>
<span style="color: #000000"> }</span>
<span style="color: #000000"> </span><span style="color: #0000FF">public</span><span style="color: #000000"> </span><span style="color: #795E26">onSave</span><span style="color: #000000"> = </span><span style="color: #0000FF">async</span><span style="color: #000000"> (</span>
<span style="color: #000000"> </span><span style="color: #001080">currentValues</span><span style="color: #000000">: </span><span style="color: #267F99">Map</span><span style="color: #000000">&lt;</span><span style="color: #267F99">string</span><span style="color: #000000">, </span><span style="color: #267F99">SmartUiInput</span><span style="color: #000000">&gt;,</span>
<span style="color: #000000"> </span><span style="color: #001080">baselineValues</span><span style="color: #000000">: </span><span style="color: #267F99">ReadonlyMap</span><span style="color: #000000">&lt;</span><span style="color: #267F99">string</span><span style="color: #000000">, </span><span style="color: #267F99">SmartUiInput</span><span style="color: #000000">&gt;</span>
<span style="color: #000000"> ): </span><span style="color: #267F99">Promise</span><span style="color: #000000">&lt;</span><span style="color: #267F99">OnSaveResult</span><span style="color: #000000">&gt; </span><span style="color: #0000FF">=&gt;</span><span style="color: #000000"> {</span>
<span style="color: #000000"> </span><span style="color: #008000">// onSave RP call and processing logic</span>
<span style="color: #000000"> }</span>
<span style="color: #000000"> </span><span style="color: #0000FF">public</span><span style="color: #000000"> </span><span style="color: #795E26">onRefresh</span><span style="color: #000000"> = </span><span style="color: #0000FF">async</span><span style="color: #000000"> (): </span><span style="color: #267F99">Promise</span><span style="color: #000000">&lt;</span><span style="color: #267F99">RefreshResult</span><span style="color: #000000">&gt; </span><span style="color: #0000FF">=&gt;</span><span style="color: #000000"> {</span>
<span style="color: #000000"> </span><span style="color: #008000">// refresh RP call and processing logic</span>
<span style="color: #000000"> };</span>
<span style="color: #000000"> @</span><span style="color: #795E26">Values</span><span style="color: #000000">(...)</span>
<span style="color: #000000"> </span><span style="color: #001080">stringProperty</span><span style="color: #000000">: </span><span style="color: #267F99">string</span><span style="color: #000000">;</span>
<span style="color: #000000"> @</span><span style="color: #795E26">OnChange</span><span style="color: #000000">(...)</span>
<span style="color: #000000"> @</span><span style="color: #795E26">PropertyInfo</span><span style="color: #000000">(...)</span>
<span style="color: #000000"> @</span><span style="color: #795E26">Values</span><span style="color: #000000">(...)</span>
<span style="color: #000000"> </span><span style="color: #001080">booleanProperty</span><span style="color: #000000">: </span><span style="color: #267F99">boolean</span><span style="color: #000000">;</span>
<span style="color: #000000">}</span>
</code></pre>
<a href="#5-update-selfservetype" id="5-update-selfservetype" style="color: inherit; text-decoration: none;">
<h3>5. Update SelfServeType</h3>
</a>
<p>Once you have written your Self Serve Class, add a corresponding type to <a href="../enums/selfserve_selfserveutils.selfservetype.html">SelfServeType</a></p>
<pre><code class="language-ts"><span style="color: #AF00DB">export</span><span style="color: #000000"> </span><span style="color: #0000FF">enum</span><span style="color: #000000"> </span><span style="color: #267F99">SelfServeType</span><span style="color: #000000"> {</span>
<span style="color: #000000"> </span><span style="color: #0070C1">invalid</span><span style="color: #000000"> = </span><span style="color: #A31515">&quot;invalid&quot;</span><span style="color: #000000">,</span>
<span style="color: #000000"> </span><span style="color: #0070C1">example</span><span style="color: #000000"> = </span><span style="color: #A31515">&quot;example&quot;</span><span style="color: #000000">,</span>
<span style="color: #000000"> ...</span>
<span style="color: #000000"> </span><span style="color: #008000">// Add the type for your new feature</span>
<span style="color: #000000"> </span><span style="color: #0070C1">featureName</span><span style="color: #000000"> = </span><span style="color: #A31515">&quot;featurename&quot;</span>
<span style="color: #000000">}</span>
</code></pre>
<a href="#6-update-selfservetsx-landing-page" id="6-update-selfservetsx-landing-page" style="color: inherit; text-decoration: none;">
<h3>6. Update SelfServe.tsx (landing page)</h3>
</a>
<p>Once the SelfServeType has been updated, update <a href="https://github.com/Azure/cosmos-explorer/blob/master/src/SelfServe/SelfServe.tsx">SelfServe.tsx</a> for your feature. This ensures that the framework picks up your SelfServe Class.</p>
<pre><code class="language-ts"><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #795E26">getDescriptor</span><span style="color: #000000"> = </span><span style="color: #0000FF">async</span><span style="color: #000000"> (</span><span style="color: #001080">selfServeType</span><span style="color: #000000">: </span><span style="color: #267F99">SelfServeType</span><span style="color: #000000">): </span><span style="color: #267F99">Promise</span><span style="color: #000000">&lt;</span><span style="color: #267F99">SelfServeDescriptor</span><span style="color: #000000">&gt; </span><span style="color: #0000FF">=&gt;</span><span style="color: #000000"> {</span>
<span style="color: #000000"> </span><span style="color: #AF00DB">switch</span><span style="color: #000000"> (</span><span style="color: #001080">selfServeType</span><span style="color: #000000">) {</span>
<span style="color: #000000"> </span><span style="color: #AF00DB">case</span><span style="color: #000000"> </span><span style="color: #001080">SelfServeType</span><span style="color: #000000">.</span><span style="color: #001080">example</span><span style="color: #000000">: {</span>
<span style="color: #000000"> ....</span>
<span style="color: #000000"> }</span>
<span style="color: #000000"> ...</span>
<span style="color: #000000"> ...</span>
<span style="color: #000000"> ...</span>
<span style="color: #000000"> </span><span style="color: #008000">// Add this for your new feature</span>
<span style="color: #000000"> </span><span style="color: #AF00DB">case</span><span style="color: #000000"> </span><span style="color: #001080">SelfServeType</span><span style="color: #000000">.</span><span style="color: #001080">featureName</span><span style="color: #000000">: {</span>
<span style="color: #000000"> </span><span style="color: #008000">// The &#039;webpackChunkName&#039; is used during debugging, to identify if the correct class has been loaded</span>
<span style="color: #000000"> </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">FeatureName</span><span style="color: #000000"> = </span><span style="color: #AF00DB">await</span><span style="color: #000000"> </span><span style="color: #795E26">import</span><span style="color: #000000">(</span><span style="color: #008000">/* webpackChunkName: &quot;FeatureName&quot; */</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;./FeatureName/FeatureName&quot;</span><span style="color: #000000">);</span>
<span style="color: #000000"> </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">featureName</span><span style="color: #000000"> = </span><span style="color: #0000FF">new</span><span style="color: #000000"> </span><span style="color: #001080">FeatureName</span><span style="color: #000000">.</span><span style="color: #795E26">default</span><span style="color: #000000">();</span>
<span style="color: #000000"> </span><span style="color: #AF00DB">await</span><span style="color: #000000"> </span><span style="color: #795E26">loadTranslations</span><span style="color: #000000">(</span><span style="color: #001080">featureName</span><span style="color: #000000">.</span><span style="color: #001080">constructor</span><span style="color: #000000">.</span><span style="color: #001080">name</span><span style="color: #000000">);</span>
<span style="color: #000000"> </span><span style="color: #AF00DB">return</span><span style="color: #000000"> </span><span style="color: #001080">featureName</span><span style="color: #000000">.</span><span style="color: #795E26">toSelfServeDescriptor</span><span style="color: #000000">();</span>
<span style="color: #000000"> }</span>
<span style="color: #000000"> ...</span>
<span style="color: #000000"> ...</span>
<span style="color: #000000"> </span><span style="color: #AF00DB">default</span><span style="color: #000000">:</span>
<span style="color: #000000"> </span><span style="color: #AF00DB">return</span><span style="color: #000000"> </span><span style="color: #0000FF">undefined</span><span style="color: #000000">;</span>
<span style="color: #000000"> }</span>
<span style="color: #000000">};</span>
</code></pre>
<a href="#telemetry" id="telemetry" style="color: inherit; text-decoration: none;">
<h2>Telemetry</h2>
</a>
<p>You can add telemetry for your feature using the functions in <a href="./selfserve_selfservetelemetryprocessor.html">SelfServeTelemetryProcessor</a></p>
<p>For example, in your SelfServe class, you can call the trace method in your <code>onSave</code> function.</p>
<pre><code class="language-ts"><span style="color: #AF00DB">import</span><span style="color: #000000"> { </span><span style="color: #001080">saveData</span><span style="color: #000000"> } </span><span style="color: #AF00DB">from</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;./FeatureName.rp&quot;</span>
<span style="color: #AF00DB">import</span><span style="color: #000000"> { </span><span style="color: #001080">RpDataModel</span><span style="color: #000000"> } </span><span style="color: #AF00DB">from</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;./FeatureName.types&quot;</span>
<span style="color: #000000">@</span><span style="color: #795E26">IsDisplayable</span><span style="color: #000000">()</span>
<span style="color: #AF00DB">export</span><span style="color: #000000"> </span><span style="color: #AF00DB">default</span><span style="color: #000000"> </span><span style="color: #0000FF">class</span><span style="color: #000000"> </span><span style="color: #267F99">FeatureName</span><span style="color: #000000"> </span><span style="color: #0000FF">extends</span><span style="color: #000000"> </span><span style="color: #267F99">SelfServeBaseClass</span><span style="color: #000000"> {</span>
<span style="color: #000000"> .</span>
<span style="color: #000000"> .</span>
<span style="color: #000000"> .</span>
<span style="color: #000000"> </span><span style="color: #0000FF">public</span><span style="color: #000000"> </span><span style="color: #795E26">onSave</span><span style="color: #000000"> = </span><span style="color: #0000FF">async</span><span style="color: #000000"> (</span>
<span style="color: #000000"> </span><span style="color: #001080">currentValues</span><span style="color: #000000">: </span><span style="color: #267F99">Map</span><span style="color: #000000">&lt;</span><span style="color: #267F99">string</span><span style="color: #000000">, </span><span style="color: #267F99">SmartUiInput</span><span style="color: #000000">&gt;,</span>
<span style="color: #000000"> </span><span style="color: #001080">baselineValues</span><span style="color: #000000">: </span><span style="color: #267F99">ReadonlyMap</span><span style="color: #000000">&lt;</span><span style="color: #267F99">string</span><span style="color: #000000">, </span><span style="color: #267F99">SmartUiInput</span><span style="color: #000000">&gt;</span>
<span style="color: #000000"> ): </span><span style="color: #267F99">Promise</span><span style="color: #000000">&lt;</span><span style="color: #267F99">OnSaveResult</span><span style="color: #000000">&gt; </span><span style="color: #0000FF">=&gt;</span><span style="color: #000000"> {</span>
<span style="color: #000000"> </span><span style="color: #001080">stringPropertyValue</span><span style="color: #000000"> = </span><span style="color: #001080">currentValues</span><span style="color: #000000">.</span><span style="color: #795E26">get</span><span style="color: #000000">(</span><span style="color: #A31515">&quot;stringProperty&quot;</span><span style="color: #000000">)</span>
<span style="color: #000000"> </span><span style="color: #001080">booleanPropertyValue</span><span style="color: #000000"> = </span><span style="color: #001080">currentValues</span><span style="color: #000000">.</span><span style="color: #795E26">get</span><span style="color: #000000">(</span><span style="color: #A31515">&quot;booleanProperty&quot;</span><span style="color: #000000">)</span>
<span style="color: #000000"> </span>
<span style="color: #000000"> </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">propertiesToSave</span><span style="color: #000000"> : </span><span style="color: #267F99">RpDataModel</span><span style="color: #000000"> = { </span>
<span style="color: #000000"> </span><span style="color: #001080">stringProperty:</span><span style="color: #000000"> </span><span style="color: #001080">stringPropertyValue</span><span style="color: #000000">,</span>
<span style="color: #000000"> </span><span style="color: #001080">booleanProperty:</span><span style="color: #000000"> </span><span style="color: #001080">booleanPropertyValue</span>
<span style="color: #000000"> }</span>
<span style="color: #000000"> </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">telemetryData</span><span style="color: #000000"> = { ...</span><span style="color: #001080">propertiesToSave</span><span style="color: #000000">, </span><span style="color: #001080">selfServeClassName:</span><span style="color: #000000"> </span><span style="color: #001080">FeatureName</span><span style="color: #000000">.</span><span style="color: #001080">name</span><span style="color: #000000"> }</span>
<span style="color: #000000"> </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">onSaveTimeStamp</span><span style="color: #000000"> = </span><span style="color: #795E26">selfServeTraceStart</span><span style="color: #000000">(</span><span style="color: #001080">telemetryData</span><span style="color: #000000">)</span>
<span style="color: #000000"> </span><span style="color: #AF00DB">await</span><span style="color: #000000"> </span><span style="color: #795E26">saveData</span><span style="color: #000000">(</span><span style="color: #001080">propertiesToSave</span><span style="color: #000000">)</span>
<span style="color: #000000"> </span><span style="color: #795E26">selfServeTraceSuccess</span><span style="color: #000000">(</span><span style="color: #001080">telemetryData</span><span style="color: #000000">, </span><span style="color: #001080">onSaveTimeStamp</span><span style="color: #000000">)</span>
<span style="color: #000000"> </span><span style="color: #008000">// return required values</span>
<span style="color: #000000"> }</span>
<span style="color: #000000"> .</span>
<span style="color: #000000"> .</span>
<span style="color: #000000"> .</span>
<span style="color: #000000"> @</span><span style="color: #795E26">Values</span><span style="color: #000000">(...)</span>
<span style="color: #000000"> </span><span style="color: #001080">stringProperty</span><span style="color: #000000">: </span><span style="color: #267F99">string</span><span style="color: #000000">;</span>
<span style="color: #000000"> @</span><span style="color: #795E26">Values</span><span style="color: #000000">(...)</span>
<span style="color: #000000"> </span><span style="color: #001080">booleanProperty</span><span style="color: #000000">: </span><span style="color: #267F99">boolean</span><span style="color: #000000">;</span>
<span style="color: #000000">}</span>
</code></pre>
<a href="#portal-notifications" id="portal-notifications" style="color: inherit; text-decoration: none;">
<h2>Portal Notifications</h2>
</a>
<p>You can enable portal notifications for your feature by passing in the required strings as part of the <a href="../interfaces/selfserve_selfservetypes.onsaveresult.html#portalnotification">portalNotification</a> property of the <a href="../interfaces/selfserve_selfservetypes.onsaveresult.html">onSaveResult</a>.</p>
<pre><code class="language-ts"><span style="color: #000000">@</span><span style="color: #795E26">IsDisplayable</span><span style="color: #000000">()</span>
<span style="color: #AF00DB">export</span><span style="color: #000000"> </span><span style="color: #AF00DB">default</span><span style="color: #000000"> </span><span style="color: #0000FF">class</span><span style="color: #000000"> </span><span style="color: #267F99">SqlX</span><span style="color: #000000"> </span><span style="color: #0000FF">extends</span><span style="color: #000000"> </span><span style="color: #267F99">SelfServeBaseClass</span><span style="color: #000000"> {</span>
<span style="color: #000000">.</span>
<span style="color: #000000">.</span>
<span style="color: #000000">.</span>
<span style="color: #000000"> </span><span style="color: #0000FF">public</span><span style="color: #000000"> </span><span style="color: #795E26">onSave</span><span style="color: #000000"> = </span><span style="color: #0000FF">async</span><span style="color: #000000"> (</span>
<span style="color: #000000"> </span><span style="color: #001080">currentValues</span><span style="color: #000000">: </span><span style="color: #267F99">Map</span><span style="color: #000000">&lt;</span><span style="color: #267F99">string</span><span style="color: #000000">, </span><span style="color: #267F99">SmartUiInput</span><span style="color: #000000">&gt;,</span>
<span style="color: #000000"> </span><span style="color: #001080">baselineValues</span><span style="color: #000000">: </span><span style="color: #267F99">Map</span><span style="color: #000000">&lt;</span><span style="color: #267F99">string</span><span style="color: #000000">, </span><span style="color: #267F99">SmartUiInput</span><span style="color: #000000">&gt;</span>
<span style="color: #000000"> ): </span><span style="color: #267F99">Promise</span><span style="color: #000000">&lt;</span><span style="color: #267F99">OnSaveResult</span><span style="color: #000000">&gt; </span><span style="color: #0000FF">=&gt;</span><span style="color: #000000"> {</span>
<span style="color: #000000"> </span><span style="color: #001080">stringPropertyValue</span><span style="color: #000000"> = </span><span style="color: #001080">currentValues</span><span style="color: #000000">.</span><span style="color: #795E26">get</span><span style="color: #000000">(</span><span style="color: #A31515">&quot;stringProperty&quot;</span><span style="color: #000000">)</span>
<span style="color: #000000"> </span><span style="color: #001080">booleanPropertyValue</span><span style="color: #000000"> = </span><span style="color: #001080">currentValues</span><span style="color: #000000">.</span><span style="color: #795E26">get</span><span style="color: #000000">(</span><span style="color: #A31515">&quot;booleanProperty&quot;</span><span style="color: #000000">)</span>
<span style="color: #000000"> </span>
<span style="color: #000000"> </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">propertiesToSave</span><span style="color: #000000"> : </span><span style="color: #267F99">RpDataModel</span><span style="color: #000000"> = { </span>
<span style="color: #000000"> </span><span style="color: #001080">stringProperty:</span><span style="color: #000000"> </span><span style="color: #001080">stringPropertyValue</span><span style="color: #000000">,</span>
<span style="color: #000000"> </span><span style="color: #001080">booleanProperty:</span><span style="color: #000000"> </span><span style="color: #001080">booleanPropertyValue</span>
<span style="color: #000000"> }</span>
<span style="color: #000000"> </span><span style="color: #0000FF">const</span><span style="color: #000000"> </span><span style="color: #0070C1">operationStatusUrl</span><span style="color: #000000"> = </span><span style="color: #AF00DB">await</span><span style="color: #000000"> </span><span style="color: #795E26">saveData</span><span style="color: #000000">(</span><span style="color: #001080">propertiesToSave</span><span style="color: #000000">);</span>
<span style="color: #000000"> </span><span style="color: #AF00DB">return</span><span style="color: #000000"> {</span>
<span style="color: #000000"> </span><span style="color: #001080">operationStatusUrl:</span><span style="color: #000000"> </span><span style="color: #001080">operationStatusUrl</span><span style="color: #000000">,</span>
<span style="color: #000000"> </span><span style="color: #001080">portalNotification:</span><span style="color: #000000"> {</span>
<span style="color: #000000"> </span><span style="color: #001080">initialize:</span><span style="color: #000000"> {</span>
<span style="color: #000000"> </span><span style="color: #001080">titleTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;DeleteInitializeTitle&quot;</span><span style="color: #000000">,</span>
<span style="color: #000000"> </span><span style="color: #001080">messageTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;DeleteInitializeMessage&quot;</span><span style="color: #000000">,</span>
<span style="color: #000000"> },</span>
<span style="color: #000000"> </span><span style="color: #001080">success:</span><span style="color: #000000"> {</span>
<span style="color: #000000"> </span><span style="color: #001080">titleTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;DeleteSuccessTitle&quot;</span><span style="color: #000000">,</span>
<span style="color: #000000"> </span><span style="color: #001080">messageTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;DeleteSuccesseMessage&quot;</span><span style="color: #000000">,</span>
<span style="color: #000000"> },</span>
<span style="color: #000000"> </span><span style="color: #001080">failure:</span><span style="color: #000000"> {</span>
<span style="color: #000000"> </span><span style="color: #001080">titleTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;DeleteFailureTitle&quot;</span><span style="color: #000000">,</span>
<span style="color: #000000"> </span><span style="color: #001080">messageTKey:</span><span style="color: #000000"> </span><span style="color: #A31515">&quot;DeleteFailureMessage&quot;</span><span style="color: #000000">,</span>
<span style="color: #000000"> },</span>
<span style="color: #000000"> },</span>
<span style="color: #000000"> };</span>
<span style="color: #000000"> }</span>
<span style="color: #000000"> .</span>
<span style="color: #000000"> .</span>
<span style="color: #000000"> .</span>
<span style="color: #000000"> @</span><span style="color: #795E26">Values</span><span style="color: #000000">(...)</span>
<span style="color: #000000"> </span><span style="color: #001080">stringProperty</span><span style="color: #000000">: </span><span style="color: #267F99">string</span><span style="color: #000000">;</span>
<span style="color: #000000"> @</span><span style="color: #795E26">Values</span><span style="color: #000000">(...)</span>
<span style="color: #000000"> </span><span style="color: #001080">booleanProperty</span><span style="color: #000000">: </span><span style="color: #267F99">boolean</span><span style="color: #000000">;</span>
<span style="color: #000000">}</span>
</code></pre>
<a href="#execution" id="execution" style="color: inherit; text-decoration: none;">
<h2>Execution</h2>
</a>
<a href="#watch-mode" id="watch-mode" style="color: inherit; text-decoration: none;">
<h3>Watch mode</h3>
</a>
<p>Run <code>npm start</code> to start the development server and automatically rebuild on changes</p>
<a href="#local-development" id="local-development" style="color: inherit; text-decoration: none;">
<h3>Local Development</h3>
</a>
<p>Ensure that you have made the <a href="./selfserve.html#code-changes">Code changes</a>.</p>
<ul>
<li>Go to <code>https://ms.portal.azure.com/</code></li>
<li>Add the query string <code>feature.showSelfServeExample=true&amp;feature.selfServeSource=https://localhost:1234/selfServe.html?selfServeType%3D&lt;SELF_SERVE_TYPE&gt;</code></li>
<li>Click on the <code>Self Serve Example</code> menu item on the left panel.</li>
</ul>
<p>For example, if you want to open up the the UI of a class with the type <code>sqlx</code>, then visit <code>https://ms.portal.azure.com/?feature.showSelfServeExample=true&amp;feature.selfServeSource=https://localhost:1234/selfServe.html?selfServeType%3Dsqlx</code></p>
<p><img src="https://sdkctlstore.blob.core.windows.net/exe/selfserveDev.PNG" alt=""></p>
</div>
</div>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class="current tsd-kind-module">
<a href="selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,149 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>SelfServe - What is currently supported? | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="selfserve___what_is_currently_supported_.html">SelfServe - What is currently supported?</a>
</li>
</ul>
<h1>Module SelfServe - What is currently supported?</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel tsd-comment">
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>The Self Serve framework has integrated support for</p>
<ol>
<li><a href="./selfserve.html#portal-notifications">Portal Notifications</a></li>
<li><a href="./selfserve.html#telemetry">Telemetry</a></li>
<li>the following UI controls:<ul>
<li><a href="https://developer.microsoft.com/en-us/fluentui#/controls/web/slider">Slider</a></li>
<li><a href="https://developer.microsoft.com/en-us/fluentui#/controls/web/spinbutton">SpinButton</a></li>
<li><a href="https://developer.microsoft.com/en-us/fluentui#/controls/web/textfield">TextField</a></li>
<li><a href="https://developer.microsoft.com/en-us/fluentui#/controls/web/toggle">Toggle</a></li>
<li><a href="https://developer.microsoft.com/en-us/fluentui#/controls/web/dropdown">Dropdown</a></li>
<li><a href="https://developer.microsoft.com/en-us/fluentui#/controls/web/link">Link</a></li>
<li><a href="https://developer.microsoft.com/en-us/fluentui#/controls/web/messagebar">MessageBar</a></li>
</ul>
</li>
</ol>
</div>
</div>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve.html">Self<wbr>Serve</a>
</li>
<li class="current tsd-kind-module">
<a href="selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,341 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>SelfServe/Decorators | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="selfserve_decorators.html">SelfServe/Decorators</a>
</li>
</ul>
<h1>Module SelfServe/Decorators</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Interfaces</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_decorators.booleaninputoptions.html" class="tsd-kind-icon">Boolean<wbr>Input<wbr>Options</a></li>
<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_decorators.choiceinputoptions.html" class="tsd-kind-icon">Choice<wbr>Input<wbr>Options</a></li>
<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_decorators.descriptiondisplayoptions.html" class="tsd-kind-icon">Description<wbr>Display<wbr>Options</a></li>
<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_decorators.numberinputoptions.html" class="tsd-kind-icon">Number<wbr>Input<wbr>Options</a></li>
<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_decorators.stringinputoptions.html" class="tsd-kind-icon">String<wbr>Input<wbr>Options</a></li>
</ul>
</section>
<section class="tsd-index-section ">
<h3>Type aliases</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-type-alias tsd-parent-kind-module"><a href="selfserve_decorators.html#inputoptions" class="tsd-kind-icon">Input<wbr>Options</a></li>
</ul>
</section>
<section class="tsd-index-section ">
<h3>Functions</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_decorators.html#isdisplayable" class="tsd-kind-icon">Is<wbr>Displayable</a></li>
<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_decorators.html#onchange" class="tsd-kind-icon">On<wbr>Change</a></li>
<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_decorators.html#propertyinfo" class="tsd-kind-icon">Property<wbr>Info</a></li>
<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_decorators.html#refreshoptions" class="tsd-kind-icon">Refresh<wbr>Options</a></li>
<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_decorators.html#values" class="tsd-kind-icon">Values</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Type aliases</h2>
<section class="tsd-panel tsd-member tsd-kind-type-alias tsd-parent-kind-module">
<a name="inputoptions" class="tsd-anchor"></a>
<h3>Input<wbr>Options</h3>
<div class="tsd-signature tsd-kind-icon">Input<wbr>Options<span class="tsd-signature-symbol">:</span> <a href="../interfaces/selfserve_decorators.numberinputoptions.html" class="tsd-signature-type" data-tsd-kind="Interface">NumberInputOptions</a><span class="tsd-signature-symbol"> | </span><a href="../interfaces/selfserve_decorators.stringinputoptions.html" class="tsd-signature-type" data-tsd-kind="Interface">StringInputOptions</a><span class="tsd-signature-symbol"> | </span><a href="../interfaces/selfserve_decorators.booleaninputoptions.html" class="tsd-signature-type" data-tsd-kind="Interface">BooleanInputOptions</a><span class="tsd-signature-symbol"> | </span><a href="../interfaces/selfserve_decorators.choiceinputoptions.html" class="tsd-signature-type" data-tsd-kind="Interface">ChoiceInputOptions</a><span class="tsd-signature-symbol"> | </span><a href="../interfaces/selfserve_decorators.descriptiondisplayoptions.html" class="tsd-signature-type" data-tsd-kind="Interface">DescriptionDisplayOptions</a></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Interprets the type of the UI element and correspondingly renders</p>
<ul>
<li>slider or spinner</li>
<li>text box</li>
<li>toggle</li>
<li>drop down</li>
<li>plain text or message bar</li>
</ul>
</div>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Functions</h2>
<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
<a name="isdisplayable" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagConst">Const</span> Is<wbr>Displayable</h3>
<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
<li class="tsd-signature tsd-kind-icon">Is<wbr>Displayable<span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">ClassDecorator</span></li>
</ul>
<ul class="tsd-descriptions">
<li class="tsd-description">
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Indicates to the compiler that UI should be generated from this class.</p>
</div>
</div>
<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">ClassDecorator</span></h4>
</li>
</ul>
</section>
<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
<a name="onchange" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagConst">Const</span> On<wbr>Change</h3>
<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
<li class="tsd-signature tsd-kind-icon">On<wbr>Change<span class="tsd-signature-symbol">(</span>onChange<span class="tsd-signature-symbol">: </span><a href="selfserve_selfservetypes.html#onchangecallback" class="tsd-signature-type" data-tsd-kind="Type alias">OnChangeCallback</a><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">PropertyDecorator</span></li>
</ul>
<ul class="tsd-descriptions">
<li class="tsd-description">
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Indicates the callback to be fired when the UI element corresponding to the property is changed.</p>
</div>
</div>
<h4 class="tsd-parameters-title">Parameters</h4>
<ul class="tsd-parameters">
<li>
<h5>onChange: <a href="selfserve_selfservetypes.html#onchangecallback" class="tsd-signature-type" data-tsd-kind="Type alias">OnChangeCallback</a></h5>
</li>
</ul>
<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">PropertyDecorator</span></h4>
</li>
</ul>
</section>
<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
<a name="propertyinfo" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagConst">Const</span> Property<wbr>Info</h3>
<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
<li class="tsd-signature tsd-kind-icon">Property<wbr>Info<span class="tsd-signature-symbol">(</span>info<span class="tsd-signature-symbol">: </span><a href="../interfaces/selfserve_selfservetypes.info.html" class="tsd-signature-type" data-tsd-kind="Interface">Info</a><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="../interfaces/selfserve_selfservetypes.info.html" class="tsd-signature-type" data-tsd-kind="Interface">Info</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">PropertyDecorator</span></li>
</ul>
<ul class="tsd-descriptions">
<li class="tsd-description">
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Indicates that the UI element corresponding to the property should have an Info bubble. The Info
bubble is the icon that looks like an &quot;i&quot; which users click on to get more information about the UI element.</p>
</div>
</div>
<h4 class="tsd-parameters-title">Parameters</h4>
<ul class="tsd-parameters">
<li>
<h5>info: <a href="../interfaces/selfserve_selfservetypes.info.html" class="tsd-signature-type" data-tsd-kind="Interface">Info</a><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="../interfaces/selfserve_selfservetypes.info.html" class="tsd-signature-type" data-tsd-kind="Interface">Info</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span></h5>
</li>
</ul>
<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">PropertyDecorator</span></h4>
</li>
</ul>
</section>
<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
<a name="refreshoptions" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagConst">Const</span> Refresh<wbr>Options</h3>
<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
<li class="tsd-signature tsd-kind-icon">Refresh<wbr>Options<span class="tsd-signature-symbol">(</span>refreshParams<span class="tsd-signature-symbol">: </span><a href="../interfaces/selfserve_selfservetypes.refreshparams.html" class="tsd-signature-type" data-tsd-kind="Interface">RefreshParams</a><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">ClassDecorator</span></li>
</ul>
<ul class="tsd-descriptions">
<li class="tsd-description">
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>If there is a long running operation in your page after the <a href="../classes/selfserve_selfservetypes.selfservebaseclass.html#onsave"><code>onSave</code></a> action, the page can
optionally auto refresh itself using the <a href="../classes/selfserve_selfservetypes.selfservebaseclass.html#onrefresh"><code>onRefresh</code></a> action. The &#39;RefreshOptions&#39; indicate
how often the auto refresh of the page occurs.</p>
</div>
</div>
<h4 class="tsd-parameters-title">Parameters</h4>
<ul class="tsd-parameters">
<li>
<h5>refreshParams: <a href="../interfaces/selfserve_selfservetypes.refreshparams.html" class="tsd-signature-type" data-tsd-kind="Interface">RefreshParams</a></h5>
</li>
</ul>
<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">ClassDecorator</span></h4>
</li>
</ul>
</section>
<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
<a name="values" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagConst">Const</span> Values</h3>
<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
<li class="tsd-signature tsd-kind-icon">Values<span class="tsd-signature-symbol">(</span>inputOptions<span class="tsd-signature-symbol">: </span><a href="selfserve_decorators.html#inputoptions" class="tsd-signature-type" data-tsd-kind="Type alias">InputOptions</a><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">PropertyDecorator</span></li>
</ul>
<ul class="tsd-descriptions">
<li class="tsd-description">
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Indicates that this property should correspond to a UI element with the given parameters.</p>
</div>
</div>
<h4 class="tsd-parameters-title">Parameters</h4>
<ul class="tsd-parameters">
<li>
<h5>inputOptions: <a href="selfserve_decorators.html#inputoptions" class="tsd-signature-type" data-tsd-kind="Type alias">InputOptions</a></h5>
</li>
</ul>
<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">PropertyDecorator</span></h4>
</li>
</ul>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class="current tsd-kind-module">
<a href="selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_decorators.booleaninputoptions.html" class="tsd-kind-icon">Boolean<wbr>Input<wbr>Options</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_decorators.choiceinputoptions.html" class="tsd-kind-icon">Choice<wbr>Input<wbr>Options</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_decorators.descriptiondisplayoptions.html" class="tsd-kind-icon">Description<wbr>Display<wbr>Options</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_decorators.numberinputoptions.html" class="tsd-kind-icon">Number<wbr>Input<wbr>Options</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_decorators.stringinputoptions.html" class="tsd-kind-icon">String<wbr>Input<wbr>Options</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="selfserve_decorators.html#inputoptions" class="tsd-kind-icon">Input<wbr>Options</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="selfserve_decorators.html#isdisplayable" class="tsd-kind-icon">Is<wbr>Displayable</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="selfserve_decorators.html#onchange" class="tsd-kind-icon">On<wbr>Change</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="selfserve_decorators.html#propertyinfo" class="tsd-kind-icon">Property<wbr>Info</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="selfserve_decorators.html#refreshoptions" class="tsd-kind-icon">Refresh<wbr>Options</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="selfserve_decorators.html#values" class="tsd-kind-icon">Values</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,323 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>SelfServe/SelfServeTelemetryProcessor | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="selfserve_selfservetelemetryprocessor.html">SelfServe/SelfServeTelemetryProcessor</a>
</li>
</ul>
<h1>Module SelfServe/SelfServeTelemetryProcessor</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Functions</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_selfservetelemetryprocessor.html#selfservetrace" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace</a></li>
<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_selfservetelemetryprocessor.html#selfservetracecancel" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Cancel</a></li>
<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_selfservetelemetryprocessor.html#selfservetracefailure" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Failure</a></li>
<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_selfservetelemetryprocessor.html#selfservetracestart" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Start</a></li>
<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_selfservetelemetryprocessor.html#selfservetracesuccess" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Success</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Functions</h2>
<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
<a name="selfservetrace" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagConst">Const</span> self<wbr>Serve<wbr>Trace</h3>
<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
<li class="tsd-signature tsd-kind-icon">self<wbr>Serve<wbr>Trace<span class="tsd-signature-symbol">(</span>data<span class="tsd-signature-symbol">: </span><a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">void</span></li>
</ul>
<ul class="tsd-descriptions">
<li class="tsd-description">
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Log an action.</p>
</div>
</div>
<h4 class="tsd-parameters-title">Parameters</h4>
<ul class="tsd-parameters">
<li>
<h5>data: <a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a></h5>
<div class="tsd-comment tsd-typography">
<p>Data to be sent as part of the Self Serve Telemetry.</p>
</div>
</li>
</ul>
<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">void</span></h4>
</li>
</ul>
</section>
<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
<a name="selfservetracecancel" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagConst">Const</span> self<wbr>Serve<wbr>Trace<wbr>Cancel</h3>
<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
<li class="tsd-signature tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Cancel<span class="tsd-signature-symbol">(</span>data<span class="tsd-signature-symbol">: </span><a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a>, timestamp<span class="tsd-signature-symbol">?: </span><span class="tsd-signature-type">number</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">void</span></li>
</ul>
<ul class="tsd-descriptions">
<li class="tsd-description">
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Log an action as cancelled.</p>
</div>
</div>
<h4 class="tsd-parameters-title">Parameters</h4>
<ul class="tsd-parameters">
<li>
<h5>data: <a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a></h5>
<div class="tsd-comment tsd-typography">
<p>Data to be sent as part of the Self Serve Telemetry.</p>
</div>
</li>
<li>
<h5><span class="tsd-flag ts-flagOptional">Optional</span> timestamp: <span class="tsd-signature-type">number</span></h5>
<div class="tsd-comment tsd-typography">
<p>Timestamp of the action&#39;s start trace.</p>
</div>
</li>
</ul>
<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">void</span></h4>
</li>
</ul>
</section>
<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
<a name="selfservetracefailure" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagConst">Const</span> self<wbr>Serve<wbr>Trace<wbr>Failure</h3>
<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
<li class="tsd-signature tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Failure<span class="tsd-signature-symbol">(</span>data<span class="tsd-signature-symbol">: </span><a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a>, timestamp<span class="tsd-signature-symbol">?: </span><span class="tsd-signature-type">number</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">void</span></li>
</ul>
<ul class="tsd-descriptions">
<li class="tsd-description">
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Log an action as a failure.</p>
</div>
</div>
<h4 class="tsd-parameters-title">Parameters</h4>
<ul class="tsd-parameters">
<li>
<h5>data: <a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a></h5>
<div class="tsd-comment tsd-typography">
<p>Data to be sent as part of the Self Serve Telemetry.</p>
</div>
</li>
<li>
<h5><span class="tsd-flag ts-flagOptional">Optional</span> timestamp: <span class="tsd-signature-type">number</span></h5>
<div class="tsd-comment tsd-typography">
<p>Timestamp of the action&#39;s start trace.</p>
</div>
</li>
</ul>
<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">void</span></h4>
</li>
</ul>
</section>
<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
<a name="selfservetracestart" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagConst">Const</span> self<wbr>Serve<wbr>Trace<wbr>Start</h3>
<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
<li class="tsd-signature tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Start<span class="tsd-signature-symbol">(</span>data<span class="tsd-signature-symbol">: </span><a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">number</span></li>
</ul>
<ul class="tsd-descriptions">
<li class="tsd-description">
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Start logging an action.</p>
</div>
</div>
<h4 class="tsd-parameters-title">Parameters</h4>
<ul class="tsd-parameters">
<li>
<h5>data: <a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a></h5>
<div class="tsd-comment tsd-typography">
<p>Data to be sent as part of the Self Serve Telemetry.</p>
</div>
</li>
</ul>
<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">number</span></h4>
<p>Timestamp of the trace start, that can be used in other trace actions.
The timestamp is used to identify all the logs associated with an action.</p>
</li>
</ul>
</section>
<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
<a name="selfservetracesuccess" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagConst">Const</span> self<wbr>Serve<wbr>Trace<wbr>Success</h3>
<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
<li class="tsd-signature tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Success<span class="tsd-signature-symbol">(</span>data<span class="tsd-signature-symbol">: </span><a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a>, timestamp<span class="tsd-signature-symbol">?: </span><span class="tsd-signature-type">number</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">void</span></li>
</ul>
<ul class="tsd-descriptions">
<li class="tsd-description">
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Log an action as a success.</p>
</div>
</div>
<h4 class="tsd-parameters-title">Parameters</h4>
<ul class="tsd-parameters">
<li>
<h5>data: <a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-signature-type" data-tsd-kind="Interface">SelfServeTelemetryMessage</a></h5>
<div class="tsd-comment tsd-typography">
<p>Data to be sent as part of the Self Serve Telemetry.</p>
</div>
</li>
<li>
<h5><span class="tsd-flag ts-flagOptional">Optional</span> timestamp: <span class="tsd-signature-type">number</span></h5>
<div class="tsd-comment tsd-typography">
<p>Timestamp of the action&#39;s start trace.</p>
</div>
</li>
</ul>
<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">void</span></h4>
</li>
</ul>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class="current tsd-kind-module">
<a href="selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="selfserve_selfservetelemetryprocessor.html#selfservetrace" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="selfserve_selfservetelemetryprocessor.html#selfservetracecancel" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Cancel</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="selfserve_selfservetelemetryprocessor.html#selfservetracefailure" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Failure</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="selfserve_selfservetelemetryprocessor.html#selfservetracestart" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Start</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="selfserve_selfservetelemetryprocessor.html#selfservetracesuccess" class="tsd-kind-icon">self<wbr>Serve<wbr>Trace<wbr>Success</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,363 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>SelfServe/SelfServeTypes | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="selfserve_selfservetypes.html">SelfServe/SelfServeTypes</a>
</li>
</ul>
<h1>Module SelfServe/SelfServeTypes</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Enumerations</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-enum tsd-parent-kind-module"><a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a></li>
<li class="tsd-kind-enum tsd-parent-kind-module"><a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a></li>
</ul>
</section>
<section class="tsd-index-section ">
<h3>Classes</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-class tsd-parent-kind-module"><a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a></li>
</ul>
</section>
<section class="tsd-index-section ">
<h3>Interfaces</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a></li>
<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a></li>
<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a></li>
<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a></li>
<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a></li>
<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a></li>
<li class="tsd-kind-interface tsd-parent-kind-module"><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a></li>
</ul>
</section>
<section class="tsd-index-section ">
<h3>Type aliases</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-type-alias tsd-parent-kind-module"><a href="selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a></li>
<li class="tsd-kind-type-alias tsd-parent-kind-module"><a href="selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a></li>
<li class="tsd-kind-type-alias tsd-parent-kind-module"><a href="selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a></li>
<li class="tsd-kind-type-alias tsd-parent-kind-module"><a href="selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a></li>
<li class="tsd-kind-type-alias tsd-parent-kind-module"><a href="selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Type aliases</h2>
<section class="tsd-panel tsd-member tsd-kind-type-alias tsd-parent-kind-module">
<a name="choiceitem" class="tsd-anchor"></a>
<h3>Choice<wbr>Item</h3>
<div class="tsd-signature tsd-kind-icon">Choice<wbr>Item<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">{ </span>key<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">; </span>labelTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> }</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-type-declaration">
<h4>Type declaration</h4>
<ul class="tsd-parameters">
<li class="tsd-parameter">
<h5>key<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string that uniquely identifies the dropdown choice item, from the strings JSON file.</p>
</div>
</div>
</li>
<li class="tsd-parameter">
<h5>labelTKey<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></h5>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Key used to pickup the string corresponding to the label of the dropdown choice item, from the strings JSON file.</p>
</div>
</div>
</li>
</ul>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-type-alias tsd-parent-kind-module">
<a name="inputtype" class="tsd-anchor"></a>
<h3>Input<wbr>Type</h3>
<div class="tsd-signature tsd-kind-icon">Input<wbr>Type<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-type">number</span><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol"> | </span><span class="tsd-signature-type">boolean</span><span class="tsd-signature-symbol"> | </span><a href="selfserve_selfservetypes.html#choiceitem" class="tsd-signature-type" data-tsd-kind="Type alias">ChoiceItem</a><span class="tsd-signature-symbol"> | </span><a href="../interfaces/selfserve_selfservetypes.description.html" class="tsd-signature-type" data-tsd-kind="Interface">Description</a></div>
<aside class="tsd-sources">
</aside>
</section>
<section class="tsd-panel tsd-member tsd-kind-type-alias tsd-parent-kind-module">
<a name="onchangecallback" class="tsd-anchor"></a>
<h3>On<wbr>Change<wbr>Callback</h3>
<div class="tsd-signature tsd-kind-icon">On<wbr>Change<wbr>Callback<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">(</span>newValue<span class="tsd-signature-symbol">: </span><a href="selfserve_selfservetypes.html#inputtype" class="tsd-signature-type" data-tsd-kind="Type alias">InputType</a>, currentValues<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span>, baselineValues<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">ReadonlyMap</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Function that dictates how the overall UI should transform when the UI element corresponding to a property, say prop1, is changed.
The callback can be used to<br> * Change the value (and reflect it in the UI) for another property, say prop2<br> * Change the visibility for prop2 in the UI<br> * Disable or enable the UI element corresponding to prop2<br>depending on logic based on the newValue of prop1, the currentValues Map and baselineValues Map.</p>
</div>
</div>
<div class="tsd-type-declaration">
<h4>Type declaration</h4>
<ul class="tsd-parameters">
<li class="tsd-parameter-signature">
<ul class="tsd-signatures tsd-kind-type-literal tsd-parent-kind-type-alias">
<li class="tsd-signature tsd-kind-icon"><span class="tsd-signature-symbol">(</span>newValue<span class="tsd-signature-symbol">: </span><a href="selfserve_selfservetypes.html#inputtype" class="tsd-signature-type" data-tsd-kind="Type alias">InputType</a>, currentValues<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span>, baselineValues<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">ReadonlyMap</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span></li>
</ul>
<ul class="tsd-descriptions">
<li class="tsd-description">
<h4 class="tsd-parameters-title">Parameters</h4>
<ul class="tsd-parameters">
<li>
<h5>newValue: <a href="selfserve_selfservetypes.html#inputtype" class="tsd-signature-type" data-tsd-kind="Type alias">InputType</a></h5>
<div class="tsd-comment tsd-typography">
<p>The newValue that the property needs to be set to, after the change in the UI element corresponding to this property.</p>
</div>
</li>
<li>
<h5>currentValues: <span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span></h5>
<div class="tsd-comment tsd-typography">
<p>The map of propertyName =&gt; <a href="../interfaces/selfserve_selfservetypes.smartuiinput.html"><code>SmartUiInput</code></a> corresponding to the current state of the UI.</p>
</div>
</li>
<li>
<h5>baselineValues: <span class="tsd-signature-type">ReadonlyMap</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span></h5>
<div class="tsd-comment tsd-typography">
<p>The map of propertyName =&gt; <a href="../interfaces/selfserve_selfservetypes.smartuiinput.html"><code>SmartUiInput</code></a> corresponding to the initial state of the UI.</p>
</div>
</li>
</ul>
<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span></h4>
<p>A new Map of propertyName =&gt; <a href="../interfaces/selfserve_selfservetypes.smartuiinput.html"><code>SmartUiInput</code></a> corresponding to the new state of the overall UI</p>
</li>
</ul>
</li>
</ul>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-type-alias tsd-parent-kind-module">
<a name="initializecallback" class="tsd-anchor"></a>
<h3>initialize<wbr>Callback</h3>
<div class="tsd-signature tsd-kind-icon">initialize<wbr>Callback<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">&gt;</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-type-declaration">
<h4>Type declaration</h4>
<ul class="tsd-parameters">
<li class="tsd-parameter-signature">
<ul class="tsd-signatures tsd-kind-type-literal tsd-parent-kind-type-alias">
<li class="tsd-signature tsd-kind-icon"><span class="tsd-signature-symbol">(</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">&gt;</span></li>
</ul>
<ul class="tsd-descriptions">
<li class="tsd-description">
<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">&gt;</span></h4>
<p>Promise of Map of propertyName =&gt; <a href="../interfaces/selfserve_selfservetypes.smartuiinput.html"><code>SmartUiInput</code></a> which will become the current state of the UI.</p>
</li>
</ul>
</li>
</ul>
</div>
</section>
<section class="tsd-panel tsd-member tsd-kind-type-alias tsd-parent-kind-module">
<a name="onsavecallback" class="tsd-anchor"></a>
<h3>on<wbr>Save<wbr>Callback</h3>
<div class="tsd-signature tsd-kind-icon">on<wbr>Save<wbr>Callback<span class="tsd-signature-symbol">:</span> <span class="tsd-signature-symbol">(</span>currentValues<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span>, baselineValues<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">ReadonlyMap</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol"> =&gt; </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="../interfaces/selfserve_selfservetypes.onsaveresult.html" class="tsd-signature-type" data-tsd-kind="Interface">OnSaveResult</a><span class="tsd-signature-symbol">&gt;</span></div>
<aside class="tsd-sources">
</aside>
<div class="tsd-type-declaration">
<h4>Type declaration</h4>
<ul class="tsd-parameters">
<li class="tsd-parameter-signature">
<ul class="tsd-signatures tsd-kind-type-literal tsd-parent-kind-type-alias">
<li class="tsd-signature tsd-kind-icon"><span class="tsd-signature-symbol">(</span>currentValues<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span>, baselineValues<span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">ReadonlyMap</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="../interfaces/selfserve_selfservetypes.onsaveresult.html" class="tsd-signature-type" data-tsd-kind="Interface">OnSaveResult</a><span class="tsd-signature-symbol">&gt;</span></li>
</ul>
<ul class="tsd-descriptions">
<li class="tsd-description">
<h4 class="tsd-parameters-title">Parameters</h4>
<ul class="tsd-parameters">
<li>
<h5>currentValues: <span class="tsd-signature-type">Map</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span></h5>
<div class="tsd-comment tsd-typography">
<p>The map of propertyName =&gt; <a href="../interfaces/selfserve_selfservetypes.smartuiinput.html"><code>SmartUiInput</code></a> corresponding to the current state of the UI</p>
</div>
</li>
<li>
<h5>baselineValues: <span class="tsd-signature-type">ReadonlyMap</span><span class="tsd-signature-symbol">&lt;</span><span class="tsd-signature-type">string</span><span class="tsd-signature-symbol">, </span><a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-signature-type" data-tsd-kind="Interface">SmartUiInput</a><span class="tsd-signature-symbol">&gt;</span></h5>
<div class="tsd-comment tsd-typography">
<p>The map of propertyName =&gt; <a href="../interfaces/selfserve_selfservetypes.smartuiinput.html"><code>SmartUiInput</code></a> corresponding to the initial state of the UI</p>
</div>
</li>
</ul>
<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">Promise</span><span class="tsd-signature-symbol">&lt;</span><a href="../interfaces/selfserve_selfservetypes.onsaveresult.html" class="tsd-signature-type" data-tsd-kind="Interface">OnSaveResult</a><span class="tsd-signature-symbol">&gt;</span></h4>
</li>
</ul>
</li>
</ul>
</div>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class="current tsd-kind-module">
<a href="selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfservetypes.descriptiontype.html" class="tsd-kind-icon">Description<wbr>Type</a>
</li>
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfservetypes.numberuitype.html" class="tsd-kind-icon">Number<wbr>UiType</a>
</li>
<li class=" tsd-kind-class tsd-parent-kind-module">
<a href="../classes/selfserve_selfservetypes.selfservebaseclass.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Base<wbr>Class</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.description.html" class="tsd-kind-icon">Description</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.info.html" class="tsd-kind-icon">Info</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.onsaveresult.html" class="tsd-kind-icon">On<wbr>Save<wbr>Result</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.refreshparams.html" class="tsd-kind-icon">Refresh<wbr>Params</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.refreshresult.html" class="tsd-kind-icon">Refresh<wbr>Result</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.selfservetelemetrymessage.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Telemetry<wbr>Message</a>
</li>
<li class=" tsd-kind-interface tsd-parent-kind-module">
<a href="../interfaces/selfserve_selfservetypes.smartuiinput.html" class="tsd-kind-icon">Smart<wbr>UiInput</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="selfserve_selfservetypes.html#choiceitem" class="tsd-kind-icon">Choice<wbr>Item</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="selfserve_selfservetypes.html#inputtype" class="tsd-kind-icon">Input<wbr>Type</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="selfserve_selfservetypes.html#onchangecallback" class="tsd-kind-icon">On<wbr>Change<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="selfserve_selfservetypes.html#initializecallback" class="tsd-kind-icon">initialize<wbr>Callback</a>
</li>
<li class=" tsd-kind-type-alias tsd-parent-kind-module">
<a href="selfserve_selfservetypes.html#onsavecallback" class="tsd-kind-icon">on<wbr>Save<wbr>Callback</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

View File

@@ -0,0 +1,185 @@
<!doctype html>
<html class="default no-js">
<head>
<meta charset="utf-8">
<meta http-equiv="X-UA-Compatible" content="IE=edge">
<title>SelfServe/SelfServeUtils | cosmos-explorer</title>
<meta name="description" content="Documentation for cosmos-explorer">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="stylesheet" href="../assets/css/main.css">
<script async src="../assets/js/search.js" id="search-script"></script>
</head>
<body>
<header>
<div class="tsd-page-toolbar">
<div class="container">
<div class="table-wrap">
<div class="table-cell" id="tsd-search" data-index="../assets/js/search.json" data-base="..">
<div class="field">
<label for="tsd-search-field" class="tsd-widget search no-caption">Search</label>
<input id="tsd-search-field" type="text" />
</div>
<ul class="results">
<li class="state loading">Preparing search index...</li>
<li class="state failure">The search index is not available</li>
</ul>
<a href="../index.html" class="title">cosmos-explorer</a>
</div>
<div class="table-cell" id="tsd-widgets">
<div id="tsd-filter">
<a href="#" class="tsd-widget options no-caption" data-toggle="options">Options</a>
<div class="tsd-filter-group">
<div class="tsd-select" id="tsd-filter-visibility">
<span class="tsd-select-label">All</span>
<ul class="tsd-select-list">
<li data-value="public">Public</li>
<li data-value="protected">Public/Protected</li>
<li data-value="private" class="selected">All</li>
</ul>
</div>
<input type="checkbox" id="tsd-filter-inherited" checked />
<label class="tsd-widget" for="tsd-filter-inherited">Inherited</label>
<input type="checkbox" id="tsd-filter-externals" checked />
<label class="tsd-widget" for="tsd-filter-externals">Externals</label>
</div>
</div>
<a href="#" class="tsd-widget menu no-caption" data-toggle="menu">Menu</a>
</div>
</div>
</div>
</div>
<div class="tsd-page-title">
<div class="container">
<ul class="tsd-breadcrumb">
<li>
<a href="../modules.html">cosmos-explorer</a>
</li>
<li>
<a href="selfserve_selfserveutils.html">SelfServe/SelfServeUtils</a>
</li>
</ul>
<h1>Module SelfServe/SelfServeUtils</h1>
</div>
</div>
</header>
<div class="container container-main">
<div class="row">
<div class="col-8 col-content">
<section class="tsd-panel-group tsd-index-group">
<h2>Index</h2>
<section class="tsd-panel tsd-index-panel">
<div class="tsd-index-content">
<section class="tsd-index-section ">
<h3>Enumerations</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-enum tsd-parent-kind-module"><a href="../enums/selfserve_selfserveutils.bladetype.html" class="tsd-kind-icon">Blade<wbr>Type</a></li>
<li class="tsd-kind-enum tsd-parent-kind-module"><a href="../enums/selfserve_selfserveutils.selfservetype.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Type</a></li>
</ul>
</section>
<section class="tsd-index-section ">
<h3>Functions</h3>
<ul class="tsd-index-list">
<li class="tsd-kind-function tsd-parent-kind-module"><a href="selfserve_selfserveutils.html#generatebladelink" class="tsd-kind-icon">generate<wbr>Blade<wbr>Link</a></li>
</ul>
</section>
</div>
</section>
</section>
<section class="tsd-panel-group tsd-member-group ">
<h2>Functions</h2>
<section class="tsd-panel tsd-member tsd-kind-function tsd-parent-kind-module">
<a name="generatebladelink" class="tsd-anchor"></a>
<h3><span class="tsd-flag ts-flagConst">Const</span> generate<wbr>Blade<wbr>Link</h3>
<ul class="tsd-signatures tsd-kind-function tsd-parent-kind-module">
<li class="tsd-signature tsd-kind-icon">generate<wbr>Blade<wbr>Link<span class="tsd-signature-symbol">(</span>blade<span class="tsd-signature-symbol">: </span><a href="../enums/selfserve_selfserveutils.bladetype.html" class="tsd-signature-type" data-tsd-kind="Enumeration">BladeType</a><span class="tsd-signature-symbol">)</span><span class="tsd-signature-symbol">: </span><span class="tsd-signature-type">string</span></li>
</ul>
<ul class="tsd-descriptions">
<li class="tsd-description">
<aside class="tsd-sources">
</aside>
<div class="tsd-comment tsd-typography">
<div class="lead">
<p>Generate the URL corresponding to the portal blade for the current Azure Cosmos DB account</p>
</div>
</div>
<h4 class="tsd-parameters-title">Parameters</h4>
<ul class="tsd-parameters">
<li>
<h5>blade: <a href="../enums/selfserve_selfserveutils.bladetype.html" class="tsd-signature-type" data-tsd-kind="Enumeration">BladeType</a></h5>
</li>
</ul>
<h4 class="tsd-returns-title">Returns <span class="tsd-signature-type">string</span></h4>
</li>
</ul>
</section>
</section>
</div>
<div class="col-4 col-menu menu-sticky-wrap menu-highlight">
<nav class="tsd-navigation primary">
<ul>
<li class=" ">
<a href="../modules.html">Modules</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve.html">Self<wbr>Serve</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve___what_is_currently_supported_.html">Self<wbr>Serve -<wbr> <wbr>What is currently supported?</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_decorators.html">Self<wbr>Serve/<wbr>Decorators</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_selfservetelemetryprocessor.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Telemetry<wbr>Processor</a>
</li>
<li class=" tsd-kind-module">
<a href="selfserve_selfservetypes.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Types</a>
</li>
<li class="current tsd-kind-module">
<a href="selfserve_selfserveutils.html">Self<wbr>Serve/<wbr>Self<wbr>Serve<wbr>Utils</a>
</li>
</ul>
</nav>
<nav class="tsd-navigation secondary menu-sticky">
<ul class="before-current">
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfserveutils.bladetype.html" class="tsd-kind-icon">Blade<wbr>Type</a>
</li>
<li class=" tsd-kind-enum tsd-parent-kind-module">
<a href="../enums/selfserve_selfserveutils.selfservetype.html" class="tsd-kind-icon">Self<wbr>Serve<wbr>Type</a>
</li>
<li class=" tsd-kind-function tsd-parent-kind-module">
<a href="selfserve_selfserveutils.html#generatebladelink" class="tsd-kind-icon">generate<wbr>Blade<wbr>Link</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
<footer class="with-border-bottom">
<div class="container">
<h2>Legend</h2>
<div class="tsd-legend-group">
<ul class="tsd-legend">
<li class="tsd-kind-function"><span class="tsd-kind-icon">Function</span></li>
<li class="tsd-kind-type-alias"><span class="tsd-kind-icon">Type alias</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-enum"><span class="tsd-kind-icon">Enumeration</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-interface"><span class="tsd-kind-icon">Interface</span></li>
</ul>
<ul class="tsd-legend">
<li class="tsd-kind-class"><span class="tsd-kind-icon">Class</span></li>
</ul>
</div>
</div>
</footer>
<div class="container tsd-generator">
<p>Generated using <a href="https://typedoc.org/" target="_blank">TypeDoc</a></p>
</div>
<div class="overlay"></div>
<script src="../assets/js/main.js"></script>
</body>
</html>

1963
externals/adal.js vendored

File diff suppressed because it is too large Load Diff

File diff suppressed because one or more lines are too long

54
images/CarouselImage1.svg Normal file

File diff suppressed because one or more lines are too long

After

Width:  |  Height:  |  Size: 20 KiB

66
images/CarouselImage2.svg Normal file

File diff suppressed because one or more lines are too long

After

Width:  |  Height:  |  Size: 18 KiB

View File

Before

Width:  |  Height:  |  Size: 842 B

After

Width:  |  Height:  |  Size: 842 B

View File

@@ -0,0 +1,3 @@
<svg width="20" height="22" viewBox="0 0 20 22" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M7.4852 1.13266C6.25055 1.69386 5.20039 2.5918 5.20039 3.8002V7.41652C5.39862 7.40568 5.59878 7.4002 5.80039 7.4002C6.00246 7.4002 6.20261 7.40569 6.40039 7.41649V5.83795C6.72565 6.08075 7.09627 6.29095 7.4852 6.46774C8.77401 7.05356 10.5123 7.4002 12.4004 7.4002C14.2885 7.4002 16.0268 7.05356 17.3156 6.46774C17.7045 6.29095 18.0752 6.08075 18.4004 5.83795V15.8002C18.4004 16.2486 17.9731 16.8507 16.819 17.3753C15.7191 17.8752 14.1574 18.2002 12.4005 18.2002L12.4004 18.7995C12.4004 19.0077 12.379 19.208 12.3392 19.4001L12.4004 19.4002C14.2885 19.4002 16.0268 19.0535 17.3156 18.4677C18.5503 17.9066 19.6004 17.0086 19.6004 15.8002V3.8002C19.6004 2.5918 18.5503 1.69386 17.3156 1.13266C16.0268 0.546827 14.2885 0.200195 12.4004 0.200195C10.5123 0.200195 8.77401 0.546827 7.4852 1.13266ZM7.98176 5.37529C6.82769 4.85071 6.40039 4.24866 6.40039 3.8002C6.40039 3.35173 6.82769 2.74968 7.98176 2.2251C9.08168 1.72513 10.6434 1.4002 12.4004 1.4002C14.1574 1.4002 15.7191 1.72513 16.819 2.2251C17.9731 2.74968 18.4004 3.35173 18.4004 3.8002C18.4004 4.24866 17.9731 4.85071 16.819 5.37529C15.7191 5.87526 14.1574 6.2002 12.4004 6.2002C10.6434 6.2002 9.08168 5.87526 7.98176 5.37529ZM6.40039 8.61851C6.76422 8.64085 7.11714 8.68327 7.4555 8.74374C7.93669 8.82972 8.38843 8.95219 8.80015 9.10529C10.2475 9.64345 11.2004 10.56 11.2004 11.6002C11.2004 13.257 8.78273 14.6002 5.80039 14.6002C2.81805 14.6002 0.400391 13.257 0.400391 11.6002C0.400391 10.056 2.50043 8.78432 5.20039 8.61851C5.39739 8.60641 5.59759 8.6002 5.80039 8.6002C6.00319 8.6002 6.20339 8.60641 6.40039 8.61851ZM11.1112 19.3454C10.6494 20.7416 8.44723 21.7995 5.80039 21.7995C2.81805 21.7995 0.400391 20.4564 0.400391 18.7995V14.0648C0.706223 14.3399 1.04834 14.5755 1.39925 14.7705C2.58615 15.4299 4.14455 15.8002 5.80039 15.8002C7.45623 15.8002 9.01463 15.4299 10.2015 14.7705C10.553 14.5752 10.8957 14.3391 11.202 14.0633C11.2015 15.2351 11.2008 16.9706 11.2005 18.1486V18.1508C11.2004 18.3942 11.2004 18.6137 11.2004 18.7995C11.2004 18.986 11.1698 19.1684 11.1112 19.3454Z" fill="#0078D4"/>
</svg>

After

Width:  |  Height:  |  Size: 2.1 KiB

23
images/Connect_color.svg Normal file
View File

@@ -0,0 +1,23 @@
<svg width="40" height="40" viewBox="0 0 40 40" fill="none" xmlns="http://www.w3.org/2000/svg">
<g clip-path="url(#clip0_480_185430)">
<path d="M35.4911 6.39638L33.4106 4.31591L37.559 0.167553C37.6611 0.0654497 37.7996 0.00808785 37.944 0.00808785C38.0884 0.00808801 38.2269 0.0654482 38.329 0.167551L39.641 1.47963C39.7431 1.58173 39.8005 1.72021 39.8005 1.86461C39.8005 2.009 39.7431 2.14749 39.641 2.24959L35.4927 6.39795L35.4911 6.39638Z" fill="#32BEDD"/>
<path d="M4.45313 33.6455L6.53988 35.7323L2.44494 39.8272C2.34367 39.9285 2.20632 39.9853 2.06311 39.9853C1.91989 39.9853 1.78254 39.9285 1.68127 39.8272L0.364478 38.5104C0.312974 38.4606 0.271905 38.401 0.243665 38.3351C0.215426 38.2692 0.20058 38.1984 0.199995 38.1267C0.19941 38.0551 0.213098 37.984 0.240258 37.9177C0.267419 37.8514 0.307509 37.7911 0.358193 37.7404L4.45313 33.6455Z" fill="#0078D4"/>
<path d="M5.09381 25.0287C3.78099 26.3415 3.04346 28.1221 3.04346 29.9787C3.04346 31.8353 3.78099 33.6159 5.09381 34.9287C6.40664 36.2415 8.1872 36.9791 10.0438 36.9791C11.9004 36.9791 13.681 36.2415 14.9938 34.9287L18.2027 31.7176L8.30492 21.8198L5.09381 25.0287Z" fill="url(#paint0_linear_480_185430)"/>
<path d="M17.4209 18.1581L17.6157 18.353C17.8133 18.5505 17.9242 18.8185 17.9242 19.0978C17.9242 19.3772 17.8133 19.6451 17.6157 19.8426L13.6009 23.8574L11.918 22.1745L15.9344 18.1581C16.1319 17.9606 16.3998 17.8496 16.6792 17.8496C16.9586 17.8496 17.2265 17.9606 17.424 18.1581L17.4209 18.1581Z" fill="#C3F1FF"/>
<path d="M21.5835 22.32L21.7783 22.5149C21.9759 22.7124 22.0868 22.9803 22.0868 23.2597C22.0868 23.539 21.9759 23.807 21.7783 24.0045L17.7588 28.024L16.0759 26.3411L20.097 22.32C20.2945 22.1225 20.5624 22.0115 20.8418 22.0115C21.1212 22.0115 21.3891 22.1225 21.5866 22.32L21.5835 22.32Z" fill="#C3F1FF"/>
<path d="M20.9363 30.0618L9.87241 18.9979C9.66673 18.7922 9.33327 18.7922 9.12759 18.9979L7.67566 20.4498C7.46999 20.6555 7.46999 20.989 7.67566 21.1946L18.7395 32.2585C18.9452 32.4642 19.2787 32.4642 19.4843 32.2585L20.9363 30.8066C21.1419 30.6009 21.1419 30.2674 20.9363 30.0618Z" fill="#5EA0EF"/>
<path d="M34.9067 14.9711C36.2196 13.6583 36.9571 11.8777 36.9571 10.0211C36.9571 8.1645 36.2196 6.38393 34.9067 5.07111C33.5939 3.75829 31.8134 3.02075 29.9567 3.02075C28.1001 3.02075 26.3196 3.75829 25.0067 5.07111L21.7979 8.28222L31.6956 18.18L34.9067 14.9711Z" fill="#ECF4FD"/>
<path d="M22.5828 21.8375L22.388 21.6426C22.1904 21.4451 22.0795 21.1772 22.0795 20.8978C22.0795 20.6184 22.1904 20.3505 22.388 20.153L26.4075 16.1335L28.092 17.8179L24.0677 21.8422C23.8698 22.0376 23.6025 22.1469 23.3243 22.146C23.0461 22.1451 22.7795 22.0342 22.5828 21.8375Z" fill="#ECF4FD"/>
<path d="M18.4178 17.6802L18.2229 17.4854C18.0254 17.2878 17.9144 17.0199 17.9144 16.7406C17.9144 16.4612 18.0254 16.1933 18.2229 15.9957L22.2409 11.9778L23.9254 13.6623L19.909 17.6787C19.7115 17.8762 19.4435 17.9872 19.1642 17.9872C18.8848 17.9872 18.6169 17.8762 18.4194 17.6787L18.4178 17.6802Z" fill="#ECF4FD"/>
<path d="M19.0642 9.93799L30.1281 21.0019C30.3338 21.2075 30.6672 21.2075 30.8729 21.0019L32.3248 19.5499C32.5305 19.3443 32.5305 19.0108 32.3248 18.8051L21.261 7.74125C21.0553 7.53557 20.7218 7.53557 20.5161 7.74125L19.0642 9.19317C18.8585 9.39885 18.8585 9.73232 19.0642 9.93799Z" fill="#ECF4FD"/>
</g>
<defs>
<linearGradient id="paint0_linear_480_185430" x1="10.6227" y1="21.8179" x2="10.6227" y2="36.9783" gradientUnits="userSpaceOnUse">
<stop stop-color="#5EA0EF"/>
<stop offset="0.997" stop-color="#0078D4"/>
</linearGradient>
<clipPath id="clip0_480_185430">
<rect width="40" height="40" fill="white"/>
</clipPath>
</defs>
</svg>

After

Width:  |  Height:  |  Size: 3.5 KiB

8
images/Containers.svg Normal file
View File

@@ -0,0 +1,8 @@
<svg width="36" height="36" viewBox="0 0 36 36" fill="none" xmlns="http://www.w3.org/2000/svg">
<path fill-rule="evenodd" clip-rule="evenodd" d="M24 34.635C24 34.8143 23.9647 34.9918 23.8961 35.1574C23.8275 35.323 23.727 35.4734 23.6002 35.6002C23.4734 35.727 23.323 35.8275 23.1574 35.8961C22.9918 35.9647 22.8143 36 22.635 36H1.365C1.18575 36 1.00825 35.9647 0.842637 35.8961C0.677028 35.8275 0.526551 35.727 0.399799 35.6002C0.273047 35.4734 0.172502 35.323 0.103904 35.1574C0.0353068 34.9918 0 34.8143 0 34.635L0 13.365C0 13.003 0.143812 12.6558 0.399799 12.3998C0.655786 12.1438 1.00298 12 1.365 12H22.635C22.997 12 23.3442 12.1438 23.6002 12.3998C23.8562 12.6558 24 13.003 24 13.365V34.635Z" fill="#005BA1"/>
<path fill-rule="evenodd" clip-rule="evenodd" d="M30 28.635C30 28.997 29.8562 29.3442 29.6002 29.6002C29.3442 29.8562 28.997 30 28.635 30H7.365C7.00298 30 6.65579 29.8562 6.3998 29.6002C6.14381 29.3442 6 28.997 6 28.635V7.365C6 7.00298 6.14381 6.65579 6.3998 6.3998C6.65579 6.14381 7.00298 6 7.365 6H28.635C28.997 6 29.3442 6.14381 29.6002 6.3998C29.8562 6.65579 30 7.00298 30 7.365V28.635Z" fill="#5EA0EF"/>
<path d="M22.635 12H6V28.635C6 28.997 6.14381 29.3442 6.3998 29.6002C6.65579 29.8562 7.00298 30 7.365 30H24V13.365C24 13.003 23.8562 12.6558 23.6002 12.3998C23.3442 12.1438 22.997 12 22.635 12Z" fill="#0078D4"/>
<path fill-rule="evenodd" clip-rule="evenodd" d="M36 22.635C36 22.8143 35.9647 22.9918 35.8961 23.1574C35.8275 23.323 35.727 23.4734 35.6002 23.6002C35.4734 23.727 35.323 23.8275 35.1574 23.8961C34.9918 23.9647 34.8143 24 34.635 24H13.365C13.003 24 12.6558 23.8562 12.3998 23.6002C12.1438 23.3442 12 22.997 12 22.635V1.365C12 1.00298 12.1438 0.655786 12.3998 0.399799C12.6558 0.143812 13.003 0 13.365 0L34.635 0C34.8143 0 34.9918 0.0353068 35.1574 0.103904C35.323 0.172502 35.4734 0.273047 35.6002 0.399799C35.727 0.526551 35.8275 0.677028 35.8961 0.842637C35.9647 1.00825 36 1.18575 36 1.365V22.635Z" fill="#E6E7E8"/>
<path d="M22.635 12H12V22.635C12 22.997 12.1438 23.3442 12.3998 23.6002C12.6558 23.8562 13.003 24 13.365 24H24V13.365C24 13.003 23.8562 12.6558 23.6002 12.3998C23.3442 12.1438 22.997 12 22.635 12Z" fill="#BCBEC0"/>
<path d="M28.635 6H12V12H22.635C22.997 12 23.3442 12.1438 23.6002 12.3998C23.8562 12.6558 24 13.003 24 13.365V24H30V7.365C30 7.00298 29.8562 6.65579 29.6002 6.3998C29.3442 6.14381 28.997 6 28.635 6Z" fill="#D1D3D4"/>
</svg>

After

Width:  |  Height:  |  Size: 2.3 KiB

35
images/Copilot.svg Normal file
View File

@@ -0,0 +1,35 @@
<svg width="40" height="40" viewBox="0 0 40 40" fill="none" xmlns="http://www.w3.org/2000/svg">
<rect width="40" height="40" fill="white"/>
<path d="M17 3.73926L20 4.04436V12.6862L15.2 13.8013L13.6 15.9967V19.4479C13.6 21.7669 14.8545 23.9045 16.879 25.0353L21.4036 27.5626L13.6 31.69L10.3559 32.1523L7.27902 30.4337C5.25445 29.3028 4 27.1652 4 24.8462V14.7591C4 12.4395 5.25512 10.3015 7.28055 9.17085L16.3174 4.12639L16.3121 4.13012L17 3.73926Z" fill="url(#paint0_radial_420_101763)"/>
<path d="M17 3.73926L20 4.04436V12.6862L15.2 13.8013L13.6 15.9967V19.4479C13.6 21.7669 14.8545 23.9045 16.879 25.0353L21.4036 27.5626L13.6 31.69L10.3559 32.1523L7.27902 30.4337C5.25445 29.3028 4 27.1652 4 24.8462V14.7591C4 12.4395 5.25512 10.3015 7.28055 9.17085L16.3174 4.12639L16.3121 4.13012L17 3.73926Z" fill="url(#paint1_linear_420_101763)"/>
<path d="M26.399 15.001L34.399 19.801L35.999 21.401V24.8452C35.999 27.1642 34.7446 29.3018 32.72 30.4327L23.12 35.7949C21.1804 36.8784 18.8177 36.8784 16.878 35.7949L7.27804 30.4327C7.09146 30.3284 6.91141 30.2157 6.73828 30.095L7.278 30.3965C9.21762 31.4799 11.5803 31.4799 13.52 30.3965L23.12 25.0342C25.1445 23.9033 26.399 21.7657 26.399 19.4467V15.001Z" fill="url(#paint2_radial_420_101763)"/>
<path d="M26.399 15.001L34.399 19.801L35.999 21.401V24.8452C35.999 27.1642 34.7446 29.3018 32.72 30.4327L23.12 35.7949C21.1804 36.8784 18.8177 36.8784 16.878 35.7949L7.27804 30.4327C7.09146 30.3284 6.91141 30.2157 6.73828 30.095L7.278 30.3965C9.21762 31.4799 11.5803 31.4799 13.52 30.3965L23.12 25.0342C25.1445 23.9033 26.399 21.7657 26.399 19.4467V15.001Z" fill="url(#paint3_linear_420_101763)"/>
<path d="M32.7191 9.17053L23.119 3.8117C21.1802 2.72943 18.819 2.72943 16.8802 3.8117L16.3151 4.1271C14.6239 5.31737 13.5996 7.26472 13.5996 9.36025V16.0461L16.8802 14.2149C18.819 13.1326 21.1802 13.1326 23.119 14.2149L32.7191 19.5737C34.6984 20.6786 35.9421 22.7456 35.9977 25.0039C35.999 24.9514 35.9996 24.8987 35.9996 24.8459V14.7588C35.9996 12.4392 34.7445 10.3011 32.7191 9.17053Z" fill="url(#paint4_radial_420_101763)"/>
<path d="M32.7191 9.17053L23.119 3.8117C21.1802 2.72943 18.819 2.72943 16.8802 3.8117L16.3151 4.1271C14.6239 5.31737 13.5996 7.26472 13.5996 9.36025V16.0461L16.8802 14.2149C18.819 13.1326 21.1802 13.1326 23.119 14.2149L32.7191 19.5737C34.6984 20.6786 35.9421 22.7456 35.9977 25.0039C35.999 24.9514 35.9996 24.8987 35.9996 24.8459V14.7588C35.9996 12.4392 34.7445 10.3011 32.7191 9.17053Z" fill="url(#paint5_linear_420_101763)"/>
<defs>
<radialGradient id="paint0_radial_420_101763" cx="0" cy="0" r="1" gradientUnits="userSpaceOnUse" gradientTransform="translate(17.5054 12.8837) rotate(112.544) scale(23.4519 19.3067)">
<stop offset="0.206732" stop-color="#45D586"/>
<stop offset="0.875628" stop-color="#128245"/>
</radialGradient>
<linearGradient id="paint1_linear_420_101763" x1="15.0625" y1="29.6174" x2="13.787" y2="27.2436" gradientUnits="userSpaceOnUse">
<stop offset="0.9999" stop-color="#0F773F"/>
<stop offset="1" stop-color="#0078D4" stop-opacity="0"/>
</linearGradient>
<radialGradient id="paint2_radial_420_101763" cx="0" cy="0" r="1" gradientUnits="userSpaceOnUse" gradientTransform="translate(10.899 27.5214) rotate(-3.9995) scale(24.6197 15.4594)">
<stop offset="0.140029" stop-color="#FBFF47"/>
<stop offset="0.952721" stop-color="#54B228"/>
</radialGradient>
<linearGradient id="paint3_linear_420_101763" x1="30.8932" y1="18.5508" x2="29.5491" y2="20.8921" gradientUnits="userSpaceOnUse">
<stop offset="0.9999" stop-color="#27770B"/>
<stop offset="1" stop-color="#8C66BA" stop-opacity="0"/>
</linearGradient>
<radialGradient id="paint4_radial_420_101763" cx="0" cy="0" r="1" gradientUnits="userSpaceOnUse" gradientTransform="translate(30.632 19.3878) rotate(-138.33) scale(22.8015 13.0047)">
<stop stop-color="#95FEA0"/>
<stop offset="0.839255" stop-color="#10B7B7"/>
</radialGradient>
<linearGradient id="paint5_linear_420_101763" x1="13.5996" y1="11.7134" x2="16.2131" y2="11.7134" gradientUnits="userSpaceOnUse">
<stop offset="0.9999" stop-color="#0A7B7B"/>
<stop offset="1" stop-color="#436DCD" stop-opacity="0"/>
</linearGradient>
</defs>
</svg>

After

Width:  |  Height:  |  Size: 4.0 KiB

View File

@@ -0,0 +1,3 @@
<svg width="16" height="16" viewBox="0 0 16 16" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M13.3626 11.9771C13.1573 11.9837 13.019 12.0288 12.9215 12.0836C12.817 12.1424 12.7301 12.229 12.6508 12.3542C12.4802 12.6239 12.3837 12.9957 12.252 13.5033L12.2347 13.5699C12.1079 14.0581 11.9424 14.6764 11.5775 15.1594C11.1788 15.687 10.5903 16 9.74835 16H4.63681C3.55423 16 2.75741 15.2435 2.18373 14.3271C1.60629 13.4047 1.17786 12.2045 0.845481 11.0542L0.845003 11.0525C0.464365 9.73512 -0.017355 8.06787 0.000479698 6.72244C0.00951195 6.04103 0.145994 5.34953 0.569528 4.825C1.00712 4.28305 1.66518 4.02294 2.50365 4.02294H2.63739C2.84267 4.01631 2.98102 3.97123 3.07848 3.9164C3.18305 3.85757 3.26995 3.77102 3.34916 3.64584C3.51985 3.37613 3.61631 3.00432 3.74801 2.49671L3.76529 2.43012C3.89213 1.94191 4.05757 1.32365 4.42251 0.840633C4.82119 0.312966 5.40972 0 6.25165 0H11.3632C12.4458 0 13.2426 0.756543 13.8163 1.67295C14.3937 2.59534 14.8221 3.79546 15.1545 4.94582L15.155 4.94748C15.5356 6.26488 16.0174 7.93213 15.9995 9.27756C15.9905 9.95897 15.854 10.6505 15.4305 11.175C14.9929 11.717 14.3348 11.9771 13.4963 11.9771H13.3626ZM14.1354 5.28381C13.8114 4.16251 13.4194 3.09096 12.9303 2.3096C12.4374 1.52225 11.9215 1.14296 11.3632 1.14296H7.95613C8.10274 1.42082 8.22537 1.731 8.33548 2.05199C8.48008 2.47355 8.61427 2.94842 8.75233 3.43699L8.78302 3.54557C9.32758 5.47082 10.008 7.94794 10.4498 9.5646C10.6507 10.2998 11.2693 10.8098 11.9798 10.8333H13.4156C13.4253 10.8333 13.4351 10.8335 13.4447 10.8341H13.4963C14.1298 10.8341 14.4484 10.6443 14.6237 10.4272C14.813 10.1928 14.9255 9.8162 14.9328 9.26133C14.9477 8.13479 14.5323 6.65749 14.1354 5.28381ZM3.06972 13.6904C3.56261 14.4777 4.0785 14.857 4.63681 14.857H8.04387C7.89726 14.5792 7.77463 14.269 7.66452 13.948C7.51992 13.5265 7.38573 13.0516 7.24767 12.563L7.21698 12.4544C6.67242 10.5292 5.99197 8.05206 5.55019 6.4354C5.34929 5.70024 4.73069 5.19015 4.02018 5.16674H2.58445C2.57465 5.16674 2.56492 5.16646 2.55526 5.1659H2.50365C1.87025 5.1659 1.5516 5.35572 1.37634 5.57277C1.18703 5.80723 1.07454 6.1838 1.06719 6.73867C1.05225 7.86521 1.46769 9.34251 1.86459 10.7162C2.18857 11.8375 2.58057 12.909 3.06972 13.6904ZM9.10298 10.8333H9.87304C9.67506 10.5554 9.5217 10.236 9.42598 9.88575C9.233 9.17956 8.99466 8.30985 8.74215 7.39421L8.47331 6.42622C8.26579 5.67902 7.62465 5.16674 6.89702 5.16674H6.12695C6.32494 5.44463 6.4783 5.76395 6.57402 6.11425C6.767 6.82044 7.00534 7.69015 7.25785 8.60579L7.52669 9.57378C7.73421 10.321 8.37535 10.8333 9.10298 10.8333ZM6.89702 4.02378C7.23212 4.02378 7.55609 4.08968 7.85646 4.21152C7.82459 4.0984 7.7931 3.98682 7.76205 3.87706L7.73417 3.77844C7.59304 3.27914 7.46754 2.83514 7.33414 2.44626C7.19129 2.02979 7.05211 1.71602 6.90214 1.4942C6.77014 1.29897 6.56087 1.14296 6.25165 1.14296C5.69009 1.14296 5.42306 1.33297 5.2517 1.55976C5.04661 1.83121 4.92755 2.21889 4.79304 2.73662C4.78284 2.77588 4.77249 2.81622 4.76191 2.85744C4.66966 3.21703 4.55997 3.64464 4.37733 4.02378H6.89702ZM9.10298 11.9762C8.76788 11.9762 8.44391 11.9103 8.14354 11.7885C8.1754 11.9016 8.2069 12.0132 8.23795 12.1229L8.26583 12.2216C8.40696 12.7208 8.53246 13.1649 8.66585 13.5537C8.80871 13.9702 8.94789 14.284 9.09786 14.5058C9.22986 14.701 9.43913 14.857 9.74835 14.857C10.3099 14.857 10.5769 14.667 10.7483 14.4402C10.9534 14.1688 11.0725 13.7811 11.207 13.2634C11.2172 13.2241 11.2275 13.1838 11.2381 13.1426C11.3303 12.783 11.44 12.3554 11.6227 11.9762H9.10298Z" fill="#0078D4"/>
</svg>

After

Width:  |  Height:  |  Size: 3.4 KiB

3
images/CopilotCopy.svg Normal file
View File

@@ -0,0 +1,3 @@
<svg width="19" height="17" viewBox="0 0 19 17" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M7 0C5.89543 0 5 0.895431 5 2V12C5 13.1046 5.89543 14 7 14H13C14.1046 14 15 13.1046 15 12V2C15 0.89543 14.1046 0 13 0H7ZM6 2C6 1.44772 6.44772 1 7 1H13C13.5523 1 14 1.44772 14 2V12C14 12.5523 13.5523 13 13 13H7C6.44772 13 6 12.5523 6 12V2ZM3 4.00001C3 3.25973 3.4022 2.61339 4 2.26758V12.5C4 13.8807 5.11929 15 6.5 15H12.7324C12.3866 15.5978 11.7403 16 11 16H6.5C4.567 16 3 14.433 3 12.5V4.00001Z" fill="#242424"/>
</svg>

After

Width:  |  Height:  |  Size: 527 B

View File

@@ -0,0 +1,3 @@
<svg width="12" height="14" viewBox="0 0 12 14" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M10 2.5C10 3.88071 7.76142 5 5 5C2.23858 5 0 3.88071 0 2.5C0 1.11929 2.23858 0 5 0C7.76142 0 10 1.11929 10 2.5ZM0 11.5V4.487C1.057 5.413 2.864 6 5 6C7.136 6 8.943 5.413 10 4.487V11.5C10 12.925 7.851 14 5 14C2.149 14 0 12.925 0 11.5Z" fill="#0078D4"/>
</svg>

After

Width:  |  Height:  |  Size: 363 B

View File

@@ -0,0 +1,3 @@
<svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M9.25028 7.30723C9.08872 7.49072 9.00001 7.74463 9.00001 8C9.00001 8.27614 8.77615 8.5 8.50001 8.5C8.22387 8.5 8.00001 8.27614 8.00001 8C8.00001 7.52689 8.1613 7.0308 8.49974 6.64641C8.84684 6.25219 9.3597 6 10 6C10.6403 6 11.1532 6.25219 11.5003 6.64641C11.8387 7.0308 12 7.52689 12 8C12 8.48947 11.8839 8.86964 11.6976 9.18921C11.5347 9.46855 11.3225 9.68963 11.1528 9.86652L11.1115 9.90956C10.9247 10.1051 10.7821 10.2639 10.6773 10.4641C10.5773 10.6551 10.5 10.9085 10.5 11.2929C10.5 11.5691 10.2762 11.7929 10 11.7929C9.72387 11.7929 9.50001 11.5691 9.50001 11.2929C9.50001 10.7611 9.61018 10.3464 9.79143 10.0002C9.96788 9.66319 10.2003 9.41576 10.3885 9.21878L10.4106 9.19559C10.5985 8.99908 10.7328 8.85858 10.8337 8.68547C10.9286 8.52273 11 8.31707 11 8C11 7.74463 10.9113 7.49072 10.7497 7.30723C10.5968 7.13358 10.3597 7 10 7C9.64033 7 9.40318 7.13358 9.25028 7.30723ZM9.99991 14.2122C10.3863 14.2122 10.6995 13.899 10.6995 13.5126C10.6995 13.1262 10.3863 12.813 9.99991 12.813C9.61353 12.813 9.3003 13.1262 9.3003 13.5126C9.3003 13.899 9.61353 14.2122 9.99991 14.2122ZM2.00001 10C2.00001 5.58172 5.58173 2 10 2C14.4183 2 18 5.58172 18 10C18 14.4183 14.4183 18 10 18C8.65078 18 7.37829 17.6656 6.26225 17.0748L2.62128 17.9851C2.45089 18.0277 2.27065 17.9777 2.14646 17.8536C2.02227 17.7294 1.97234 17.5491 2.01494 17.3787L2.92518 13.7378C2.33442 12.6217 2.00001 11.3492 2.00001 10ZM10 3C6.13402 3 3.00001 6.13401 3.00001 10C3.00001 11.245 3.32462 12.4128 3.89345 13.4247C3.95602 13.536 3.97363 13.6671 3.94266 13.791L3.18719 16.8128L6.20904 16.0574C6.33294 16.0264 6.46399 16.044 6.57531 16.1066C7.58726 16.6754 8.75497 17 10 17C13.866 17 17 13.866 17 10C17 6.13401 13.866 3 10 3Z" fill="#424242"/>
</svg>

After

Width:  |  Height:  |  Size: 1.8 KiB

3
images/CopilotFlash.svg Normal file
View File

@@ -0,0 +1,3 @@
<svg width="12" height="14" viewBox="0 0 12 14" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M4.21207 0C3.73772 0 3.32085 0.314446 3.19054 0.770537L0.940937 8.64415C0.747029 9.32283 1.25663 9.99841 1.96246 9.99841H3.22974L2.06002 14.6773C1.79611 15.7329 3.10089 16.4551 3.85526 15.6726L12.5318 6.81506L12.5354 6.81137C13.1762 6.1436 12.7152 5 11.7688 5H9.20509L10.4665 1.40582L10.469 1.39836C10.6983 0.710426 10.1863 0 9.46114 0H4.21207Z" fill="#0078D4"/>
</svg>

After

Width:  |  Height:  |  Size: 475 B

3
images/CopilotInsert.svg Normal file
View File

@@ -0,0 +1,3 @@
<svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M6 4C4.89543 4 4 4.89543 4 6V7C4 8.10457 4.89543 9 6 9H14C15.1046 9 16 8.10457 16 7V6C16 4.89543 15.1046 4 14 4H6ZM5 6C5 5.44772 5.44772 5 6 5H14C14.5523 5 15 5.44772 15 6V7C15 7.55228 14.5523 8 14 8H6C5.44772 8 5 7.55228 5 7V6ZM6 11C4.89543 11 4 11.8954 4 13V14C4 15.1046 4.89543 16 6 16H14C15.1046 16 16 15.1046 16 14V13C16 11.8954 15.1046 11 14 11H6ZM5 13C5 12.4477 5.44772 12 6 12H14C14.5523 12 15 12.4477 15 13V14C15 14.5523 14.5523 15 14 15H6C5.44772 15 5 14.5523 5 14V13Z" fill="#242424"/>
</svg>

After

Width:  |  Height:  |  Size: 609 B

View File

@@ -0,0 +1,3 @@
<svg width="16" height="18" viewBox="0 0 16 18" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M10.4829 0.703737C9.68406 -0.133389 8.39129 0.316883 8.05198 1.29418C7.77205 2.10043 7.4084 3.06594 7.05406 3.77684C5.99442 5.90276 5.37583 7.11234 3.66974 8.62586C3.44337 8.82668 3.15163 8.9885 2.82905 9.11601C1.69991 9.56233 0.638089 10.7321 0.915812 12.1207L1.26885 13.8859C1.45455 14.8144 2.14894 15.5583 3.06251 15.8075L8.66224 17.3347C11.2078 18.0289 13.8017 16.3942 14.2737 13.7983L14.9576 10.0365C15.2924 8.19503 13.8777 6.49989 12.006 6.49989H11.1225L11.1328 6.44766C11.2129 6.03948 11.3093 5.47735 11.3738 4.86473C11.438 4.25446 11.4721 3.58034 11.4218 2.9522C11.3725 2.33584 11.2379 1.70305 10.9176 1.22254C10.8081 1.05832 10.6455 0.874161 10.4829 0.703737Z" fill="#605E5C"/>
</svg>

After

Width:  |  Height:  |  Size: 799 B

View File

@@ -0,0 +1,3 @@
<svg width="16" height="18" viewBox="0 0 16 18" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M10.4829 0.703737C9.68406 -0.133389 8.39129 0.316883 8.05198 1.29418C7.77205 2.10043 7.4084 3.06594 7.05406 3.77684C5.99442 5.90276 5.37583 7.11234 3.66974 8.62586C3.44337 8.82668 3.15163 8.9885 2.82905 9.11601C1.69991 9.56233 0.638089 10.7321 0.915812 12.1207L1.26885 13.8859C1.45455 14.8144 2.14894 15.5583 3.06251 15.8075L8.66224 17.3347C11.2078 18.0289 13.8017 16.3942 14.2737 13.7983L14.9576 10.0365C15.2924 8.19503 13.8777 6.49989 12.006 6.49989H11.1225L11.1328 6.44766C11.2129 6.03948 11.3093 5.47735 11.3738 4.86473C11.438 4.25446 11.4721 3.58034 11.4218 2.9522C11.3725 2.33584 11.2379 1.70305 10.9176 1.22254C10.8081 1.05832 10.6455 0.874161 10.4829 0.703737Z" fill="#0078D4"/>
</svg>

After

Width:  |  Height:  |  Size: 799 B

View File

@@ -0,0 +1,3 @@
<svg width="15" height="18" viewBox="0 0 15 18" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M7.55198 1.29418C7.89129 0.316883 9.18406 -0.133389 9.98289 0.703737C10.1455 0.874162 10.3081 1.05832 10.4176 1.22254C10.7379 1.70305 10.8725 2.33584 10.9218 2.9522C10.9721 3.58034 10.938 4.25446 10.8738 4.86473C10.8093 5.47735 10.7129 6.03948 10.6328 6.44766C10.6294 6.46535 10.6259 6.48277 10.6225 6.49989H11.506C13.3777 6.49989 14.7924 8.19503 14.4576 10.0365L13.7737 13.7983C13.3017 16.3942 10.7078 18.0289 8.16224 17.3347L2.56251 15.8075C1.64894 15.5583 0.954555 14.8144 0.768846 13.8859L0.415812 12.1207C0.138089 10.7321 1.19991 9.56233 2.32905 9.11601C2.65163 8.9885 2.94337 8.82668 3.16974 8.62586C4.87583 7.11234 5.49442 5.90276 6.55406 3.77684C6.9084 3.06594 7.27205 2.10043 7.55198 1.29418ZM9.51651 6.87851L9.51689 6.87696L9.51869 6.86962L9.5262 6.83852C9.53284 6.81068 9.54264 6.76892 9.55487 6.71482C9.57935 6.60658 9.61349 6.44919 9.65152 6.25525C9.72773 5.86655 9.81878 5.33493 9.8793 4.76005C9.94006 4.18282 9.96852 3.57569 9.92502 3.03195C9.88058 2.47644 9.76518 2.04673 9.58552 1.77724C9.52643 1.68859 9.41385 1.55593 9.25942 1.3941C9.06051 1.18565 8.63137 1.23417 8.49666 1.62217C8.21411 2.43598 7.83339 3.45183 7.44904 4.22294C6.38216 6.36338 5.69326 7.72396 3.83336 9.37392C3.49304 9.67583 3.08878 9.89099 2.69665 10.046C1.81631 10.394 1.25035 11.1944 1.39639 11.9246L1.74943 13.6898C1.86085 14.2469 2.27748 14.6932 2.82562 14.8427L8.42536 16.3699C10.4052 16.9099 12.4227 15.6384 12.7898 13.6194L13.4738 9.85766C13.697 8.62998 12.7538 7.49989 11.506 7.49989H10.0015C9.84758 7.49989 9.7022 7.42895 9.60745 7.3076C9.51272 7.18627 9.47921 7.02785 9.51651 6.87851C9.51651 6.87847 9.5165 6.87855 9.51651 6.87851Z" fill="#424242"/>
</svg>

After

Width:  |  Height:  |  Size: 1.7 KiB

View File

@@ -0,0 +1,3 @@
<svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M5 2.5C5 2.22386 4.77614 2 4.5 2C4.22386 2 4 2.22386 4 2.5V4H2.5C2.22386 4 2 4.22386 2 4.5C2 4.77614 2.22386 5 2.5 5H4.5C4.77614 5 5 4.77614 5 4.5V2.5ZM16 2.5C16 2.22386 15.7761 2 15.5 2C15.2239 2 15 2.22386 15 2.5V4.5C15 4.77614 15.2239 5 15.5 5H17.5C17.7761 5 18 4.77614 18 4.5C18 4.22386 17.7761 4 17.5 4H16V2.5ZM7 5C6.44771 5 6 5.44772 6 6V14C6 14.5523 6.44772 15 7 15H13C13.5523 15 14 14.5523 14 14V6C14 5.44772 13.5523 5 13 5H7ZM7 6H13V14H7V6ZM4.5 18C4.77614 18 5 17.7761 5 17.5V15.5C5 15.2239 4.77614 15 4.5 15H2.5C2.22386 15 2 15.2239 2 15.5C2 15.7761 2.22386 16 2.5 16H4V17.5C4 17.7761 4.22386 18 4.5 18ZM15.5 18C15.7761 18 16 17.7761 16 17.5V16H17.5C17.7761 16 18 15.7761 18 15.5C18 15.2239 17.7761 15 17.5 15H15.5C15.2239 15 15 15.2239 15 15.5V17.5C15 17.7761 15.2239 18 15.5 18ZM8.5 8C8.22386 8 8 8.22386 8 8.5C8 8.77614 8.22386 9 8.5 9H11.5C11.7761 9 12 8.77614 12 8.5C12 8.22386 11.7761 8 11.5 8H8.5ZM8.5 10C8.22386 10 8 10.2239 8 10.5C8 10.7761 8.22386 11 8.5 11H10.5C10.7761 11 11 10.7761 11 10.5C11 10.2239 10.7761 10 10.5 10H8.5Z" fill="#424242"/>
</svg>

After

Width:  |  Height:  |  Size: 1.2 KiB

View File

@@ -0,0 +1,3 @@
<svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M9.14645 2.64645C9.34171 2.45118 9.65829 2.45118 9.85355 2.64645L11.3536 4.14645C11.5488 4.34171 11.5488 4.65829 11.3536 4.85355L9.85355 6.35355C9.65829 6.54882 9.34171 6.54882 9.14645 6.35355C8.95118 6.15829 8.95118 5.84171 9.14645 5.64645L9.7885 5.00439C7.12517 5.11522 5 7.30943 5 10C5 11.568 5.72118 12.9672 6.85185 13.8847C7.06627 14.0587 7.09904 14.3736 6.92503 14.588C6.75103 14.8024 6.43615 14.8352 6.22172 14.6612C4.86712 13.5619 4 11.882 4 10C4 6.75447 6.57689 4.1108 9.79629 4.00339L9.14645 3.35355C8.95118 3.15829 8.95118 2.84171 9.14645 2.64645ZM13.075 5.41199C13.249 5.19756 13.5639 5.1648 13.7783 5.3388C15.1329 6.43806 16 8.11795 16 10C16 13.2455 13.4231 15.8892 10.2037 15.9966L10.8536 16.6464C11.0488 16.8417 11.0488 17.1583 10.8536 17.3536C10.6583 17.5488 10.3417 17.5488 10.1464 17.3536L8.64645 15.8536C8.55268 15.7598 8.5 15.6326 8.5 15.5C8.5 15.3674 8.55268 15.2402 8.64645 15.1464L10.1464 13.6464C10.3417 13.4512 10.6583 13.4512 10.8536 13.6464C11.0488 13.8417 11.0488 14.1583 10.8536 14.3536L10.2115 14.9956C12.8748 14.8848 15 12.6906 15 10C15 8.43201 14.2788 7.03283 13.1482 6.1153C12.9337 5.94129 12.901 5.62641 13.075 5.41199Z" fill="#242424"/>
</svg>

After

Width:  |  Height:  |  Size: 1.3 KiB

View File

@@ -0,0 +1,34 @@
<svg width="20" height="22" viewBox="0 0 20 22" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M7.79997 1.36139L9.59997 1.54445V6.72957L6.71997 7.39864L5.75998 8.71588V10.7866C5.75998 12.178 6.51265 13.4605 7.72739 14.139L10.4421 15.6554L5.75997 18.1318L3.81352 18.4092L1.96738 17.378C0.75264 16.6995 -3.05176e-05 15.417 -3.05176e-05 14.0256V7.97332C-3.05176e-05 6.58155 0.753043 5.29871 1.9683 4.62034L7.3904 1.59367L7.38722 1.59591L7.79997 1.36139Z" fill="url(#paint0_radial_1157_162756)"/>
<path d="M7.79997 1.36139L9.59997 1.54445V6.72957L6.71997 7.39864L5.75998 8.71588V10.7866C5.75998 12.178 6.51265 13.4605 7.72739 14.139L10.4421 15.6554L5.75997 18.1318L3.81352 18.4092L1.96738 17.378C0.75264 16.6995 -3.05176e-05 15.417 -3.05176e-05 14.0256V7.97332C-3.05176e-05 6.58155 0.753043 5.29871 1.9683 4.62034L7.3904 1.59367L7.38722 1.59591L7.79997 1.36139Z" fill="url(#paint1_linear_1157_162756)"/>
<path d="M13.4397 8.11841L18.2397 10.9984L19.1997 11.9584V14.025C19.1997 15.4164 18.447 16.6989 17.2323 17.3774L11.4723 20.5948C10.3085 21.2448 8.89088 21.2448 7.72711 20.5948L1.96711 17.3774C1.85515 17.3149 1.74713 17.2472 1.64325 17.1748L1.96708 17.3557C3.13085 18.0057 4.54849 18.0057 5.71226 17.3557L11.4723 14.1383C12.687 13.4598 13.4397 12.1773 13.4397 10.7859V8.11841Z" fill="url(#paint2_radial_1157_162756)"/>
<path d="M13.4397 8.11841L18.2397 10.9984L19.1997 11.9584V14.025C19.1997 15.4164 18.447 16.6989 17.2323 17.3774L11.4723 20.5948C10.3085 21.2448 8.89088 21.2448 7.72711 20.5948L1.96711 17.3774C1.85515 17.3149 1.74713 17.2472 1.64325 17.1748L1.96708 17.3557C3.13085 18.0057 4.54849 18.0057 5.71226 17.3557L11.4723 14.1383C12.687 13.4598 13.4397 12.1773 13.4397 10.7859V8.11841Z" fill="url(#paint3_linear_1157_162756)"/>
<path d="M17.2316 4.62014L11.4716 1.40484C10.3083 0.755475 8.89151 0.755475 7.72821 1.40484L7.38921 1.59407C6.37448 2.30824 5.75989 3.47665 5.75989 4.73397V8.74548L7.72821 7.64674C8.89151 6.99738 10.3083 6.99738 11.4716 7.64674L17.2316 10.862C18.4192 11.525 19.1654 12.7652 19.1987 14.1202C19.1995 14.0886 19.1999 14.057 19.1999 14.0254V7.97311C19.1999 6.58134 18.4468 5.29851 17.2316 4.62014Z" fill="url(#paint4_radial_1157_162756)"/>
<path d="M17.2316 4.62014L11.4716 1.40484C10.3083 0.755475 8.89151 0.755475 7.72821 1.40484L7.38921 1.59407C6.37448 2.30824 5.75989 3.47665 5.75989 4.73397V8.74548L7.72821 7.64674C8.89151 6.99738 10.3083 6.99738 11.4716 7.64674L17.2316 10.862C18.4192 11.525 19.1654 12.7652 19.1987 14.1202C19.1995 14.0886 19.1999 14.057 19.1999 14.0254V7.97311C19.1999 6.58134 18.4468 5.29851 17.2316 4.62014Z" fill="url(#paint5_linear_1157_162756)"/>
<defs>
<radialGradient id="paint0_radial_1157_162756" cx="0" cy="0" r="1" gradientUnits="userSpaceOnUse" gradientTransform="translate(8.1032 6.84805) rotate(112.544) scale(14.0711 11.584)">
<stop offset="0.206732" stop-color="#4995D0"/>
<stop offset="0.875628" stop-color="#0078D4"/>
</radialGradient>
<linearGradient id="paint1_linear_1157_162756" x1="6.63744" y1="16.8883" x2="5.87214" y2="15.464" gradientUnits="userSpaceOnUse">
<stop offset="0.9999" stop-color="#0078D4"/>
<stop offset="1" stop-color="#0078D4" stop-opacity="0"/>
</linearGradient>
<radialGradient id="paint2_radial_1157_162756" cx="0" cy="0" r="1" gradientUnits="userSpaceOnUse" gradientTransform="translate(4.13968 15.6306) rotate(-3.9995) scale(14.7718 9.27561)">
<stop offset="0.140029" stop-color="#80C8FF"/>
<stop offset="0.952721" stop-color="#0078D4"/>
</radialGradient>
<linearGradient id="paint3_linear_1157_162756" x1="16.1362" y1="10.2483" x2="15.3298" y2="11.6531" gradientUnits="userSpaceOnUse">
<stop offset="0.9999" stop-color="#3F8AC3"/>
<stop offset="1" stop-color="#8C66BA" stop-opacity="0"/>
</linearGradient>
<radialGradient id="paint4_radial_1157_162756" cx="0" cy="0" r="1" gradientUnits="userSpaceOnUse" gradientTransform="translate(15.9793 10.7505) rotate(-138.33) scale(13.6809 7.80282)">
<stop stop-color="#7BC6FF"/>
<stop offset="0.839255" stop-color="#0078D4"/>
</radialGradient>
<linearGradient id="paint5_linear_1157_162756" x1="5.75989" y1="6.14584" x2="7.32799" y2="6.14584" gradientUnits="userSpaceOnUse">
<stop offset="0.9999" stop-color="#0078D4"/>
<stop offset="1" stop-color="#436DCD" stop-opacity="0"/>
</linearGradient>
</defs>
</svg>

After

Width:  |  Height:  |  Size: 4.2 KiB

View File

@@ -0,0 +1,29 @@
<svg width="121" height="94" viewBox="0 0 121 94" fill="none" xmlns="http://www.w3.org/2000/svg">
<path opacity="0.3" d="M3.25029 80.7474H97.1699C97.8805 80.7474 98.5648 80.471 99.078 79.9578C99.5913 79.4446 99.8676 78.7603 99.8676 78.0497V13.8575C99.8676 12.3704 98.3148 11.0018 96.2224 11.0018L4.53992 12.3968C4.18461 12.3968 3.84247 12.4626 3.51348 12.5942C3.18449 12.7389 2.89498 12.9231 2.64495 13.1863C2.39492 13.4364 2.19752 13.7259 2.05277 14.0549C1.90801 14.3838 1.85538 14.7392 1.85538 15.0813L0.552582 78.076C0.552582 78.7866 0.82893 79.4709 1.34215 79.971C1.85537 80.471 2.53967 80.7474 3.25029 80.7474Z" fill="#1F1D20"/>
<path d="M96.9332 9.80411H2.67139C1.19752 9.80411 0 11.0016 0 12.4755V76.7993C0 78.2732 1.19752 79.4707 2.67139 79.4707H96.9463C98.4202 79.4707 99.6177 78.2732 99.6177 76.7993V12.4755C99.6045 11.0016 98.407 9.80411 96.9332 9.80411Z" fill="url(#paint0_linear_1157_163007)"/>
<path d="M95.6963 13.7121H50.1379V74.904H95.6963V13.7121Z" fill="white"/>
<path d="M50.7829 13.7121H5.22461V74.904H50.7829V13.7121Z" fill="#CDCDD0"/>
<path d="M14.3309 0V60.6918C14.3309 60.6918 26.4903 59.4811 36.3468 64.4291C46.2165 69.3771 50.7829 74.8514 50.7829 74.8514V14.1465C50.7829 14.1465 45.0979 6.90876 36.3468 4.23737C29.2275 2.05289 14.3309 0 14.3309 0Z" fill="#EAEAEA"/>
<path d="M59.1387 42.9135L56.2699 41.6633L53.388 42.9135V9.80411H59.1387V42.9135Z" fill="url(#paint1_linear_1157_163007)"/>
<path opacity="0.15" d="M86.7212 25.6883H66.7713C65.9028 25.6883 65.2053 26.3989 65.2053 27.2543C65.2053 28.1228 65.9159 28.8202 66.7713 28.8202H86.7212C87.5897 28.8202 88.2872 28.1096 88.2872 27.2543C88.3003 26.3857 87.5897 25.6883 86.7212 25.6883Z" fill="#1F1D20"/>
<path opacity="0.15" d="M86.7212 32.5045H66.7713C65.9028 32.5045 65.2053 33.2151 65.2053 34.0705C65.2053 34.939 65.9159 35.6365 66.7713 35.6365H86.7212C87.5897 35.6365 88.2872 34.9258 88.2872 34.0705C88.3003 33.2019 87.5897 32.5045 86.7212 32.5045Z" fill="#1F1D20"/>
<path opacity="0.15" fill-rule="evenodd" clip-rule="evenodd" d="M66.7715 39.3336H86.695C87.5636 39.3336 88.261 40.0442 88.261 40.8995C88.261 41.7681 87.5504 42.4655 86.695 42.4655H66.7715C65.903 42.4655 65.2055 41.7549 65.2055 40.8995C65.1923 40.0442 65.8898 39.3336 66.7715 39.3336Z" fill="#1F1D20"/>
<path d="M86.7212 25.1614H66.7713C65.9028 25.1614 65.2053 25.872 65.2053 26.7273C65.2053 27.5959 65.9159 28.2933 66.7713 28.2933H86.7212C87.5897 28.2933 88.2872 27.5827 88.2872 26.7273C88.3003 25.8588 87.5897 25.1614 86.7212 25.1614Z" fill="#50E6FF"/>
<path d="M86.7212 31.9917H66.7713C65.9028 31.9917 65.2053 32.7023 65.2053 33.5577C65.2053 34.4262 65.9159 35.1237 66.7713 35.1237H86.7212C87.5897 35.1237 88.2872 34.4131 88.2872 33.5577C88.3003 32.6892 87.5897 31.9917 86.7212 31.9917Z" fill="#32B0E7"/>
<path fill-rule="evenodd" clip-rule="evenodd" d="M66.7715 38.808H86.695C87.5636 38.808 88.261 39.5186 88.261 40.3739C88.261 41.2425 87.5504 41.9399 86.695 41.9399H66.7715C65.903 41.9531 65.2055 41.2293 65.2055 40.3739C65.1923 39.5186 65.8898 38.808 66.7715 38.808Z" fill="#185A97"/>
<path opacity="0.2" d="M120.295 60.2875H80.476V85.9653C80.476 87.0514 81.3515 87.9269 82.4375 87.9269H86.6156V94L92.733 87.9269H118.333C119.419 87.9269 120.295 87.0514 120.295 85.9653V60.2875Z" fill="#1F1D21"/>
<path d="M118.965 58.6804H81.8058C81.0744 58.6804 80.476 59.2788 80.476 60.0103V84.9898C80.476 85.7213 81.0744 86.3197 81.8058 86.3197H86.6156V92.3928L92.733 86.3197H118.965C119.696 86.3197 120.295 85.7213 120.295 84.9898V60.0103C120.295 59.2788 119.696 58.6804 118.965 58.6804Z" fill="#49C8EF"/>
<path d="M106.564 67.8017H94.1846C93.697 67.8017 93.298 68.2006 93.298 68.6883C93.298 69.1759 93.697 69.5748 94.1846 69.5748H106.564C107.051 69.5748 107.45 69.1759 107.45 68.6883C107.45 68.2006 107.051 67.8017 106.564 67.8017Z" fill="#C3F1FF"/>
<path d="M106.564 71.6913H94.1846C93.697 71.6913 93.298 72.0903 93.298 72.5779C93.298 73.0655 93.697 73.4645 94.1846 73.4645H106.564C107.051 73.4645 107.45 73.0655 107.45 72.5779C107.45 72.1014 107.051 71.6913 106.564 71.6913Z" fill="#C3F1FF"/>
<path d="M106.564 75.6026H94.1846C93.697 75.6026 93.298 76.0016 93.298 76.4892C93.298 76.9768 93.697 77.3758 94.1846 77.3758H106.564C107.051 77.3758 107.45 76.9768 107.45 76.4892C107.45 75.9905 107.051 75.6026 106.564 75.6026Z" fill="#C3F1FF"/>
<defs>
<linearGradient id="paint0_linear_1157_163007" x1="49.8133" y1="14.2868" x2="49.8133" y2="85.0398" gradientUnits="userSpaceOnUse">
<stop stop-color="#007ED8"/>
<stop offset="0.7065" stop-color="#002D4C"/>
</linearGradient>
<linearGradient id="paint1_linear_1157_163007" x1="36.5785" y1="-9.69372" x2="104.813" y2="115.29" gradientUnits="userSpaceOnUse">
<stop stop-color="#007ED8"/>
<stop offset="0.7065" stop-color="#002D4C"/>
</linearGradient>
</defs>
</svg>

After

Width:  |  Height:  |  Size: 4.6 KiB

View File

@@ -0,0 +1,3 @@
<svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M5.5 4C4.67157 4 4 4.67157 4 5.5V6.5C4 6.77614 3.77614 7 3.5 7C3.22386 7 3 6.77614 3 6.5V5.5C3 4.11929 4.11929 3 5.5 3H6.5C6.77614 3 7 3.22386 7 3.5C7 3.77614 6.77614 4 6.5 4H5.5ZM16 5.5C16 4.67157 15.3284 4 14.5 4H13.5C13.2239 4 13 3.77614 13 3.5C13 3.22386 13.2239 3 13.5 3H14.5C15.8807 3 17 4.11929 17 5.5V6.5C17 6.77614 16.7761 7 16.5 7C16.2239 7 16 6.77614 16 6.5V5.5ZM16 14.5C16 15.3284 15.3284 16 14.5 16H13.5C13.2239 16 13 16.2239 13 16.5C13 16.7761 13.2239 17 13.5 17H14.5C15.8807 17 17 15.8807 17 14.5V13.5C17 13.2239 16.7761 13 16.5 13C16.2239 13 16 13.2239 16 13.5V14.5ZM4 14.5C4 15.3284 4.67157 16 5.5 16H6.75C7.02614 16 7.25 16.2239 7.25 16.5C7.25 16.7761 7.02614 17 6.75 17H5.5C4.11929 17 3 15.8807 3 14.5V13.25C3 12.9739 3.22386 12.75 3.5 12.75C3.77614 12.75 4 12.9739 4 13.25V14.5ZM8.5 7C7.67157 7 7 7.67157 7 8.5V11.5C7 12.3284 7.67157 13 8.5 13H11.5C12.3284 13 13 12.3284 13 11.5V8.5C13 7.67157 12.3284 7 11.5 7H8.5ZM8 8.5C8 8.22386 8.22386 8 8.5 8H11.5C11.7761 8 12 8.22386 12 8.5V11.5C12 11.7761 11.7761 12 11.5 12H8.5C8.22386 12 8 11.7761 8 11.5V8.5Z" fill="#424242"/>
</svg>

After

Width:  |  Height:  |  Size: 1.2 KiB

View File

@@ -0,0 +1,3 @@
<svg width="20" height="22" viewBox="0 0 28 28" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M12.5849 1.28273C11.0125 0.262814 8.98746 0.262813 7.41509 1.28273L2.16509 4.68813C0.8149 5.56393 0 7.06384 0 8.6732V13.3268C0 14.9361 0.814898 16.4361 2.16509 17.3119L7.41509 20.7173C8.98746 21.7372 11.0125 21.7372 12.5849 20.7173L17.8349 17.3119C19.1851 16.4361 20 14.9361 20 13.3268V8.6732C20 7.06384 19.1851 5.56393 17.8349 4.68813L12.5849 1.28273ZM9.50097 2.05627C10.2759 1.93601 11.0848 2.09764 11.7686 2.54117L17.0186 5.94657C17.9424 6.54581 18.5 7.57205 18.5 8.6732V11.3955C18.287 11.1926 18.0465 11.0117 17.7802 10.8585L11.8647 7.4571C10.7104 6.79343 9.29086 6.79152 8.13486 7.45209L7.5 7.81487V4.41942C7.5 3.54181 8.01028 2.74428 8.80712 2.37651L9.50097 2.05627ZM17.8644 15.2257L17.7932 15.3503C17.5776 15.6214 17.3172 15.8597 17.0186 16.0534L11.7686 19.4588C10.6928 20.1567 9.30721 20.1567 8.23138 19.4588L5.86807 17.9259C6.11557 17.8361 6.35595 17.7193 6.58487 17.5754L12.2457 14.0172C13.3374 13.3309 14 12.1318 14 10.8423V10.4152L17.0324 12.1589C18.1077 12.7771 18.4798 14.1489 17.8644 15.2257ZM12.5 9.55272V10.8423C12.5 11.616 12.1025 12.3354 11.4474 12.7472L10.0303 13.6379L8.57078 12.7398C7.90535 12.3303 7.5 11.6049 7.5 10.8235V9.54249L8.87907 8.75445C9.57267 8.35811 10.4244 8.35926 11.1169 8.75746L12.5 9.55272ZM8.61445 14.5279L5.78662 16.3054C5.02045 16.787 4.04031 16.7627 3.29894 16.2437L2.5521 15.721C1.88767 15.1111 1.5 14.245 1.5 13.3268V8.6732C1.5 7.57205 2.05756 6.5458 2.98138 5.94657L6.0268 3.97116C6.00907 4.11873 6 4.26836 6 4.41942V10.8235C6 12.1258 6.67558 13.3348 7.78463 14.0173L8.61445 14.5279Z" fill="#0078D4"/>
</svg>

After

Width:  |  Height:  |  Size: 1.6 KiB

3
images/CopilotThumb.svg Normal file
View File

@@ -0,0 +1,3 @@
<svg width="12" height="14" viewBox="0 0 12 14" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M7.5806 0.051598C6.83006 -0.157 6.24411 0.402481 6.03494 0.923322C5.79411 1.52303 5.58243 1.94395 5.32941 2.44707C5.17287 2.75833 5.00052 3.10106 4.79565 3.53704C4.32141 4.54625 3.84755 5.19347 3.5035 5.58154C3.33128 5.77579 3.19093 5.90585 3.09835 5.98435C3.05204 6.02362 3.01761 6.05005 2.99704 6.0652L2.9809 6.07684L1.109 7.18119C0.272443 7.67473 -0.0885815 8.69797 0.253045 9.6072L0.773038 10.9912C0.989444 11.5671 1.45891 12.0114 2.04591 12.1958L7.40179 13.8781C8.73654 14.2974 10.1555 13.5397 10.5497 12.1973L11.9139 7.55127C12.29 6.2705 11.3298 4.9878 9.99492 4.9878H8.60995C8.67586 4.76117 8.74339 4.50906 8.80466 4.24751C8.93612 3.68641 9.04781 3.04484 9.03753 2.51008C9.02797 2.01293 8.97781 1.49126 8.77353 1.04807C8.55437 0.572583 8.1709 0.21566 7.5806 0.051598ZM2.9768 6.07969L2.97492 6.08097L2.9768 6.07969Z" fill="#0078D4"/>
</svg>

After

Width:  |  Height:  |  Size: 952 B

View File

@@ -0,0 +1,29 @@
<svg width="287" height="225" viewBox="0 0 287 225" fill="none" xmlns="http://www.w3.org/2000/svg">
<path opacity="0.3" d="M7.75456 192.647H231.829C233.524 192.647 235.156 191.988 236.381 190.764C237.605 189.539 238.265 187.907 238.265 186.211V33.061C238.265 29.5132 234.56 26.248 229.568 26.248L10.8314 29.576C9.98368 29.576 9.16738 29.733 8.38248 30.047C7.59758 30.3923 6.90687 30.8319 6.31034 31.4598C5.71381 32.0563 5.24287 32.747 4.89751 33.5319C4.55216 34.3168 4.42658 35.1645 4.42658 35.9808L1.31836 186.274C1.31836 187.969 1.97767 189.602 3.20212 190.795C4.42657 191.988 6.05917 192.647 7.75456 192.647Z" fill="#1F1D20"/>
<path d="M231.264 23.3906H6.37342C2.85705 23.3906 0 26.2477 0 29.764V183.228C0 186.745 2.85705 189.602 6.37342 189.602H231.295C234.811 189.602 237.669 186.745 237.669 183.228V29.764C237.637 26.2477 234.78 23.3906 231.264 23.3906Z" fill="url(#paint0_linear_1151_179507)"/>
<path d="M228.313 32.7148H119.62V178.707H228.313V32.7148Z" fill="white"/>
<path d="M121.158 32.7148H12.4648V178.707H121.158V32.7148Z" fill="#CDCDD0"/>
<path d="M34.1909 0V144.799C34.1909 144.799 63.2009 141.91 86.7166 153.715C110.264 165.52 121.158 178.581 121.158 178.581V33.7508C121.158 33.7508 107.595 16.483 86.7166 10.1095C69.7313 4.8978 34.1909 0 34.1909 0Z" fill="#EAEAEA"/>
<path d="M141.094 102.383L134.249 99.4006L127.374 102.383V23.3906H141.094V102.383Z" fill="url(#paint1_linear_1151_179507)"/>
<path opacity="0.15" d="M206.9 61.2871H159.304C157.231 61.2871 155.567 62.9825 155.567 65.0233C155.567 67.0954 157.263 68.7594 159.304 68.7594H206.9C208.972 68.7594 210.636 67.064 210.636 65.0233C210.668 62.9511 208.972 61.2871 206.9 61.2871Z" fill="#1F1D20"/>
<path opacity="0.15" d="M206.9 77.5498H159.304C157.231 77.5498 155.567 79.2452 155.567 81.2859C155.567 83.3581 157.263 85.0221 159.304 85.0221H206.9C208.972 85.0221 210.636 83.3267 210.636 81.2859C210.668 79.2138 208.972 77.5498 206.9 77.5498Z" fill="#1F1D20"/>
<path opacity="0.15" fill-rule="evenodd" clip-rule="evenodd" d="M159.304 93.8428H206.838C208.91 93.8428 210.574 95.5381 210.574 97.5789C210.574 99.651 208.878 101.315 206.838 101.315H159.304C157.232 101.315 155.568 99.6196 155.568 97.5789C155.536 95.5381 157.2 93.8428 159.304 93.8428Z" fill="#1F1D20"/>
<path d="M206.9 60.0303H159.304C157.231 60.0303 155.567 61.7257 155.567 63.7664C155.567 65.8385 157.263 67.5025 159.304 67.5025H206.9C208.972 67.5025 210.636 65.8072 210.636 63.7664C210.668 61.6943 208.972 60.0303 206.9 60.0303Z" fill="#50E6FF"/>
<path d="M206.9 76.3262H159.304C157.231 76.3262 155.567 78.0216 155.567 80.0623C155.567 82.1345 157.263 83.7984 159.304 83.7984H206.9C208.972 83.7984 210.636 82.1031 210.636 80.0623C210.668 77.9902 208.972 76.3262 206.9 76.3262Z" fill="#32B0E7"/>
<path fill-rule="evenodd" clip-rule="evenodd" d="M159.304 92.5889H206.838C208.91 92.5889 210.574 94.2843 210.574 96.325C210.574 98.3972 208.878 100.061 206.838 100.061H159.304C157.232 100.093 155.568 98.3658 155.568 96.325C155.536 94.2843 157.2 92.5889 159.304 92.5889Z" fill="#185A97"/>
<path opacity="0.2" d="M287 143.834H192V205.096C192 207.687 194.089 209.776 196.68 209.776H206.648V224.265L221.243 209.776H282.32C284.911 209.776 287 207.687 287 205.096V143.834Z" fill="#1F1D21"/>
<path d="M283.827 140H195.173C193.428 140 192 141.428 192 143.173V202.769C192 204.514 193.428 205.942 195.173 205.942H206.648V220.431L221.243 205.942H283.827C285.572 205.942 287 204.514 287 202.769V143.173C287 141.428 285.572 140 283.827 140Z" fill="#49C8EF"/>
<path d="M254.24 161.762H224.706C223.543 161.762 222.591 162.714 222.591 163.877C222.591 165.04 223.543 165.992 224.706 165.992H254.24C255.403 165.992 256.355 165.04 256.355 163.877C256.355 162.714 255.403 161.762 254.24 161.762Z" fill="#C3F1FF"/>
<path d="M254.24 171.042H224.706C223.543 171.042 222.591 171.994 222.591 173.157C222.591 174.321 223.543 175.272 224.706 175.272H254.24C255.403 175.272 256.355 174.321 256.355 173.157C256.355 172.02 255.403 171.042 254.24 171.042Z" fill="#C3F1FF"/>
<path d="M254.24 180.373H224.706C223.543 180.373 222.591 181.325 222.591 182.488C222.591 183.652 223.543 184.604 224.706 184.604H254.24C255.403 184.604 256.355 183.652 256.355 182.488C256.355 181.298 255.403 180.373 254.24 180.373Z" fill="#C3F1FF"/>
<defs>
<linearGradient id="paint0_linear_1151_179507" x1="118.845" y1="34.0854" x2="118.845" y2="202.888" gradientUnits="userSpaceOnUse">
<stop stop-color="#007ED8"/>
<stop offset="0.7065" stop-color="#002D4C"/>
</linearGradient>
<linearGradient id="paint1_linear_1151_179507" x1="87.2694" y1="-23.1274" x2="250.063" y2="275.059" gradientUnits="userSpaceOnUse">
<stop stop-color="#007ED8"/>
<stop offset="0.7065" stop-color="#002D4C"/>
</linearGradient>
</defs>
</svg>

After

Width:  |  Height:  |  Size: 4.6 KiB

9
images/EntraID.svg Normal file
View File

@@ -0,0 +1,9 @@
<?xml version="1.0" encoding="UTF-8"?>
<svg id="uuid-f8d4d392-7c12-4bd9-baff-66fbf7814b91" data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" width="18" height="18" viewBox="0 0 18 18">
<path d="m3.802,14.032c.388.242,1.033.511,1.715.511.621,0,1.198-.18,1.676-.487,0,0,.001,0,.002-.001l1.805-1.128v4.073c-.286,0-.574-.078-.824-.234l-4.374-2.734Z" fill="#225086"/>
<path d="m7.853,1.507L.353,9.967c-.579.654-.428,1.642.323,2.111,0,0,2.776,1.735,3.126,1.954.388.242,1.033.511,1.715.511.621,0,1.198-.18,1.676-.487,0,0,.001,0,.002-.001l1.805-1.128-4.364-2.728,4.365-4.924V1s0,0,0,0c-.424,0-.847.169-1.147.507Z" fill="#6df"/>
<polygon points="4.636 10.199 4.688 10.231 9 12.927 9.001 12.927 9.001 12.927 9.001 5.276 9 5.275 4.636 10.199" fill="#cbf8ff"/>
<path d="m17.324,12.078c.751-.469.902-1.457.323-2.111l-4.921-5.551c-.397-.185-.842-.291-1.313-.291-.925,0-1.752.399-2.302,1.026l-.109.123h0s4.364,4.924,4.364,4.924h0s0,0,0,0l-4.365,2.728v4.073c.287,0,.573-.078.823-.234l7.5-4.688Z" fill="#074793"/>
<path d="m9.001,1v4.275s.109-.123.109-.123c.55-.627,1.377-1.026,2.302-1.026.472,0,.916.107,1.313.291l-2.579-2.909c-.299-.338-.723-.507-1.146-.507Z" fill="#0294e4"/>
<polygon points="13.365 10.199 13.365 10.199 13.365 10.199 9.001 5.276 9.001 12.926 13.365 10.199" fill="#96bcc2"/>
</svg>

After

Width:  |  Height:  |  Size: 1.3 KiB

3
images/Hint.svg Normal file
View File

@@ -0,0 +1,3 @@
<svg width="14" height="14" viewBox="0 0 14 14" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M4.39804 9.80882C4.57428 9.93313 4.78476 9.99968 5.00043 9.9993C5.21633 9.99946 5.42686 9.93197 5.60243 9.8063C5.77993 9.67582 5.91464 9.49552 5.98943 9.2883L6.43643 7.9153C6.55086 7.57101 6.74391 7.25811 7.00028 7.00139C7.25665 6.74467 7.56929 6.5512 7.91343 6.4363L9.30443 5.9853C9.45636 5.93095 9.59364 5.84214 9.70551 5.72586C9.81738 5.60957 9.9008 5.46896 9.94924 5.31503C9.99767 5.16111 10.0098 4.99806 9.98468 4.83867C9.95955 4.67927 9.89786 4.52786 9.80443 4.3963C9.67034 4.21038 9.47939 4.07314 9.26043 4.0053L7.88543 3.5583C7.54091 3.44407 7.22777 3.25111 6.97087 2.99472C6.71396 2.73833 6.52035 2.42558 6.40543 2.0813L5.95343 0.693301C5.88113 0.490997 5.74761 0.316236 5.57143 0.193301C5.43877 0.0995741 5.28607 0.0380931 5.12548 0.0137472C4.96489 -0.0105984 4.80083 0.00286224 4.64636 0.0530596C4.49188 0.103257 4.35125 0.188806 4.23564 0.302903C4.12004 0.417 4.03265 0.556497 3.98043 0.710301L3.52343 2.1103C3.40884 2.44513 3.21967 2.74954 2.97022 3.00055C2.72076 3.25157 2.41753 3.44263 2.08343 3.5593L0.692428 4.0073C0.540653 4.0617 0.403522 4.15048 0.291767 4.26669C0.180011 4.3829 0.0966621 4.5234 0.0482407 4.67719C-0.000180673 4.83097 -0.0123605 4.99388 0.0126534 5.15315C0.0376676 5.31243 0.0991972 5.46376 0.192428 5.5953C0.320272 5.77475 0.501046 5.90972 0.709428 5.9813L2.08343 6.4263C2.52354 6.57278 2.90999 6.84713 3.19343 7.2143C3.35585 7.42494 3.4813 7.66164 3.56443 7.9143L4.01643 9.3053C4.08846 9.50859 4.22179 9.68452 4.39804 9.80882ZM4.48343 2.3943L5.01043 1.0173L5.44943 2.3943C5.61312 2.88745 5.88991 3.33546 6.25767 3.70253C6.62544 4.0696 7.07397 4.34554 7.56743 4.5083L8.97343 5.0373L7.59143 5.4853C7.09866 5.6496 6.65095 5.92646 6.28382 6.29393C5.9167 6.66141 5.64026 7.10938 5.47643 7.6023L4.95343 8.9803L4.50443 7.6013C4.34335 7.10803 4.06943 6.65913 3.70443 6.2903C3.3356 5.92226 2.88653 5.64467 2.39243 5.4793L1.01443 4.9573L2.40043 4.5073C2.88672 4.33867 3.32775 4.06051 3.68943 3.6943C4.04901 3.3266 4.32049 2.88211 4.48343 2.3943ZM10.5353 13.8513C10.6713 13.9475 10.8337 13.9992 11.0003 13.9993C11.1654 13.9994 11.3264 13.9484 11.4613 13.8533C11.6008 13.7548 11.7058 13.6149 11.7613 13.4533L12.0093 12.6913C12.0625 12.5329 12.1515 12.3888 12.2693 12.2703C12.3867 12.1518 12.5307 12.063 12.6893 12.0113L13.4613 11.7593C13.619 11.7048 13.7557 11.6024 13.8523 11.4663C13.9257 11.3633 13.9736 11.2444 13.9921 11.1193C14.0106 10.9942 13.9992 10.8665 13.9588 10.7467C13.9184 10.6268 13.8501 10.5183 13.7597 10.4299C13.6692 10.3415 13.5591 10.2759 13.4383 10.2383L12.6743 9.98933C12.5162 9.93676 12.3724 9.84814 12.2544 9.73048C12.1364 9.61281 12.0473 9.46932 11.9943 9.31133L11.7423 8.53833C11.6886 8.38048 11.586 8.24387 11.4493 8.14833C11.3473 8.07538 11.2295 8.02744 11.1056 8.00838C10.9816 7.98932 10.8549 7.99967 10.7357 8.0386C10.6164 8.07753 10.508 8.14395 10.4192 8.23249C10.3304 8.32104 10.2636 8.42923 10.2243 8.54833L9.97731 9.31033C9.92502 9.46798 9.83747 9.61162 9.72131 9.73033C9.60657 9.8468 9.46665 9.93541 9.31231 9.98933L8.53931 10.2413C8.38025 10.2952 8.2422 10.3978 8.1447 10.5346C8.04721 10.6713 7.99522 10.8353 7.99611 11.0032C7.99699 11.1712 8.0507 11.3346 8.14963 11.4703C8.24856 11.606 8.38769 11.7071 8.54731 11.7593L9.31031 12.0063C9.46917 12.0597 9.61358 12.149 9.73231 12.2673C9.85053 12.3856 9.93896 12.5302 9.99031 12.6893L10.2433 13.4633C10.2981 13.6198 10.4001 13.7554 10.5353 13.8513ZM9.62231 11.0583L9.44331 10.9993L9.62731 10.9353C9.92907 10.8304 10.2027 10.6576 10.4273 10.4303C10.6537 10.2013 10.8248 9.92359 10.9273 9.61833L10.9853 9.44033L11.0443 9.62133C11.1463 9.92803 11.3185 10.2067 11.5471 10.4352C11.7757 10.6636 12.0545 10.8356 12.3613 10.9373L12.5563 11.0003L12.3763 11.0593C12.0689 11.1615 11.7898 11.3342 11.5611 11.5636C11.3324 11.793 11.1606 12.0727 11.0593 12.3803L11.0003 12.5613L10.9423 12.3803C10.8409 12.0722 10.6687 11.792 10.4394 11.5625C10.2102 11.3329 9.93033 11.1602 9.62231 11.0583Z" fill="#424242"/>
</svg>

After

Width:  |  Height:  |  Size: 3.9 KiB

3
images/Home_16.svg Normal file
View File

@@ -0,0 +1,3 @@
<svg width="16" height="16" viewBox="0 0 16 16" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M7.31299 1.26164C7.69849 0.897163 8.30151 0.897163 8.68701 1.26164L13.5305 5.84098C13.8302 6.12431 14 6.51853 14 6.93094V12.5002C14 13.3286 13.3284 14.0002 12.5 14.0002H10.5C9.67157 14.0002 9 13.3286 9 12.5002V10.0002C9 9.72407 8.77614 9.50021 8.5 9.50021H7.5C7.22386 9.50021 7 9.72407 7 10.0002V12.5002C7 13.3286 6.32843 14.0002 5.5 14.0002H3.5C2.67157 14.0002 2 13.3286 2 12.5002V6.93094C2 6.51853 2.1698 6.12431 2.46948 5.84098L7.31299 1.26164ZM8 1.98828L3.15649 6.56762C3.0566 6.66207 3 6.79347 3 6.93094V12.5002C3 12.7763 3.22386 13.0002 3.5 13.0002H5.5C5.77614 13.0002 6 12.7763 6 12.5002V10.0002C6 9.17179 6.67157 8.50022 7.5 8.50022H8.5C9.32843 8.50022 10 9.17179 10 10.0002V12.5002C10 12.7763 10.2239 13.0002 10.5 13.0002H12.5C12.7761 13.0002 13 12.7763 13 12.5002V6.93094C13 6.79347 12.9434 6.66207 12.8435 6.56762L8 1.98828Z" fill="#0078D4" />
</svg>

After

Width:  |  Height:  |  Size: 968 B

View File

@@ -0,0 +1,3 @@
<svg width="20" height="22" viewBox="0 0 20 22" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M0.799805 3.99971C0.799805 2.79131 1.8498 1.89371 3.0798 1.33211C4.6378 0.684806 6.313 0.367334 7.9998 0.39971C9.68664 0.367334 11.3618 0.684806 12.9198 1.33211C14.1498 1.89371 15.1998 2.79131 15.1998 3.99971V10.1304C14.827 10.1594 14.4604 10.2471 14.1138 10.3906C14.0755 10.4066 14.0375 10.423 13.9998 10.4403V6.03971C13.6631 6.28732 13.301 6.49849 12.9198 6.66971C11.3616 7.3162 9.6864 7.63285 7.9998 7.59971C6.313 7.63209 4.6378 7.31461 3.0798 6.66731C2.69864 6.49686 2.33662 6.28648 1.9998 6.03971V15.9997C1.9998 16.4485 2.427 17.0497 3.5814 17.5753C4.98209 18.1502 6.48605 18.4308 7.9998 18.3997L8.02536 18.4002C8.03904 18.4647 8.05452 18.529 8.0718 18.593L7.15982 19.5098C7.13596 19.5337 7.11282 19.5582 7.09042 19.5832C5.71356 19.507 4.35728 19.198 3.0798 18.6673C1.8498 18.1057 0.799805 17.2081 0.799805 15.9997V3.99971ZM1.9998 3.99971C1.9998 4.44851 2.427 5.04971 3.5814 5.57531C4.98209 6.15018 6.48605 6.4308 7.9998 6.39971C9.5136 6.4308 11.0176 6.15018 12.4182 5.57531C13.5726 5.04971 13.9998 4.44851 13.9998 3.99971C13.9998 3.55091 13.5726 2.94971 12.4182 2.42411C11.0176 1.84924 9.5136 1.56863 7.9998 1.59971C6.48605 1.56863 4.98209 1.84924 3.5814 2.42411C2.427 2.94971 1.9998 3.55091 1.9998 3.99971ZM19.0373 11.0246C19.15 10.9122 19.2133 10.7595 19.2134 10.6003C19.2136 10.441 19.1504 10.2883 19.0379 10.1756C18.9254 10.0629 18.7728 9.99963 18.6136 9.99952C18.4543 9.9994 18.3016 10.0626 18.1889 10.175L16.7657 11.5982C16.7506 11.6187 16.7366 11.64 16.7237 11.6618C16.2658 11.3886 15.7297 11.2755 15.2004 11.3407C14.6711 11.4058 14.1785 11.6456 13.8005 12.0218L13.0805 12.7418C12.8603 12.9626 12.7366 13.2616 12.7366 13.5734C12.7366 13.8853 12.8603 14.1843 13.0805 14.405L14.8109 16.1318C15.0317 16.3525 15.331 16.4764 15.6431 16.4764C15.9552 16.4764 16.2546 16.3525 16.4753 16.1318L17.1953 15.4118C17.5718 15.0338 17.8117 14.541 17.8769 14.0114C17.942 13.4817 17.829 12.9456 17.5553 12.4874C17.5777 12.4753 17.599 12.4612 17.6189 12.4454L19.0373 11.0246ZM12.2317 15.2498C12.1225 15.1405 11.9928 15.054 11.8501 14.9948C11.7074 14.9356 11.5546 14.9053 11.4001 14.9053C11.2457 14.9053 11.0927 14.9356 10.95 14.9948C10.8073 15.054 10.6777 15.1405 10.5685 15.2498L9.84852 15.9698C9.47196 16.3478 9.23208 16.8406 9.16692 17.3702C9.10176 17.8998 9.21492 18.436 9.48852 18.8942C9.46632 18.9066 9.44508 18.9206 9.42492 18.9362L8.00652 20.3582C7.89722 20.4714 7.83674 20.6229 7.8381 20.7802C7.83947 20.9376 7.90258 21.088 8.01384 21.1993C8.12508 21.3105 8.27556 21.3736 8.43288 21.375C8.5902 21.3763 8.74176 21.3158 8.85492 21.2066L10.2769 19.7834C10.2926 19.7631 10.3072 19.7419 10.3201 19.7198C10.778 19.993 11.3141 20.1061 11.8434 20.0409C12.3727 19.9756 12.8653 19.736 13.2433 19.3598L13.9633 18.6398C14.184 18.419 14.3078 18.1197 14.3078 17.8076C14.3078 17.4955 14.184 17.1961 13.9633 16.9754L12.2317 15.2498Z" fill="#0078D4"/>
</svg>

After

Width:  |  Height:  |  Size: 2.9 KiB

3
images/Link_blue.svg Normal file
View File

@@ -0,0 +1,3 @@
<svg width="11" height="11" viewBox="0 0 11 11" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M10 6H11V11H0V0H5V1H1V10H10V6ZM11 0V5H10V1.71094L5.35156 6.35156L4.64844 5.64844L9.28906 1H6V0H11Z" fill="#0078D4"/>
</svg>

After

Width:  |  Height:  |  Size: 229 B

23
images/Notebooks.svg Normal file
View File

@@ -0,0 +1,23 @@
<svg width="32" height="36" viewBox="0 0 32 36" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M30.1809 0H5.6045C5.45725 -2.06304e-07 5.31144 0.0290347 5.17541 0.0854435C5.03939 0.141852 4.91583 0.224528 4.81179 0.32874C4.70775 0.432952 4.62528 0.556655 4.5691 0.692771C4.51292 0.828887 4.48413 0.974745 4.48438 1.122V31.7149C4.48438 32.0121 4.60234 32.2972 4.81236 32.5075C5.02238 32.7178 5.30729 32.8361 5.6045 32.8365H30.1809C30.4781 32.8362 30.7631 32.7179 30.9731 32.5076C31.1832 32.2972 31.3011 32.0121 31.301 31.7149V1.122C31.301 0.824752 31.1831 0.53965 30.973 0.329288C30.763 0.118926 30.4781 0.000496739 30.1809 0V0Z" fill="url(#paint0_linear_1311_8669)"/>
<path d="M16.1495 3.22485H2.17401C1.8837 3.22485 1.60528 3.34018 1.39999 3.54546C1.19471 3.75074 1.07939 4.02917 1.07939 4.31948V34.465C1.07815 34.6087 1.10524 34.7513 1.15912 34.8845C1.21299 35.0178 1.2926 35.1391 1.39338 35.2416C1.49416 35.3441 1.61414 35.4257 1.74648 35.4818C1.87881 35.5379 2.0209 35.5674 2.16464 35.5686H26.3926C26.6829 35.5686 26.9614 35.4533 27.1667 35.248C27.3719 35.0427 27.4873 34.7643 27.4873 34.474V14.5202C27.4874 14.3764 27.4591 14.234 27.4042 14.1011C27.3492 13.9682 27.2686 13.8475 27.1669 13.7457C27.0653 13.644 26.9446 13.5633 26.8117 13.5082C26.6788 13.4532 26.5364 13.4249 26.3926 13.4249H18.3549C18.0642 13.422 17.7865 13.3045 17.5819 13.098C17.3774 12.8915 17.2626 12.6126 17.2625 12.322V4.33185C17.2628 4.03998 17.1477 3.75982 16.9423 3.55245C16.7369 3.34508 16.4579 3.22733 16.166 3.22485H16.1495Z" fill="white"/>
<path d="M16.175 3.16357H1.99513C1.69791 3.16397 1.41301 3.28232 1.20299 3.49262C0.992965 3.70292 0.875 3.98799 0.875 4.2852V34.8781C0.875 35.1753 0.992953 35.4604 1.20296 35.6708C1.41297 35.8812 1.69788 35.9996 1.99513 36.0001H26.5715C26.8687 35.9996 27.1537 35.8812 27.3637 35.6708C27.5737 35.4604 27.6916 35.1753 27.6916 34.8781V14.6307C27.6916 14.3336 27.5736 14.0487 27.3635 13.8387C27.1535 13.6286 26.8686 13.5106 26.5715 13.5106H18.4134C18.1163 13.5106 17.8314 13.3926 17.6213 13.1825C17.4113 12.9724 17.2933 12.6875 17.2933 12.3905V4.2852C17.2924 3.98858 17.1744 3.70432 16.9649 3.49426C16.7555 3.2842 16.4716 3.16535 16.175 3.16357Z" fill="url(#paint1_linear_1311_8669)"/>
<path d="M27.2629 13.7335L16.9065 3.4082V11.8213C16.9035 12.3253 17.1007 12.8097 17.4548 13.1684C17.8088 13.527 18.2907 13.7304 18.7947 13.7338L27.2629 13.7335Z" fill="#83B9F9"/>
<path d="M17.744 16.4092H4.76108C4.47196 16.4092 4.23608 16.5543 4.23608 16.7332V17.5323C4.23608 17.7112 4.47046 17.8559 4.76108 17.8559H17.744C18.0331 17.8559 18.269 17.7112 18.269 17.5323V16.7332C18.2675 16.5543 18.0331 16.4092 17.744 16.4092Z" fill="#83B9F9"/>
<path d="M17.744 20.7498H4.76108C4.47196 20.7498 4.23608 20.8945 4.23608 21.0734V21.8725C4.23608 22.0514 4.47046 22.1965 4.76108 22.1965H17.744C18.0331 22.1965 18.269 22.0514 18.269 21.8725V21.0749C18.2675 20.8945 18.0331 20.7498 17.744 20.7498Z" fill="#83B9F9"/>
<path d="M17.744 25.0906H4.76108C4.47196 25.0906 4.23608 25.2353 4.23608 25.4142V26.2126C4.23608 26.3915 4.47046 26.5366 4.76108 26.5366H17.744C18.0331 26.5366 18.269 26.3915 18.269 26.2126V25.4142C18.2675 25.2353 18.0331 25.0906 17.744 25.0906Z" fill="#83B9F9"/>
<path d="M12.4729 29.4312H4.90167C4.53492 29.4312 4.23755 29.5759 4.23755 29.7548V30.5539C4.23755 30.7328 4.53492 30.8779 4.90167 30.8779H12.4729C12.8397 30.8779 13.137 30.7328 13.137 30.5539V29.7548C13.1374 29.5759 12.8397 29.4312 12.4729 29.4312Z" fill="#83B9F9"/>
<defs>
<linearGradient id="paint0_linear_1311_8669" x1="17.8925" y1="2.19225" x2="17.8925" y2="35.1225" gradientUnits="userSpaceOnUse">
<stop stop-color="#DCDCDC"/>
<stop offset="1" stop-color="#AAAAAA"/>
</linearGradient>
<linearGradient id="paint1_linear_1311_8669" x1="14.2831" y1="5.35582" x2="14.2831" y2="38.2857" gradientUnits="userSpaceOnUse">
<stop stop-color="#0078D7"/>
<stop offset="0.327" stop-color="#0076D4"/>
<stop offset="0.576" stop-color="#0071CA"/>
<stop offset="0.799" stop-color="#0068BA"/>
<stop offset="1" stop-color="#005BA4"/>
</linearGradient>
</defs>
</svg>

After

Width:  |  Height:  |  Size: 3.9 KiB

View File

@@ -0,0 +1,4 @@
<svg width="16" height="16" viewBox="0 0 16 16" fill="none" xmlns="http://www.w3.org/2000/svg">
<circle cx="8" cy="8" r="8" fill="#0078D4"/>
<path d="M9.18652 4.8418V12H7.64844V6.58008C7.5638 6.65495 7.46289 6.72656 7.3457 6.79492C7.23177 6.86003 7.1097 6.92025 6.97949 6.97559C6.84928 7.02767 6.71419 7.07324 6.57422 7.1123C6.43424 7.14811 6.2959 7.17415 6.15918 7.19043V5.8916C6.55957 5.77441 6.93717 5.62467 7.29199 5.44238C7.64681 5.26009 7.96745 5.0599 8.25391 4.8418H9.18652Z" fill="white"/>
</svg>

After

Width:  |  Height:  |  Size: 505 B

4
images/Pivot2.svg Normal file
View File

@@ -0,0 +1,4 @@
<svg width="16" height="16" viewBox="0 0 16 16" fill="none" xmlns="http://www.w3.org/2000/svg">
<circle cx="8" cy="8" r="7.5" stroke="#949494"/>
<path d="M7.21875 10.7207H10.1875V12H5.5293V11.4727C5.5293 11.1146 5.58952 10.7939 5.70996 10.5107C5.8304 10.2243 5.98177 9.96875 6.16406 9.74414C6.34635 9.51628 6.54492 9.31608 6.75977 9.14355C6.97786 8.96777 7.18457 8.8099 7.37988 8.66992C7.58496 8.52344 7.764 8.38346 7.91699 8.25C8.07324 8.11654 8.20345 7.9847 8.30762 7.85449C8.41504 7.72103 8.49479 7.58757 8.54688 7.4541C8.59896 7.31738 8.625 7.17253 8.625 7.01953C8.625 6.72005 8.54036 6.49382 8.37109 6.34082C8.20182 6.18783 7.94303 6.11133 7.59473 6.11133C6.99251 6.11133 6.41634 6.35059 5.86621 6.8291V5.47168C6.47493 5.0778 7.16178 4.88086 7.92676 4.88086C8.28158 4.88086 8.59896 4.92806 8.87891 5.02246C9.16211 5.11361 9.40137 5.24544 9.59668 5.41797C9.79199 5.59049 9.9401 5.80046 10.041 6.04785C10.1452 6.29199 10.1973 6.56543 10.1973 6.86816C10.1973 7.19043 10.1468 7.47689 10.0459 7.72754C9.94824 7.97819 9.81641 8.20605 9.65039 8.41113C9.48763 8.61621 9.29883 8.80501 9.08398 8.97754C8.86914 9.14681 8.64616 9.3112 8.41504 9.4707C8.25879 9.58138 8.10742 9.69206 7.96094 9.80273C7.81771 9.91016 7.69076 10.0176 7.58008 10.125C7.4694 10.2292 7.38151 10.3317 7.31641 10.4326C7.2513 10.5335 7.21875 10.6296 7.21875 10.7207Z" fill="#949494"/>
</svg>

After

Width:  |  Height:  |  Size: 1.3 KiB

View File

@@ -0,0 +1,4 @@
<svg width="16" height="16" viewBox="0 0 16 16" fill="none" xmlns="http://www.w3.org/2000/svg">
<circle cx="8" cy="8" r="8" fill="#0078D4"/>
<path d="M7.21875 10.7207H10.1875V12H5.5293V11.4727C5.5293 11.1146 5.58952 10.7939 5.70996 10.5107C5.8304 10.2243 5.98177 9.96875 6.16406 9.74414C6.34635 9.51628 6.54492 9.31608 6.75977 9.14355C6.97786 8.96777 7.18457 8.8099 7.37988 8.66992C7.58496 8.52344 7.764 8.38346 7.91699 8.25C8.07324 8.11654 8.20345 7.9847 8.30762 7.85449C8.41504 7.72103 8.49479 7.58757 8.54688 7.4541C8.59896 7.31738 8.625 7.17253 8.625 7.01953C8.625 6.72005 8.54036 6.49382 8.37109 6.34082C8.20182 6.18783 7.94303 6.11133 7.59473 6.11133C6.99251 6.11133 6.41634 6.35059 5.86621 6.8291V5.47168C6.47493 5.0778 7.16178 4.88086 7.92676 4.88086C8.28158 4.88086 8.59896 4.92806 8.87891 5.02246C9.16211 5.11361 9.40137 5.24544 9.59668 5.41797C9.79199 5.59049 9.9401 5.80046 10.041 6.04785C10.1452 6.29199 10.1973 6.56543 10.1973 6.86816C10.1973 7.19043 10.1468 7.47689 10.0459 7.72754C9.94824 7.97819 9.81641 8.20605 9.65039 8.41113C9.48763 8.61621 9.29883 8.80501 9.08398 8.97754C8.86914 9.14681 8.64616 9.3112 8.41504 9.4707C8.25879 9.58138 8.10742 9.69206 7.96094 9.80273C7.81771 9.91016 7.69076 10.0176 7.58008 10.125C7.4694 10.2292 7.38151 10.3317 7.31641 10.4326C7.2513 10.5335 7.21875 10.6296 7.21875 10.7207Z" fill="white"/>
</svg>

After

Width:  |  Height:  |  Size: 1.3 KiB

4
images/Pivot3.svg Normal file
View File

@@ -0,0 +1,4 @@
<svg width="16" height="16" viewBox="0 0 16 16" fill="none" xmlns="http://www.w3.org/2000/svg">
<circle cx="8" cy="8" r="7.5" stroke="#949494"/>
<path d="M5.69531 11.7705V10.4277C6.16406 10.7695 6.71094 10.9404 7.33594 10.9404C7.72982 10.9404 8.03581 10.8558 8.25391 10.6865C8.47526 10.5173 8.58594 10.2812 8.58594 9.97852C8.58594 9.66602 8.44922 9.42513 8.17578 9.25586C7.9056 9.08659 7.53288 9.00195 7.05762 9.00195H6.4082V7.82031H7.00879C7.92025 7.82031 8.37598 7.51758 8.37598 6.91211C8.37598 6.34245 8.02604 6.05762 7.32617 6.05762C6.85742 6.05762 6.40169 6.20898 5.95898 6.51172V5.25195C6.45052 5.00456 7.02344 4.88086 7.67773 4.88086C8.39388 4.88086 8.95052 5.04199 9.34766 5.36426C9.74805 5.68652 9.94824 6.10482 9.94824 6.61914C9.94824 7.53385 9.48438 8.10677 8.55664 8.33789V8.3623C9.05143 8.42415 9.44206 8.60482 9.72852 8.9043C10.015 9.20052 10.1582 9.5651 10.1582 9.99805C10.1582 10.6523 9.91895 11.1699 9.44043 11.5508C8.96191 11.9316 8.30111 12.1221 7.45801 12.1221C6.73535 12.1221 6.14779 12.0049 5.69531 11.7705Z" fill="#949494"/>
</svg>

After

Width:  |  Height:  |  Size: 1.0 KiB

View File

@@ -0,0 +1,4 @@
<svg width="16" height="16" viewBox="0 0 16 16" fill="none" xmlns="http://www.w3.org/2000/svg">
<circle cx="8" cy="8" r="8" fill="#0078D4"/>
<path d="M5.69531 11.7705V10.4277C6.16406 10.7695 6.71094 10.9404 7.33594 10.9404C7.72982 10.9404 8.03581 10.8558 8.25391 10.6865C8.47526 10.5173 8.58594 10.2812 8.58594 9.97852C8.58594 9.66602 8.44922 9.42513 8.17578 9.25586C7.9056 9.08659 7.53288 9.00195 7.05762 9.00195H6.4082V7.82031H7.00879C7.92025 7.82031 8.37598 7.51758 8.37598 6.91211C8.37598 6.34245 8.02604 6.05762 7.32617 6.05762C6.85742 6.05762 6.40169 6.20898 5.95898 6.51172V5.25195C6.45052 5.00456 7.02344 4.88086 7.67773 4.88086C8.39388 4.88086 8.95052 5.04199 9.34766 5.36426C9.74805 5.68652 9.94824 6.10482 9.94824 6.61914C9.94824 7.53385 9.48438 8.10677 8.55664 8.33789V8.3623C9.05143 8.42415 9.44206 8.60482 9.72852 8.9043C10.015 9.20052 10.1582 9.5651 10.1582 9.99805C10.1582 10.6523 9.91895 11.1699 9.44043 11.5508C8.96191 11.9316 8.30111 12.1221 7.45801 12.1221C6.73535 12.1221 6.14779 12.0049 5.69531 11.7705Z" fill="white"/>
</svg>

After

Width:  |  Height:  |  Size: 1.0 KiB

4
images/Pivot4.svg Normal file
View File

@@ -0,0 +1,4 @@
<svg width="16" height="16" viewBox="0 0 16 16" fill="none" xmlns="http://www.w3.org/2000/svg">
<circle cx="8" cy="8" r="7.5" stroke="#949494"/>
<path d="M9.77246 4.99805V9.41211H10.6123V10.5645H9.77246V12H8.36621V10.5645H5.31445V9.3584C5.58464 9.05566 5.86458 8.72526 6.1543 8.36719C6.44401 8.00586 6.72396 7.63477 6.99414 7.25391C7.26432 6.87305 7.51497 6.49056 7.74609 6.10645C7.98047 5.71908 8.17904 5.34961 8.3418 4.99805H9.77246ZM6.69629 9.41211H8.36621V6.96582C8.25228 7.17741 8.12858 7.39225 7.99512 7.61035C7.86165 7.8252 7.72168 8.03841 7.5752 8.25C7.42871 8.45833 7.2806 8.66178 7.13086 8.86035C6.98112 9.05566 6.83626 9.23958 6.69629 9.41211Z" fill="#949494"/>
</svg>

After

Width:  |  Height:  |  Size: 680 B

View File

@@ -0,0 +1,4 @@
<svg width="16" height="16" viewBox="0 0 16 16" fill="none" xmlns="http://www.w3.org/2000/svg">
<circle cx="8" cy="8" r="8" fill="#0078D4"/>
<path d="M9.77246 4.99805V9.41211H10.6123V10.5645H9.77246V12H8.36621V10.5645H5.31445V9.3584C5.58464 9.05566 5.86458 8.72526 6.1543 8.36719C6.44401 8.00586 6.72396 7.63477 6.99414 7.25391C7.26432 6.87305 7.51497 6.49056 7.74609 6.10645C7.98047 5.71908 8.17904 5.34961 8.3418 4.99805H9.77246ZM6.69629 9.41211H8.36621V6.96582C8.25228 7.17741 8.12858 7.39225 7.99512 7.61035C7.86165 7.8252 7.72168 8.03841 7.5752 8.25C7.42871 8.45833 7.2806 8.66178 7.13086 8.86035C6.98112 9.05566 6.83626 9.23958 6.69629 9.41211Z" fill="white"/>
</svg>

After

Width:  |  Height:  |  Size: 674 B

4
images/Pivot5.svg Normal file
View File

@@ -0,0 +1,4 @@
<svg width="16" height="16" viewBox="0 0 16 16" fill="none" xmlns="http://www.w3.org/2000/svg">
<circle cx="8" cy="8" r="7.5" stroke="#949494"/>
<path d="M5.81738 11.8193V10.501C6.2959 10.7939 6.80534 10.9404 7.3457 10.9404C7.7526 10.9404 8.06999 10.8444 8.29785 10.6523C8.52897 10.457 8.64453 10.1934 8.64453 9.86133C8.64453 9.16797 8.15462 8.82129 7.1748 8.82129C6.81348 8.82129 6.39681 8.84896 5.9248 8.9043L6.18848 4.99805H9.89453V6.25781H7.36523L7.26758 7.65918C7.51823 7.63965 7.7347 7.62988 7.91699 7.62988C8.63639 7.62988 9.19954 7.81868 9.60645 8.19629C10.0133 8.57389 10.2168 9.08171 10.2168 9.71973C10.2168 10.4261 9.97428 11.0039 9.48926 11.4531C9.00423 11.8991 8.34668 12.1221 7.5166 12.1221C6.84277 12.1221 6.27637 12.0212 5.81738 11.8193Z" fill="#949494"/>
</svg>

After

Width:  |  Height:  |  Size: 779 B

View File

@@ -0,0 +1,4 @@
<svg width="16" height="16" viewBox="0 0 16 16" fill="none" xmlns="http://www.w3.org/2000/svg">
<circle cx="8" cy="8" r="8" fill="#0078D4"/>
<path d="M5.81738 11.8193V10.501C6.2959 10.7939 6.80534 10.9404 7.3457 10.9404C7.7526 10.9404 8.06999 10.8444 8.29785 10.6523C8.52897 10.457 8.64453 10.1934 8.64453 9.86133C8.64453 9.16797 8.15462 8.82129 7.1748 8.82129C6.81348 8.82129 6.39681 8.84896 5.9248 8.9043L6.18848 4.99805H9.89453V6.25781H7.36523L7.26758 7.65918C7.51823 7.63965 7.7347 7.62988 7.91699 7.62988C8.63639 7.62988 9.19954 7.81868 9.60645 8.19629C10.0133 8.57389 10.2168 9.08171 10.2168 9.71973C10.2168 10.4261 9.97428 11.0039 9.48926 11.4531C9.00423 11.8991 8.34668 12.1221 7.5166 12.1221C6.84277 12.1221 6.27637 12.0212 5.81738 11.8193Z" fill="white"/>
</svg>

After

Width:  |  Height:  |  Size: 773 B

View File

@@ -0,0 +1,3 @@
<svg width="16" height="16" viewBox="0 0 16 16" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M2.9 10.4C2.86142 9.92426 2.92976 9.44591 3.1 9C3.2722 8.57315 3.54698 8.19534 3.9 7.9L5.6 6.1L10.6 11.1L8.8 12.8C8.50466 13.153 8.12685 13.4278 7.7 13.6C7.29358 13.7932 6.84997 13.8955 6.4 13.9L5.2 13.7L4.3 13.2L1.7 15.7L1 15L3.5 12.4C3.29618 12.1222 3.12819 11.8198 3 11.5C2.92162 11.1388 2.88804 10.7694 2.9 10.4ZM6.4 12.9L7.3 12.7C7.60584 12.5584 7.87842 12.354 8.1 12.1L9.2 11.1L5.6 7.5L4.6 8.6L4 9.4C3.9125 9.72567 3.87872 10.0634 3.9 10.4C3.88428 10.7034 3.91806 11.0074 4 11.3L4.6 12.1L5.4 12.7L6.4 12.9ZM13.2 4.3C13.4038 4.5778 13.5718 4.88018 13.7 5.2C13.8153 5.59037 13.8824 5.99335 13.9 6.4C13.8955 6.84997 13.7932 7.29358 13.6 7.7C13.4278 8.12685 13.153 8.50466 12.8 8.8L11.1 10.6L6.1 5.6L7.9 3.9C8.19534 3.54698 8.57315 3.2722 9 3.1C9.44591 2.92976 9.92426 2.86142 10.4 2.9H11.5L12.4 3.4L15 1L15.7 1.7L13.2 4.3ZM12.1 8.1C12.354 7.87842 12.5584 7.60584 12.7 7.3C12.8142 7.01258 12.8818 6.70875 12.9 6.4C12.8909 6.0577 12.8232 5.71948 12.7 5.4L12.1 4.6L11.3 4.1C11.0284 3.9405 10.7136 3.87053 10.4 3.9H9.4L8.6 4.5L7.5 5.5L11.1 9.1L12.1 8.1Z" fill="#0078D4"/>
</svg>

After

Width:  |  Height:  |  Size: 1.2 KiB

15
images/PowerShell.svg Normal file
View File

@@ -0,0 +1,15 @@
<svg width="34" height="34" viewBox="0 0 34 34" fill="none" xmlns="http://www.w3.org/2000/svg">
<path d="M0.944458 10.9331H33.0556V28.836C33.0556 29.1205 32.9425 29.3934 32.7413 29.5946C32.5401 29.7958 32.2672 29.9089 31.9827 29.9089H2.01735C1.7328 29.9089 1.45991 29.7958 1.2587 29.5946C1.05749 29.3934 0.944458 29.1205 0.944458 28.836V10.9331Z" fill="url(#paint0_linear_1497_136679)"/>
<path d="M2.02301 4.09132H31.977C32.1179 4.09132 32.2574 4.11907 32.3876 4.17299C32.5178 4.22691 32.636 4.30594 32.7357 4.40557C32.8353 4.50519 32.9143 4.62347 32.9682 4.75364C33.0222 4.8838 33.0499 5.02332 33.0499 5.16421V10.9329H0.944458V5.16421C0.944456 5.02284 0.972394 4.88286 1.02667 4.75232C1.08094 4.62178 1.16047 4.50326 1.2607 4.40356C1.36093 4.30385 1.47987 4.22494 1.6107 4.17136C1.74152 4.11778 1.88164 4.09058 2.02301 4.09132Z" fill="#0078D4"/>
<path d="M5.33553 15.0706L6.03309 14.371C6.09216 14.3118 6.17235 14.2785 6.25601 14.2783C6.33967 14.2782 6.41995 14.3113 6.47919 14.3704L11.6394 19.5161C11.6982 19.5747 11.7449 19.6444 11.7769 19.7211C11.8088 19.7979 11.8252 19.8801 11.8254 19.9632C11.8255 20.0463 11.8092 20.1286 11.7775 20.2055C11.7458 20.2823 11.6993 20.3521 11.6407 20.4109L10.9444 21.1091L5.3375 15.518C5.27826 15.4589 5.24491 15.3788 5.24479 15.2951C5.24467 15.2114 5.27779 15.1312 5.33687 15.0719L5.33553 15.0706Z" fill="#F2F2F2"/>
<path d="M6.1367 25.5068L5.43717 24.8092C5.37793 24.7501 5.34459 24.67 5.34447 24.5863C5.34435 24.5026 5.37747 24.4224 5.43654 24.3631L10.9463 18.8378L11.6445 19.534C11.7633 19.6525 11.8302 19.8133 11.8305 19.9812C11.8307 20.149 11.7643 20.31 11.6457 20.4289L6.57747 25.5115C6.5184 25.5707 6.43821 25.6041 6.35455 25.6042C6.27089 25.6043 6.19061 25.5712 6.13137 25.5121L6.1367 25.5068Z" fill="#E6E6E6"/>
<path d="M22.1019 23.8755H14.1893C13.8857 23.8755 13.6396 24.1216 13.6396 24.4252V25.2355C13.6396 25.5391 13.8857 25.7852 14.1893 25.7852H22.1019C22.4054 25.7852 22.6515 25.5391 22.6515 25.2355V24.4252C22.6515 24.1216 22.4054 23.8755 22.1019 23.8755Z" fill="#F2F2F2"/>
<defs>
<linearGradient id="paint0_linear_1497_136679" x1="17" y1="29.9089" x2="17" y2="10.9331" gradientUnits="userSpaceOnUse">
<stop stop-color="#32BEDD"/>
<stop offset="0.175" stop-color="#32CAEA"/>
<stop offset="0.41" stop-color="#32D2F2"/>
<stop offset="0.775" stop-color="#32D4F5"/>
</linearGradient>
</defs>
</svg>

After

Width:  |  Height:  |  Size: 2.3 KiB

View File

@@ -0,0 +1,40 @@
<svg xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink" width="34px" height="34px" viewBox="0 0 34 34" version="1.1">
<defs>
<radialGradient id="radial0" gradientUnits="userSpaceOnUse" cx="0" cy="0" fx="0" fy="0" r="1" gradientTransform="matrix(-7.787324,-9.624098,9.028449,-7.305356,26.915817,14.703725)">
<stop offset="0.0955758" style="stop-color:rgb(0%,47.058824%,83.137255%);stop-opacity:1;"/>
<stop offset="0.715277" style="stop-color:rgb(4.705882%,43.921569%,60.784314%);stop-opacity:1;"/>
<stop offset="1" style="stop-color:rgb(3.921569%,31.372549%,47.45098%);stop-opacity:1;"/>
</radialGradient>
<radialGradient id="radial1" gradientUnits="userSpaceOnUse" cx="0" cy="0" fx="0" fy="0" r="1" gradientTransform="matrix(7.955722,8.152531,-8.011265,7.817866,7.897393,23.013892)">
<stop offset="0" style="stop-color:rgb(0%,56.862745%,92.156863%);stop-opacity:1;"/>
<stop offset="0.523516" style="stop-color:rgb(15.294118%,39.215686%,90.588235%);stop-opacity:1;"/>
<stop offset="0.923392" style="stop-color:rgb(2.352941%,21.176471%,76.470588%);stop-opacity:1;"/>
</radialGradient>
<linearGradient id="linear0" gradientUnits="userSpaceOnUse" x1="5.16831" y1="2" x2="7.75605" y2="17.2359" gradientTransform="matrix(1.416667,0,0,1.416667,0,0)">
<stop offset="0.289817" style="stop-color:rgb(0%,64.705882%,85.098039%);stop-opacity:1;"/>
<stop offset="0.662336" style="stop-color:rgb(12.941176%,79.215686%,69.803922%);stop-opacity:1;"/>
<stop offset="0.950002" style="stop-color:rgb(41.568627%,86.27451%,56.470588%);stop-opacity:1;"/>
</linearGradient>
<linearGradient id="linear1" gradientUnits="userSpaceOnUse" x1="7.25046" y1="2" x2="7.87502" y2="16.4401" gradientTransform="matrix(1.416667,0,0,1.416667,0,0)">
<stop offset="0" style="stop-color:rgb(6.27451%,78.823529%,92.54902%);stop-opacity:1;"/>
<stop offset="0.166667" style="stop-color:rgb(0.392157%,68.235294%,89.411765%);stop-opacity:0;"/>
</linearGradient>
<radialGradient id="radial2" gradientUnits="userSpaceOnUse" cx="0" cy="0" fx="0" fy="0" r="1" gradientTransform="matrix(-9.930588,25.254205,-30.30117,-11.915182,29.269325,8.70791)">
<stop offset="0.154405" style="stop-color:rgb(15.294118%,44.313725%,84.705882%);stop-opacity:1;"/>
<stop offset="0.678875" style="stop-color:rgb(7.843137%,69.411765%,100%);stop-opacity:1;"/>
<stop offset="0.931138" style="stop-color:rgb(8.627451%,74.901961%,87.45098%);stop-opacity:1;"/>
</radialGradient>
<linearGradient id="linear2" gradientUnits="userSpaceOnUse" x1="21.2403" y1="7.01008" x2="20.306" y2="12.5802" gradientTransform="matrix(1.416667,0,0,1.416667,0,0)">
<stop offset="0.0581535" style="stop-color:rgb(7.843137%,69.411765%,100%);stop-opacity:1;"/>
<stop offset="0.708063" style="stop-color:rgb(16.078431%,46.27451%,85.882353%);stop-opacity:0;"/>
</linearGradient>
</defs>
<g id="surface1">
<path style=" stroke:none;fill-rule:nonzero;fill:url(#radial0);" d="M 24.1875 5.1875 C 23.777344 3.792969 22.496094 2.832031 21.039062 2.832031 L 20.078125 2.832031 C 18.496094 2.832031 17.140625 3.960938 16.855469 5.519531 L 15.175781 14.625 L 15.628906 13.066406 C 16.039062 11.664062 17.320312 10.703125 18.777344 10.703125 L 24.335938 10.703125 L 26.667969 11.613281 L 28.917969 10.703125 L 28.261719 10.703125 C 26.804688 10.703125 25.523438 9.746094 25.113281 8.347656 Z M 24.1875 5.1875 "/>
<path style=" stroke:none;fill-rule:nonzero;fill:url(#radial1);" d="M 10.152344 28.796875 C 10.558594 30.199219 11.839844 31.167969 13.300781 31.167969 L 15.359375 31.167969 C 17.128906 31.167969 18.578125 29.765625 18.636719 27.996094 L 18.941406 19.011719 L 18.371094 20.945312 C 17.960938 22.339844 16.679688 23.296875 15.226562 23.296875 L 9.613281 23.296875 L 7.613281 22.210938 L 5.449219 23.296875 L 6.09375 23.296875 C 7.554688 23.296875 8.839844 24.261719 9.246094 25.664062 Z M 10.152344 28.796875 "/>
<path style=" stroke:none;fill-rule:nonzero;fill:url(#linear0);" d="M 20.898438 2.832031 L 9.535156 2.832031 C 6.289062 2.832031 4.339844 7.121094 3.042969 11.410156 C 1.503906 16.492188 -0.507812 23.289062 5.316406 23.289062 L 10.222656 23.289062 C 11.6875 23.289062 12.972656 22.320312 13.375 20.910156 C 14.230469 17.929688 15.722656 12.722656 16.898438 8.761719 C 17.496094 6.75 17.992188 5.019531 18.753906 3.941406 C 19.183594 3.339844 19.894531 2.832031 20.898438 2.832031 Z M 20.898438 2.832031 "/>
<path style=" stroke:none;fill-rule:nonzero;fill:url(#linear1);" d="M 20.898438 2.832031 L 9.535156 2.832031 C 6.289062 2.832031 4.339844 7.121094 3.042969 11.410156 C 1.503906 16.492188 -0.507812 23.289062 5.316406 23.289062 L 10.222656 23.289062 C 11.6875 23.289062 12.972656 22.320312 13.375 20.910156 C 14.230469 17.929688 15.722656 12.722656 16.898438 8.761719 C 17.496094 6.75 17.992188 5.019531 18.753906 3.941406 C 19.183594 3.339844 19.894531 2.832031 20.898438 2.832031 Z M 20.898438 2.832031 "/>
<path style=" stroke:none;fill-rule:nonzero;fill:url(#radial2);" d="M 13.101562 31.167969 L 24.464844 31.167969 C 27.710938 31.167969 29.660156 26.878906 30.957031 22.589844 C 32.496094 17.507812 34.507812 10.710938 28.6875 10.710938 L 23.78125 10.710938 C 22.3125 10.710938 21.027344 11.679688 20.625 13.089844 C 19.769531 16.074219 18.277344 21.277344 17.101562 25.238281 C 16.503906 27.253906 16.007812 28.980469 15.246094 30.058594 C 14.816406 30.660156 14.105469 31.167969 13.101562 31.167969 Z M 13.101562 31.167969 "/>
<path style=" stroke:none;fill-rule:nonzero;fill:url(#linear2);" d="M 13.101562 31.167969 L 24.464844 31.167969 C 27.710938 31.167969 29.660156 26.878906 30.957031 22.589844 C 32.496094 17.507812 34.507812 10.710938 28.6875 10.710938 L 23.78125 10.710938 C 22.3125 10.710938 21.027344 11.679688 20.625 13.089844 C 19.769531 16.074219 18.277344 21.277344 17.101562 25.238281 C 16.503906 27.253906 16.007812 28.980469 15.246094 30.058594 C 14.816406 30.660156 14.105469 31.167969 13.101562 31.167969 Z M 13.101562 31.167969 "/>
</g>
</svg>

After

Width:  |  Height:  |  Size: 5.8 KiB

View File

@@ -0,0 +1,127 @@
<svg width="68" height="72" viewBox="0 0 68 72" fill="none" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
<circle cx="34" cy="35" r="32" fill="#BFBFBF"/>
<g style="mix-blend-mode:multiply" filter="url(#filter0_ddd_1497_137613)">
<path d="M18 21.3999C18 19.1908 19.7909 17.3999 22 17.3999H43.6L50 23.7999V48.5999C50 50.809 48.2091 52.5999 46 52.5999H22C19.7909 52.5999 18 50.809 18 48.5999V21.3999Z" fill="white"/>
</g>
<g filter="url(#filter1_b_1497_137613)">
<path d="M18 21.3999C18 19.1908 19.7909 17.3999 22 17.3999H43.6L50 23.7999V48.5999C50 50.809 48.2091 52.5999 46 52.5999H22C19.7909 52.5999 18 50.809 18 48.5999V21.3999Z" fill="url(#paint0_linear_1497_137613)"/>
</g>
<g style="mix-blend-mode:hard-light" filter="url(#filter2_ii_1497_137613)">
<path d="M18 21.3999C18 19.1908 19.7909 17.3999 22 17.3999H43.6L50 23.7999V48.5999C50 50.809 48.2091 52.5999 46 52.5999H22C19.7909 52.5999 18 50.809 18 48.5999V21.3999Z" fill="#808080"/>
<path d="M18 21.3999C18 19.1908 19.7909 17.3999 22 17.3999H43.6L50 23.7999V48.5999C50 50.809 48.2091 52.5999 46 52.5999H22C19.7909 52.5999 18 50.809 18 48.5999V21.3999Z" fill="url(#pattern0)" fill-opacity="0.02"/>
</g>
<g style="mix-blend-mode:multiply" filter="url(#filter3_ddd_1497_137613)">
<path d="M43.6006 17.3999L50.0006 23.7999H47.6006C45.3914 23.7999 43.6006 22.009 43.6006 19.7999V17.3999Z" fill="white"/>
</g>
<g filter="url(#filter4_b_1497_137613)">
<path d="M43.6006 17.3999L50.0006 23.7999H47.6006C45.3914 23.7999 43.6006 22.009 43.6006 19.7999V17.3999Z" fill="url(#paint1_linear_1497_137613)"/>
</g>
<g style="mix-blend-mode:hard-light" filter="url(#filter5_ii_1497_137613)">
<path d="M43.6006 17.3999L50.0006 23.7999H47.6006C45.3914 23.7999 43.6006 22.009 43.6006 19.7999V17.3999Z" fill="#808080"/>
<path d="M43.6006 17.3999L50.0006 23.7999H47.6006C45.3914 23.7999 43.6006 22.009 43.6006 19.7999V17.3999Z" fill="url(#pattern1)" fill-opacity="0.02"/>
</g>
<circle cx="33.9994" cy="34.9999" r="9.6" fill="#BFBFBF"/>
<path d="M30.7998 34.9998L33.3598 37.5598L37.8398 32.7598" stroke="white" stroke-width="2" stroke-linecap="round" stroke-linejoin="round"/>
<path fill-rule="evenodd" clip-rule="evenodd" d="M41.6793 34.9998C41.6793 39.2414 38.2409 42.6798 33.9993 42.6798C29.7578 42.6798 26.3193 39.2414 26.3193 34.9998C26.3193 30.7583 29.7578 27.3198 33.9993 27.3198C38.2409 27.3198 41.6793 30.7583 41.6793 34.9998ZM33.9993 42.0398C37.8874 42.0398 41.0393 38.8879 41.0393 34.9998C41.0393 31.1117 37.8874 27.9598 33.9993 27.9598C30.1113 27.9598 26.9593 31.1117 26.9593 34.9998C26.9593 38.8879 30.1113 42.0398 33.9993 42.0398Z" fill="white"/>
<path fill-rule="evenodd" clip-rule="evenodd" d="M30.3899 22.3199C30.0451 22.3769 29.7748 22.6471 29.7179 22.9919C29.661 22.6471 29.3907 22.3769 29.0459 22.3199C29.3907 22.263 29.661 21.9928 29.7179 21.6479C29.7748 21.9928 30.0451 22.263 30.3899 22.3199Z" fill="white"/>
<path fill-rule="evenodd" clip-rule="evenodd" d="M29.5508 19.4641C30.2404 19.5779 30.781 20.1185 30.8948 20.8081C31.0086 20.1185 31.5491 19.5779 32.2388 19.4641C31.5491 19.3503 31.0086 18.8098 30.8948 18.1201C30.781 18.8098 30.2404 19.3503 29.5508 19.4641Z" fill="white"/>
<path fill-rule="evenodd" clip-rule="evenodd" d="M7.20776 22.3199C7.55259 22.3769 7.82285 22.6471 7.87976 22.9919C7.93667 22.6471 8.20693 22.3769 8.55176 22.3199C8.20693 22.263 7.93667 21.9928 7.87976 21.6479C7.82285 21.9928 7.55259 22.263 7.20776 22.3199Z" fill="white"/>
<path fill-rule="evenodd" clip-rule="evenodd" d="M8.04688 19.4641C7.35721 19.5779 6.81669 20.1185 6.70287 20.8081C6.58906 20.1185 6.04854 19.5779 5.35887 19.4641C6.04854 19.3503 6.58906 18.8098 6.70287 18.1201C6.81669 18.8098 7.35721 19.3503 8.04688 19.4641Z" fill="white"/>
<defs>
<filter id="filter0_ddd_1497_137613" x="0" y="0.399902" width="68" height="71.2002" filterUnits="userSpaceOnUse" color-interpolation-filters="sRGB">
<feFlood flood-opacity="0" result="BackgroundImageFix"/>
<feColorMatrix in="SourceAlpha" type="matrix" values="0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 127 0" result="hardAlpha"/>
<feOffset dy="3"/>
<feGaussianBlur stdDeviation="2.5"/>
<feColorMatrix type="matrix" values="0 0 0 0 0.25098 0 0 0 0 0.25098 0 0 0 0 0.25098 0 0 0 0.16 0"/>
<feBlend mode="normal" in2="BackgroundImageFix" result="effect1_dropShadow_1497_137613"/>
<feColorMatrix in="SourceAlpha" type="matrix" values="0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 127 0" result="hardAlpha"/>
<feOffset dy="1"/>
<feGaussianBlur stdDeviation="9"/>
<feColorMatrix type="matrix" values="0 0 0 0 0.25098 0 0 0 0 0.25098 0 0 0 0 0.25098 0 0 0 0.12 0"/>
<feBlend mode="normal" in2="effect1_dropShadow_1497_137613" result="effect2_dropShadow_1497_137613"/>
<feColorMatrix in="SourceAlpha" type="matrix" values="0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 127 0" result="hardAlpha"/>
<feOffset dy="6"/>
<feGaussianBlur stdDeviation="5"/>
<feColorMatrix type="matrix" values="0 0 0 0 0.25098 0 0 0 0 0.25098 0 0 0 0 0.25098 0 0 0 0.14 0"/>
<feBlend mode="normal" in2="effect2_dropShadow_1497_137613" result="effect3_dropShadow_1497_137613"/>
<feBlend mode="normal" in="SourceGraphic" in2="effect3_dropShadow_1497_137613" result="shape"/>
</filter>
<filter id="filter1_b_1497_137613" x="16" y="15.3999" width="36" height="39.2002" filterUnits="userSpaceOnUse" color-interpolation-filters="sRGB">
<feFlood flood-opacity="0" result="BackgroundImageFix"/>
<feGaussianBlur in="BackgroundImage" stdDeviation="1"/>
<feComposite in2="SourceAlpha" operator="in" result="effect1_backgroundBlur_1497_137613"/>
<feBlend mode="normal" in="SourceGraphic" in2="effect1_backgroundBlur_1497_137613" result="shape"/>
</filter>
<filter id="filter2_ii_1497_137613" x="18" y="17.3999" width="32" height="35.2002" filterUnits="userSpaceOnUse" color-interpolation-filters="sRGB">
<feFlood flood-opacity="0" result="BackgroundImageFix"/>
<feBlend mode="normal" in="SourceGraphic" in2="BackgroundImageFix" result="shape"/>
<feColorMatrix in="SourceAlpha" type="matrix" values="0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 127 0" result="hardAlpha"/>
<feOffset dy="1"/>
<feComposite in2="hardAlpha" operator="arithmetic" k2="-1" k3="1"/>
<feColorMatrix type="matrix" values="0 0 0 0 0.94902 0 0 0 0 0.94902 0 0 0 0 0.94902 0 0 0 0.5 0"/>
<feBlend mode="normal" in2="shape" result="effect1_innerShadow_1497_137613"/>
<feColorMatrix in="SourceAlpha" type="matrix" values="0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 127 0" result="hardAlpha"/>
<feOffset/>
<feGaussianBlur stdDeviation="3"/>
<feComposite in2="hardAlpha" operator="arithmetic" k2="-1" k3="1"/>
<feColorMatrix type="matrix" values="0 0 0 0 0.94902 0 0 0 0 0.94902 0 0 0 0 0.94902 0 0 0 1 0"/>
<feBlend mode="normal" in2="effect1_innerShadow_1497_137613" result="effect2_innerShadow_1497_137613"/>
</filter>
<pattern id="pattern0" patternContentUnits="objectBoundingBox" width="1.875" height="1.70455">
<use xlink:href="#image0_1497_137613" transform="scale(0.03125 0.0284091)"/>
</pattern>
<filter id="filter3_ddd_1497_137613" x="25.6006" y="0.399902" width="42.4004" height="42.3999" filterUnits="userSpaceOnUse" color-interpolation-filters="sRGB">
<feFlood flood-opacity="0" result="BackgroundImageFix"/>
<feColorMatrix in="SourceAlpha" type="matrix" values="0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 127 0" result="hardAlpha"/>
<feOffset dy="3"/>
<feGaussianBlur stdDeviation="2.5"/>
<feColorMatrix type="matrix" values="0 0 0 0 0.25098 0 0 0 0 0.25098 0 0 0 0 0.25098 0 0 0 0.16 0"/>
<feBlend mode="normal" in2="BackgroundImageFix" result="effect1_dropShadow_1497_137613"/>
<feColorMatrix in="SourceAlpha" type="matrix" values="0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 127 0" result="hardAlpha"/>
<feOffset dy="1"/>
<feGaussianBlur stdDeviation="9"/>
<feColorMatrix type="matrix" values="0 0 0 0 0.25098 0 0 0 0 0.25098 0 0 0 0 0.25098 0 0 0 0.12 0"/>
<feBlend mode="normal" in2="effect1_dropShadow_1497_137613" result="effect2_dropShadow_1497_137613"/>
<feColorMatrix in="SourceAlpha" type="matrix" values="0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 127 0" result="hardAlpha"/>
<feOffset dy="6"/>
<feGaussianBlur stdDeviation="5"/>
<feColorMatrix type="matrix" values="0 0 0 0 0.25098 0 0 0 0 0.25098 0 0 0 0 0.25098 0 0 0 0.14 0"/>
<feBlend mode="normal" in2="effect2_dropShadow_1497_137613" result="effect3_dropShadow_1497_137613"/>
<feBlend mode="normal" in="SourceGraphic" in2="effect3_dropShadow_1497_137613" result="shape"/>
</filter>
<filter id="filter4_b_1497_137613" x="41.6006" y="15.3999" width="10.4004" height="10.3999" filterUnits="userSpaceOnUse" color-interpolation-filters="sRGB">
<feFlood flood-opacity="0" result="BackgroundImageFix"/>
<feGaussianBlur in="BackgroundImage" stdDeviation="1"/>
<feComposite in2="SourceAlpha" operator="in" result="effect1_backgroundBlur_1497_137613"/>
<feBlend mode="normal" in="SourceGraphic" in2="effect1_backgroundBlur_1497_137613" result="shape"/>
</filter>
<filter id="filter5_ii_1497_137613" x="43.6006" y="17.3999" width="6.40039" height="6.3999" filterUnits="userSpaceOnUse" color-interpolation-filters="sRGB">
<feFlood flood-opacity="0" result="BackgroundImageFix"/>
<feBlend mode="normal" in="SourceGraphic" in2="BackgroundImageFix" result="shape"/>
<feColorMatrix in="SourceAlpha" type="matrix" values="0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 127 0" result="hardAlpha"/>
<feOffset dy="1"/>
<feComposite in2="hardAlpha" operator="arithmetic" k2="-1" k3="1"/>
<feColorMatrix type="matrix" values="0 0 0 0 0.94902 0 0 0 0 0.94902 0 0 0 0 0.94902 0 0 0 0.5 0"/>
<feBlend mode="normal" in2="shape" result="effect1_innerShadow_1497_137613"/>
<feColorMatrix in="SourceAlpha" type="matrix" values="0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 127 0" result="hardAlpha"/>
<feOffset/>
<feGaussianBlur stdDeviation="3"/>
<feComposite in2="hardAlpha" operator="arithmetic" k2="-1" k3="1"/>
<feColorMatrix type="matrix" values="0 0 0 0 0.94902 0 0 0 0 0.94902 0 0 0 0 0.94902 0 0 0 1 0"/>
<feBlend mode="normal" in2="effect1_innerShadow_1497_137613" result="effect2_innerShadow_1497_137613"/>
</filter>
<pattern id="pattern1" patternContentUnits="objectBoundingBox" width="9.375" height="9.375">
<use xlink:href="#image0_1497_137613" transform="scale(0.15625)"/>
</pattern>
<linearGradient id="paint0_linear_1497_137613" x1="34" y1="52.5999" x2="34" y2="17.3999" gradientUnits="userSpaceOnUse">
<stop stop-color="#F2F2F2" stop-opacity="0.5"/>
<stop offset="1" stop-color="#F2F2F2"/>
</linearGradient>
<linearGradient id="paint1_linear_1497_137613" x1="46.8006" y1="23.7999" x2="46.8006" y2="17.3999" gradientUnits="userSpaceOnUse">
<stop stop-color="#F2F2F2" stop-opacity="0.5"/>
<stop offset="1" stop-color="#F2F2F2"/>
</linearGradient>
<image id="image0_1497_137613" width="60" height="60" xlink:href="data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAADwAAAA8CAYAAAA6/NlyAAAM9ElEQVRoQ+WbS6iO3RvG1zv/HCcbiRhR2mJESlJbjBwmGwOH0laUHAaEJLXFwCG1FROHgcPEYbRFSaJtRKQYyCltTBxi/v77rc/v+e53efic+fo/k733+z7Peta67+u+7uu+19qNlFKz2Wwmr/fv36e//vorNRqN1NbWll68eJFWrlyZDh06lG/h856enrRq1ap0//79NH78eAbIn3d1deX7+HzcuHH5uSFDhqRdu3alhQsXpkGDBqXDhw/ncXzG927cuDHfV16My707d+5MW7Zsyb9znTx5Mi1atCiPe/r06Wo8xzl48GBavXp1y3Dt7e2pwWp56NSpU3nSXEz8xo0bqbOzM23evDlNnDgxL2Tq1Km1k+3u7k7Lly9PT548SW/evEkPHz7MBtFAdQu8d+9eNsqwYcOyUb2YC9/duXOneteFCxfS3r1708WLFz8a0+eYI89gEO5//fp1unLlSlq3bl3lFNbECrPJuPH58+dpxIgRlRVnzZqVX6K19LjeZIA4MV56/fr1NGDAgDyPjo6O/LyoiBbnfZs2baq8yj19fX1pypQpGRkgQRREBOqciB4dVaKD50Rhb29vdkS1YLyJl7HO4MGD0+XLl7N3gc6RI0eqiTsJ4CECNIgTixPw/hMnTqTFixe3IMTvWKjo0fjRc7t3706zZ8/OhovjAF++8xkd5LOEAWuIKMqQjhN89+5dOn78eMZ/tKyxVOcVJwu0jTPuZyy97SQcUzRhOIwsspxLNKjvNl4/CvQPCPVzx+jv70/Dhw9vCYNGT09Pk/iM+MeaWkUIAV/gFi8GBrY8Sxz698uXL/NnkNvYsWPTnDlzsvEw1s2bN9OBAwfSjBkzEvdJSBDP7du3M19w8TtXJCU9Vs5BD4O0JUuWZNLlAs4gFT7h3aAhQxpPMAm8Ey9wD2yYjGzM9yys9KYLEmJ4yEn7TLzH+OY7Gdh3C1vev2zZsvwxxnFhn+Iax/kc1+QF/2or8z5IZ/To0Wny5MkVAliQ6UYYx3DDyDDvvHnzsievXbuWn/UyhFywiAJtR48e/ZsHOjo6mmPGjKlYkcBnEuREXs53+/fvzy/CyqQMyArvleQUYyjGP+GBxy9dupQhbAqJKOFdkhqxt3Tp0gx7UEdoyCm+M44vWfEew6TUCDq1ysPANl7fwtpYG0P9yazdaGtra0I4JaUbd8ZNhBjW4n48Rkp59OhRTl2ID7xk/kNY4LlJkyZlDnCsFst++IPxZVXfheqD5UuOQRjhfREBhPWsOX/Hjh3p1q1bmf3hAuAMshpdXV1NYgnoMLCyMnpYliXutm/f3pJCmKQpRQka0wKLZTJOKhIPKcN7CZWRI0fmBZaCg3skQaD6+PHjKi8TFuRaWRjCO3/+fItyjA7KkMZbeoeBo3pSUzPpmFejAPF+BUQUIMZsjPlSoGDcuXPn5nDwvihY8CYeYg56TSaPjMwzIMpxTGOm1oxaIU3cQVaICAYDopIMi1aUlyJe65vHhSaeNTfrXYsOoMXCIJlt27alq1evZo/UhZEe5DsLG3OzaUsGVpJqDBELKrhAUKO3t7eJGIg52LSBIGEBwK2MQVHBQMat8GSBa9asqcaMOdkcavEQ41mmLlFmLEeol4a36MCQzI3Uxe979uypNEaultrb23PxwJfKRqSecatVzZHCxXtdJN6bOXNmjnEGJq6ix/gdj1DFYCCIJ5aKpqpoABdYR3LRKHXP+CyG3bdvX34XKM0xzAIV58aXrI3VYWEKCiSaLEjiVyczKESiCHAMIAaBRJXE5Bj72LFj+Z1CG/hj3GfPnuWxuCwzZW0NGHMwnxmjhMi5c+dyWMYFi04MnmNYSieOgTE5mZTiBQxhVLwKgWApjIQ3WZD1rF7XWLEQIMYhp1isx5RXpiyeFQVMHi2P0QkVuCVmB9DBfCLrR/hjCMIshygeVpXwUpnWuDWnxs4GL4OUtCZw9mJQvGbXIzYXuA+CAmJldeQETYexaGBBFC5kEn7yN8al42HBEtWi8tQCyLAk7lsaAN9DDixUIiG+5AVhKHNKiBb4kSPwEuixzuZZ5aIGjfk8xi7jYwAFEQw9bdq0KsXqzJbi4Uf0jEACsBUhpiI8YUcjavA6whGuos1c+yNSZwXpsm78nRUNRmBx9sVMV8Z0LCa4j0ahuiFygWQnpxBm2cNfIypUW8bcv4kK4jl2PCNRxU7ljxAVymLegVGePn2aVVds8LW0eBQIsVBwgU6uLM+IMYp0Cn+L+s/lVJQT+dq2kMwd+1r+zngwMhe/K3+j+lL6RqET05akRjMRovuItMpAjypJQrADSI0aCw7jMXqfOpq45hl+37p1a0ufq+w78Tf3WQkxpjFMakJBlXmdhSAvyRpohvisi1fONvr6+ppQvbm27DQYy7wYZo1dQxaB2ICg4IC6Ij0igglHUVAaKMZfbBZGweF4zENBRNjQf47awWf46TzhgLxgJ+EEzJ0xl5aCwclBGvPnz88vfPXqVe6QELOOESsWPGdBUZaAsSNZVx6a+33euRKrvA+nvX37NlddpCdJr1SROYZLC1owx8/5HQOws/A1iJBRo6W/BxGxHPwWRDQ6OzubeMaghtUspmU7oYq36G4SQxqlbpcA6FL2xfISOFG52EK1X4bxREFdj8wQI+Toczkmc1MolbkctHBNnz49x3VUYRVLl5UJZGWngoeBBpDEILZto4Uj9TMRmvkWG/G+qKycaCwO+MzOSUvh/mFTLcZmWcbyN+Nv2LAh801s8ltdNbq7u5t4jdiQVFRHDG4slOmonAxQw6vuH1nvWgTQRsJQFBEyP0bCqLGJT3HCFcvLWChopG/e5Sy3S7+m5YkUZaEQhdqYCdmWHTp0aO5kfGp30i7nr9ydrCAdC3IW8eDBg5wv3fON8EMEGBdCRZEgOohRvEXJJnKMe4wqm4ucKGwUO3W7FzFemSc9LutquIcGg8qOe4n9s2fP/pMygTS9rP9yjUu4xFqYharWYmcEhZZZOm6GS14xNUWp6HYHrB7jKJZ9piB+ooCsnhAGqrUyLgkD5WHMwyV3MKbziUWEmoH7ESWIEeSuY4FUmhUteVg2jenhd+3UI4YsTGKDXr2u4YR42fZhDeh0LhxaScv+/v4m3YefUXtq3T+pwqo8LDt/yZYjC1iwYEE6c+bMFx9viHu7tn49+CLD1533wDvferzB8tBeeY5ztlp+V7sFlWWeBnolu4K8UkUZbsDVwy8gydZyeX/LcYdG45827Zee6/gv7BCW5zpYNBekWLG0RxrqzlEQ3x5y4UFyLIwH+7rHq6jXwpAEn61fvz5L0oEDB2b1pGwsO6XUudbOP7NTmhsAdvyiTnXikfoVEDAlKooFlydwGAtRYUfDFMGChHCZDWTYsnjwb8VPhG3U/vwuCzM2AmTUqFGV2LAnlp+J57Qc0O5ibNvieSQkXqDqiduacQEMyguoj2NnIhYIHj7hyAIqiIY+hGLlxXimn5hf7a7EZoVHl2JruGxiMJ7FUNXEQ5LZ6I6BXx4g0YJUTbH7EDfUypzIMxhvxYoVLbuEThYDwyE06Lk88KZKgpwwCoxtk93QiOInGj4WL7G533LkAauycz5hwoTKg1iYM5Juf7pgVExdM436k8nTxyIc3IJVKztBJgxSPJjiuwkFDMD35Sm/eEAtanwQw44GIeYxKreP4rZPhjQdj7iJ/L27guXpuF+1K+hxKZzgxh/OscVDSK5du/bvBf/JBbvQjMeZWEhsJrYk63BulMOuHqYDBaCvti8tW8cDYm6nxj5yPJknUaCosLCNANnUOEVdyfagQfaWiHy3pWHcW2IsOcV4jWmQgsH2EqGk17mn2vLhBMDXHu5igK/ZCuF+YyxOtG4rpDzxV9bjEiC9sXgmWiRgEC7LRQmUWCau88E0zyHHDWmMYDzQqfQsZIQPEy4bAHomniLQa/HoBN7lqEXZCCh3DWKOLnNv2QtzbrFvFhsMZKKqeNBysCaTQSXFk3PAxdMAtHacvAornmP2KIMT+JMOuVULLvdpPeMRC3D3kfAMxohNAr3IzygzSWvm0CgIyi5p3PyK7zS2eTfNBOYljyhr4wGZKHvrjlll4VHqYHIg2xj0pNC/ETplH9rOhd60Vfon7lFlp9DT+n84NmwN39LTiv0qvBoLAzwXd+Bl2zqCiN6O8pM9H686eMc+VzyHZQUHlBEP36MEqyMPTORndz3Kfx8w9n7mP3WUXY+PtlpIK7+jyHdLE8N/yz9vxCLffz3yDBhc5GG5iqXVvPG0zZe2Pr/3+DGsj+z7FcePq+KBOtcNKCxTV2zD5ljLPraiwONGQNYyEU/ZuOMnwgUpat/KDkss+n/Ff9RUaclyirxHcX/37t3ctRBeLJZ6lQXZIKh6vR/+oy32gSWzWC19TkXVFQCQFedHovS1Vx1P6cUT+BrwU+dV/gf5nFrpDQ6oIQAAAABJRU5ErkJggg=="/>
</defs>
</svg>

After

Width:  |  Height:  |  Size: 15 KiB

Some files were not shown because too many files have changed in this diff Show More